2LQQA

Oxidized mrx1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
88
structure length
88
Chain Sequence
b'MVTAALTIYTTSWCGYCLRLKTALTANRIAYDEVDIEHNRAAAEFVGSVNGGNRTVPTVKFADGSTLTNPSADEVKAKLVKIAGLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative glutaredoxin Rv3198.1/MT3292
publication title Mycoredoxin-1 is one of the missing links in the oxidative stress defence mechanism of Mycobacteria.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 24
structure length 88
sequence length 88
ec nomenclature ec 1.-.-.-:
pdb deposition date 2012-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2lqqA00
2Z9SA 1DSBA 1GSEA 2H66A 2HZFA 2H76A 1TOFA 1FG4A 2TRXA 4Q5NA 4TN8A 2MMNA 4FYBA 4ZL7A 2HSHA 2MZCA 2VL2A 1LJRA 3KP9A 3M0FA 3JCML 4O7HA 4K9ZA 4F82A 1M2DA 1KEBA 5FHIA 3G7JA 3CXGA 1XVQA 3KCMA 9GSSA 1G6YA 3QR6A 5DBQA 1MTCA 1SL2B 3F4RA 2OBKA 3P2AA 2B5YA 3UVTA 5E59A 1MD3A 1SKRB 2E0QA 2ON5A 1IYIA 4MCUA 2P31A 3P8WA 3WGEA 3D4MA 2PERA 2NDOA 1B4QA 3A2XA 1HNAA 4V2NA 3TB2A 4XRDA 1PD21 3FY7A 2WZ9A 4HJMA 3TUEA 4FIWA 1WE0A 3IBHA 2CX4A 1O6JA 3ZLPA 2LEGA 2XC2A 1RK4A 4MLYA 1YEPA 1DE2A 2LNSA 5ABRA 4NMUA 1VF1A 1EGRA 2ALBA 5G5EA 1F9MA 2J23A 3APSA 2GQLA 1WP0A 2VCZA 4IGJA 4IS0A 2RUEA 13GSA 4WEYA 1J0FA 19GSA 2GT6A 4FO5A 2C3NA 5IPHA 1OKTA 2YANA 3FZ4A 4XIHA 1XW5A 2R6KA 3BJ5A 4O32A 12GSA 3VWUA 2QC7A 5B8BA 2PU9C 1AUCA 3VPQA 2HLSA 2X8CA 3HXSA 3ERFA 3IA1A 5CRDA 1A2LA 2YPMA 3FW2A 2PVQA 2C0FA 5F07A 1N8JA 5EPFA 2DJJA 5ECRB 1U6TA 4G10A 1TXXA 3R2QA 4KCEA 1QQ2A 1NM3A 3FK8A 4JBBA 1XXUA 5KN1A 2O8VB 4FYCA 2REMA 2M72A 1OAZA 5GSSA 3KTBA 4J57E 2VCXA 4IBPA 3ZMLA 2DJ3A 2KUCA 2VCTA 3QFAC 5ELGA 1T4ZA 3KMNA 2OKAA 4HOJA 3DVXA 1EOHA 3UJ1A 2A2RA 2LRCA 1MDKA 3FR6A 5J3RA 2GZPA 1M9AA 3MAKA 5DVBA 3ZZXA 2DMLA 2JACA 1T00A 3A2VA 3KP8A 1XZOA 2GQMA 2J9HA 3GKXA 2YWOA 4OO4A 4LMWA 5DQSA 3DWVA 2CAQA 2WS2A 1XWCA 1AIUA 2B6MA 3SWLA 4MF6A 4JZQA 4J56E 3GKKA 4PQHA 2R2JA 2B5EA 4HJ2A 5IIZA 11GSA 1Z7RA 2HXKA 4OMVA 1G6WA 4HQZA 1O7UA 1FO5A 3RAZA 3V1WA 4BWSA 2YOIA 1AXDA 4IP1A 4IQ1A 1B48A 2L5OA 3KEBA 2LQQA 2A4VA 4OD7A 3M3MA 1F3BA 5HFGA 2VLTA 2H1AA 1GSUA 1M7TA 2MMOA 4DSSA 1EP7A 1AQXA 2IJYA 1PA3A 3GL5A 2WJUA 2H1GA 4GLTA 4IJIA 2YJHA 5IMCA 5INYA 5COHA 5DALB 1E6BA 1XCCA 1X0RA 4X0XA 5E4WA 2FA4A 3IV4A 5HQPA 5F0GA 2B1LA 2F8FA 1BAYA 1WMJA 3PR8A 1GTUA 2C1YA 1PL1A 2DJ0A 1BG5A 1B9YC 1GSSA 1XOAA 4DEJA 3APQA 5DDLA 2CZ3A 4IHUA 1GRXA 6GSUA 2H73A 4KCAA 1QFNA 2K18A 3ZFLA 4XS4B 2V2GA 2YWNA 3UMAA 4I5QA 2K6VA 4POLA 1PRXA 3APOA 4KNDA 3UIWA 1PMTA 2VIMA 4MJCA 1NSWA 3HVSA 4I8BA 6GSVA 4N0VA 2DJ2A 3HYPA 4F0BA 5J9CA 4GF0A 3TRPA 3CMIA 17GSA 2VCVA 2R37A 2H1DA 3GHAA 3HDCA 2P0GA 4BVXA 4ZB9A 5G30A 2HYXA 4TRXA 5IOXA 5D9TA 2DJ1A 2FY6A 3A3TA 4FYUA 1IYHA 4POBA 3TKQA 1NW2A 3I43A 3BD2A 5ECLB 1OC8A 2FHEA 5JCGA 4HU9A 2CT6A 1OKDA 4K7OA 4I97A 4GTUA 5AGYA 1HQOA 2CQ9A 1R5PA 3TKSC 3DVWA 3F9UA 2LTKA 1XBSA 3IAM2 5B7CA 1AQVA 2DLXA 2PPTA 3EU3A 1JLWA 1WRYA 4TXOA 3DYRA 1EZKA 2QKEA 3NZNA 1XFLA 4OFNA 2HZEA 1X9WB 4ILFA 3IK7A 2G0FA 4KDXA 4ZL9A 2LNTA 3KGKA 1TU8A 3ZMKA 3CRTA 3TJJA 5IM9A 4NAXA 2C0DA 1PL2A 1TK0B 4MH3A 5C04A 1TRVA 3HZ8A 2F3MA 3Q6OA 4WF5A 1ZCPA 2FCHA 2QGVA 1GULA 4KSOA 1N2AA 1GLPA 1K0AA 1YJ6A 2JZSA 4ECCA 4ZB6A 5FWGA 1UVZA 5B8AA 1XVWA 4OO5A 5IMAA 2YP6A 4AJ6A 3W8SA 2VAFA 1R7HA 2FNOA 2L5LA 2DBCA 3Q19A 1GSQA 1K0NA 3CRUA 4MJAA 2HE3A 4N10A 2CAIA 4YQVA 16GSA 1OC9B 2VL3A 1WPIA 3GX0A 1OVNA 2VOCA 2LQOA 3EC3A 3C1RA 4QQ7A 2O87A 2VD1A 3HZ4A 4IVFA 1YEXA 1NHYA 1I5GA 4KDYA 2FD3A 1ERTA 3IOSA 4TVEA 4YAVA 3QPMA 5D9WA 5D73A 2FWHA 3H4KA 3UAPA 1G7OA 3TRXA 5LCZA 4PX1A 1JLVA 1VF2A 2R4VA 3VWWA 4K6XA 4MMMA 4OCEA 2R3XA 3G7YA 2MYGA 4HEA2 2FWGA 1PGTA 4L5OA 4GWRA 5CYYA 1HD2A 1HNBA 1YQ1A 3ME7A 5IPGA 3H79A 1THOA 1TU7A 4RQXA 5GAPD 3MNGA 3ISOA 2IN3A 1U3IA 3LORA 1B9XC 4EDZA 4D73A 1GNWA 2R5GA 2GLRA 1TRUA 3D0ZA 1TJDA 2YN1A 5C00A 1O8WA 3O6TA 3EVIA 4MABA 3KMOA 2GS3A 4GRFA 4ZBAA 1GL8A 3IK9A 4DSRA 1X5DA 1U88A 2NVLA 4F2IA 4GSSA 5ECPB 1K0DA 4MF5A 2RM5A 1JZRA 1TKDB 3C1SA 4MZCA 2WCIA 5ID2A 2C80A 3ERGA 4I6XA 3U5RE 1Z6MA 3RHBA 4IP6A 4V1Ap 1A0FA 4FH8A 4K7NA 5CP1A 3FHKA 3E3EA 4PNGA 1SK2A 3LG6A 5G1KA 3VFIA 1V9WA 3LEFA 3F63A 3HY2A 1UC7A 4V1Ag 3TJKA 3I9V2 3TCOA 5IQYA 5J5NA 2X8GA 1BYEA 1ZOFA 3GNJA 1FW1A 2M80A 22GSA 4ECJA 2D2ZA 2FWEA 2IIYA 3ZIVA 2YWMA 5JWRB 3LFLA 3IRAA 3KIJA 3D22A 2TIRA 5IO2A 2H6YA 4N11A 4N0ZA 5GZZB 3FZAA 2EC4A 1Y6EA 2XBQA 5DJLA 5ECMB 2RIIA 1DBYA 4LA1A 3DD3A 1BJXA 2VM1A 4KUNA 2C3QA 2E7PA 2VCWA 3KM6A 3WT2A 2AAWA 4HI7A 3HKRA 3IXRA 4ML6A 3GMFA 3LYPA 2I9HA 1GTIA 5ID2B 3QD9A 3KH7A 3CYNA 3I6AA 5HFKA 1V2AA 3G9BA 1AQWA 5KN3A 4MPGA 1TDIA 4PUAA 2IFQA 4KAEA 1EV4A 5CREA 1JFUA 1FAAA 2KOKA 2N5AA 1MEKA 3L4NA 2NPBA 2GQKA 2VL9A 3F3QA 1Z9HA 1X5EA 4V2LA 4NV5A 1U3AA 4ID0A 1ML6A 4NPBA 3TKRA 1B4PA 1F6MC 4OFTA 3DEXA 3DXBA 3TKSA 3ZVJD 3FR3A 4HU7A 2K8SA 2GT5A 4F0CA 2GSTA 2PN8A 2LJKA 2MMAA 4KSMA 4QL9A 5A4WA 3KD0A 3GV1A 1WJKA 5J4UA 1ST9A 1A2JA 3CSIA 3FEUA 4Q5RA 4WBJA 4MZWA 5ECKB 1EEMA 4TR1A 2PBJA 2OA7A 2JZTA 3F4SA 3F6FA 3L0HA 2EIRA 2B5XA 4K0NA 2JSYA 2VO4A 4G2EA 2IFQB 4K8MA 5ECHB 5F05A 2WDUA 4ISDA 3Q18A 1MDIA 2OE1A 3C7MA 3F6DA 1T3BA 1WWJA 5ECIB 5CRHA 3ZFBA 2TRCP 4L8EA 1TTZA 14GSA 1T4YA 2GTUA 3O76A 3TJBA 4XS6A 2DMMA 2VL2C 2YNXA 3MDKA 1UA5A 2KLXA 1V57A 3TOTA 3IDVA 1SJ6A 4NHZA 1FB6A 1PN9A 2C8UA 2V1MA 3HJOA 3HVVA 3TDGA 5LNKe 3GX8A 2CV4A 5G5FA 2GZZA 2JSZA 1LBKA 3WGXA 1ON4A 5JCUA 3VK9A 4KW6A 2L4QA 3N5OA 5G31A 2V6OA 4WR5A 1HNCA 1EEJA 4TOPA 4BWQA 2X8HA 1TW9A 2MBTA 3CSHA 4TR1B 3RHCA 3FKFA 2ZNMA 1QMVA 2WFCA 4PQIA 2DC5A 1KTEA 2HI7A 5CNWA 2F8AA 2RUFA 2CZ2A 4JE1A 5DQYA 2GSRA 4WXTA 1FVKA 4H86A 2LV3A 2V41A 1O81A 1FB0A 4X1UA 4XCSA 4MJBA 6GSTA 3H1NA 2H0IA 3RPNA 4XS1A 3D21A 1T1VA 3QDNA 3EMPA 5L71A 4J2FA 3U6VA 1M9BA 3US3A 4E8EA 4MF7A 4XRAA 3EWLA 3ZYWA 4DSSB 1I9DA 1K3YA 2IMFA 4YQMA 4MDCA 3W6GA 1BQ7A 2XPDA 3LQ7A 4Z7XA 1DUGA 2G2QA 1MD4A 1XPVA 1OE8A 1V58A 4WKWA 2H30A 4F03A 2VLUA 1XW6A 5DCGA 3CSJA 4YH2A 5H5QA 2OJLA 5ENUA 4EKZA 2L4CA 2HT9A 3HJMA 1CQGA 1S3AA 2ES7A 3E9JB 3VWXA 3BOAA 4IQAA 1PX6A 3GFKA 1ZMAA 4NXIA 1A0RP 3RDWA 2AHEA 2OE3A 3C8EA 4WBRD 2IWTA 4ECIA 3HA9A 3LSZA 2AV4A 2L57A 1F3AA 4EL1A 1GH2A 1ZZYA 4KH7A 4TR3A 3ZTLA 4WETA 3ME8A 3ED3A 18GSA 6GSXA 1ZYQB 5B6MA 1VF4A 1YDKA 5ECSA 2FGXA 1BX9A 5AIVA 3GIXA 4GSTA 2I3YA 3I69A 1GTBA 1QGVA 4PXOA 1PX7A 1V98A 2JU5A 3GA4A 2F9SA 2FLSA 2IL3A 1SKSB 6GSSA 4HZ4A 5H5SA 3ZRDA 5F06A 4YAPA 1TK5B 4L5LA 3A2WA 3GURA 5CRWA 1K0BA 4DVCA 4EUYA 4HQSA 2CVKA 1M2BA 1T7PB 1A23A 4IN0A 1W4VA 2RLIA 4RQRA 1YF1A 6GSYA 2LRTA 2CX3A 2X99A 5CRGA 2H72A 2LSTA 2OADA 4OWYA 3VPTA 4TXOB 5LD0A 1PKWA 1YKCA 1U87A 3QCPA 2HZEB 2HRNA 2LRNA 2GVPA 2DSAA 4NWYA 1EV9A 2BTOT 2GSQA 2O7KA 1J9BA 2LJRA 5G2ZA 3SBCA 3H93A 4LL1B 3UOMA 3S9FA 3EU4A 4K1FA 2JADA 2HSYA 3QFBC 5IMZA 4RUVA 3HVXA 1F37A 3EURA 2XBIA 3M9KA 5ECOB 5KN0A 1R4WA 2B3SA 2H1BA 3F8UA 4IW9A 1JZOA 1TI3A 5KEJA 4Q5QA 2O85A 3M8NA 1Z6NA 4O92A 4K7IA 3MSZA 4LLRA 4AJ8A 3AY8A 2L6CA 4LL4B 5D93A 4TR0A 1G7EA 4HS1A 1PSQA 1VRSD 2H71A 2XPEA 4MK3A 1E2YA 3EE2A 2MBSA 5ELAA 3ZIJA 5D96A 2HNLA 2AYTA 3GYKA 2C0EA 1NHOA 3VI5A 2DIYA 1URMA 2HFDA 1GTAA 1O85A 2H6XA 2VUPA 2GDRA 2YWIA 3KZQA 4DSQA 1Z5YE 2I81A 3L9SA 4PURA 3A5WA 3IC4A 3VURA 1YZXA 1A8YA 2OE0A 1SYRA 4OCFA 1T8EB 4ECBA 2N5BA 2VLVA 2CVDA 4I2TA 5D9VA 2HRFA 2WRTA 1KNGA 5JWOB 1GWCA 1SL0B 2LJAA 2L59A 3IR4A 4AGSA 1S3DA 1TRSA 3UBKA 2E2MA 2E2GA 3O3TA 4L0WA 3GSSA 3HHVA 1VGLA 4E8HA 10GSA 5AIXA 1H75A 2YZUA 4RI6A 6GSWA 1QUWA 2DIZA 4OFMA 1CQHA 2X64A 1USBA 2VCQA 3C71A 2LKUA 3GH9A 2YZHA 4HUAA 3D5JA 3VWVA 1YKAA 3D6IA 5A5KA 4ULXA 4D73B 3P7XA 5JWQB 3BBYA 4IJ3A 1SD8A 4L0UA 1TRWA 4MZBA 4JEDA 5DAKA 5ECQB 2M46A 3CBUA 5DJMA 3UARA 4IKHA 4HZ2A 1XW9A 2GZYA 5IOWA 3VI7A 2PVOC 1FVJA 5HR3A 3M1GA 2I1UA 1XWBA 5IMDA 1EGOA 2K9FA 5AN1A 1J08A 1YF0A 1GUHA 1UN2A 3ZREA 2EIQA 2NTOA 1GSDA 4EF0A 1AAZA 4BA7A 3KH9A 2IMDA 4PQ1A 1THXA 3MWHA 5IMVA 2WULA 4JR6A 2H6ZA 4RI7A 1SJIA 4N30A 4ML1A 2FA8A 3FYGA 3H8QA 1ACVA 1SK0A 1MDJA 5EY6A 4IELA 1XWGA 3L78A 3D4TA 1YY7A 3K8NA 3RPPA 1M99A 3GSTA 5CO3A 5D8IA 4GSNA 5AISA 1LU4A 1AC1A 3HCZA 1R5AA 3N9JA 1PKZA 3E0UA 3IPZA 5DAKB 1BEDA 4CHSA 2YV7A 4TKYA 2BJXA 2IPAA 4G9HA 1WIKA 1OE7A 1K3OA 3Q74A 2GSSA 1K0OA 3LXZA 1EP8A 1V40A 5A4VA 2P5RA 5IMFA 5DALA 3EYTA 2KHPA 2KP2A 3BCIA 20GSA 4HDEA 1EOGA 3DGQA 4JRRA 3TOUA 5J41A 4LMVA 3UVHA 4NV2A 1OYJA 3RBTA 4TW5A 2JZRA 1QK8A 3F0IA 5GAND 4Q5FA 2B1KA 1JHBA 4EO3A 2AB6A 4F9ZA 4JU5A 2XHFA 3LGCA 1W89A 3DIEA 4KDUA 2L6DA 3QAGA 1ABAA 4ZXGA 1ERWA 4CW9A 5EVOA 4ZIJA 2NBSA 2P5QA 1K0MA 2WGRA 1TI1A 1AW9A 2K8VA 4XS4A 4PUFC 1ZYEA 1KBNA 2H75A 2PGTA 3ZVJA 2PMTA 5EL8A 3W8JA 5HR2A 4EVMA 3ERWA 3GL3A 1H4OA 2H70A 1QXHA 4KA0A 1R26A 5FT3A 1A2MA 1Y25A 1DE1A 1K3LA 3L9VA 3WT1A 2IMEA 5F8BA 2H0HA 3NIVA 3FR9A 2BMXA 3TGZA 3L9UA 4POMA 3EINA 2V6KA 3QOUA 3PH9A 1X5CA 3LYKA 4K2DA 4ZBBA 2H74A 5HFIA 1O73A 3QMXA 5J9BA 3GUSA 2QSIA 1O8XA 3DKSA 2PUKC 2I4AA 3WGDA 2O89A 1SD9A 4ZILA 3UL3A 1B8XA 2C3TA 5H5RA 2KP1A 1GNEA 2A2SA 4CDOA 4EDYA 1X9SB 3GKMA 3TRQA 3BCKA 1Q98A 4O5RA 3TJGA 4KB3A 5KN2A 4XTSA 1VF3A 3FRCA 4V2MA 1GSFA 1GSYA 4MH2A 3J7Yb 2IMIA 1ZGNA 2VM2A 3EMXA 1Q4JA 1ERVA 3OR5A 2RM6A 1X9MB 2OBIA 1TK8B 1GUKA 3QAWA 2ZCTA 1SKWB 3GN3A 3M9JA 1ZL9A 4I2UA 4BL7A 3UBLA 4GQCA 1PQNA 4AJ7A 1ILOA 1OC3A 2C4JA 8GSSA 4MJEA 3P90A 2YCDA 5GSTA 5G1LA 1SJZA 2MMZA 1OC9A 2ZUPA 4POKA 1F2EA 4JR4A 3F3RA 4ZL8A 4ZBDA 1XOBA 4QL7A 4GQFA 3WYWA 5CAXA 3HD5A 1Z3EA 1XWKA 4BPYA 2F51A 3GH6A 1C72A 2JL4A 1JZDA 3DRNA 2CA8A 4KX4A 2WB9A 1Z7PA 3GTUA 3TKPA 4KGIA 4EC0A 1HYUA 1SK1A 2B7JA 1FOVA 4GXZA 4TXVA 4MA9A 4XHMA 3PINA 1WOUA 4WR4A 1A8LA 1RQMA 1GP1A 1TP9A 4MP4A 1XIYA 3KTLA 3DMLA 3ZITA 2H8LA 3IAS2 3LXTA 4WF4A 3PGTA 2AJQB 1SU9A 1SENA 3CTGA 4MPFA 3FZ9A 2VD0A 4KE3A 3WD6A 4GCIA 5IO0A 3UEMA 4EE0A 4PNFA 5JCWA 4G19A 4P3YB 2DJKA 2N5FA 3G7IA 3KJYA 5HR0A 3F4TA 1A24A 5A4UA 2EIOA 3CTFA 3IE3A 2H0GA 5B6NA 2IMKA 1SL1B 1M0UA 1ERUA 5ECNB 2YV9A 2GGTA 2LUSA 4K0GA 4PGTA 4AF2A 3KXOA 2H01A 4X43A 3QAVA 3GTUB 2OACA 3LWAA 4ZB8A 3J7Yk 3IHQA 1EWXA 3NOFA 2PWJA 2FWFA 2C0GA 3VLNA 1XWAA 1S3CA 5HR1A 5DCHA 3TKSE 2CVBA 4EXJA 1G0TA 2YJ7A 3GKNA 3GRXA 2H19A 7GSSA 2FUG2 2AUVA 1M2AA 4NHWA 1RW1A 4BVYA 1FHEA 3HJPA 2ON7A 4ACSA 4TR4A 2B7KA 1JZWA 1K0CA 3TJFA 1GUMA 3FZ5A 2LS5A 2V32A 1GLQA 5D9XA 3LJRA 1SYXA 3ZL5A 3C73A 4YQUA
chains in the Genus database with same CATH superfamily
2Z9SA 1DSBA 1GSEA 2H66A 2HZFA 2H76A 1TOFA 1FG4A 2TRXA 4Q5NA 4TN8A 2MMNA 4FYBA 4K5RA 4ZL7A 2HSHA 2MZCA 2VL2A 1LJRA 3KP9A 2QA1A 3M0FA 3JCML 4O7HA 4K9ZA 4F82A 1M2DA 1KEBA 5FHIA 3G7JA 3CXGA 1XVQA 3KCMA 9GSSA 1G6YA 3QR6A 5DBQA 1MTCA 2HRAA 3F4RA 1SL2B 2OBKA 3P2AA 2B5YA 3UVTA 5E59A 1MD3A 1SKRB 2E0QA 2ON5A 1IYIA 4MCUA 4BVYB 2P31A 3P8WA 3WGEA 3D4MA 2PERA 2NDOA 1B4QA 3A2XA 1HNAA 4V2NA 3TB2A 4XRDA 1PD21 3FY7A 2WZ9A 4HJMA 3TUEA 4FIWA 1WE0A 3IBHA 2CX4A 3R3EA 1O6JA 2R0CA 3ZLPA 2LEGA 2XC2A 1RK4A 4MLYA 1YEPA 1DE2A 2LNSA 5ABRA 4NMUA 1VF1A 1EGRA 2ALBA 5G5EA 1F9MA 2J23A 3APSA 2GQLA 1WP0A 2VCZA 4IGJA 4IS0A 2RUEA 13GSA 4WEYA 1J0FA 19GSA 2GT6A 4FO5A 2C3NA 5IPHA 1OKTA 2YANA 2X49A 3FZ4A 4XIHA 1XW5A 2R6KA 3BJ5A 4O32A 12GSA 3VWUA 2QC7A 5B8BA 2PU9C 1AUCA 3VPQA 2HLSA 2X8CA 3HXSA 3ERFA 3IA1A 5CRDA 1A2LA 2YPMA 3FW2A 2PVQA 2C0FA 5F07A 1N8JA 5EPFA 2DJJA 5ECRB 1U6TA 4G10A 1TXXA 3R2QA 4KCEA 1QQ2A 4Z2UA 1NM3A 3FK8A 4JBBA 1XXUA 5KN1A 2O8VB 4FYCA 2REMA 2M72A 1OAZA 5GSSA 3KTBA 4J57E 2VCXA 4IBPA 3ZMLA 2DJ3A 2KUCA 2VCTA 3QFAC 5ELGA 1T4ZA 4CY8A 3KMNA 2OKAA 4HOJA 3DVXA 1EOHA 3UJ1A 2A2RA 2LRCA 1MDKA 3FR6A 5J3RA 2GZPA 1M9AA 3MAKA 5DVBA 3ZZXA 2DMLA 2JACA 1T00A 3A2VA 3KP8A 1XZOA 2GQMA 2J9HA 3GKXA 2YWOA 4OO4A 4LMWA 5DQSA 3DWVA 2CAQA 2WS2A 1XWCA 1AIUA 2B6MA 3SWLA 4MF6A 4JZQA 4J56E 3GKKA 4PQHA 2R2JA 2B5EA 4HJ2A 5IIZA 11GSA 1Z7RA 2HXKA 4OMVA 1G6WA 4HQZA 1O7UA 4USSA 1FO5A 3RAZA 3V1WA 4BWSA 2YOIA 1AXDA 4IP1A 4IQ1A 1B48A 2L5OA 3KEBA 2LQQA 2A4VA 4OD7A 3M3MA 1F3BA 5HFGA 2VLTA 2H1AA 1GSUA 2A2PA 1M7TA 2MMOA 4DSSA 1EP7A 1AQXA 4G0KA 2IJYA 1PA3A 3GL5A 2WJUA 2H1GA 4GLTA 4Z2TA 4IJIA 2YJHA 5IMCA 5INYA 5COHA 5DALB 5KOWA 1E6BA 1XCCA 1X0RA 4X0XA 2A4HA 5E4WA 2FA4A 3IV4A 5HQPA 3PPUA 5F0GA 2B1LA 2F8FA 1BAYA 1WMJA 3PR8A 4O5QA 1GTUA 2C1YA 4KF9A 1PL1A 2DJ0A 1BG5A 1B9YC 1GSSA 1XOAA 4DEJA 3APQA 5DDLA 2CZ3A 4IHUA 2HRKA 1GRXA 6GSUA 2H73A 4KCAA 1QFNA 2K18A 3ZFLA 4XS4B 2V2GA 2YWNA 3UMAA 4I5QA 2K6VA 4POLA 1PRXA 3APOA 4KNDA 3UIWA 1PMTA 2VIMA 4MJCA 5BMUA 1NSWA 3HVSA 4I8BA 6GSVA 4N0VA 2DJ2A 3HYPA 4F0BA 5J9CA 4GF0A 3TRPA 3CMIA 17GSA 2VCVA 2R37A 2H1DA 3GHAA 3HDCA 2P0GA 4BVXA 4ZB9A 5G30A 2HYXA 4TRXA 5IOXA 5D9TA 2DJ1A 2FY6A 3A3TA 4FYUA 1IYHA 4POBA 3TKQA 1NW2A 3I43A 3BD2A 5ECLB 1OC8A 2FHEA 5JCGA 4HU9A 2CT6A 1OKDA 4K7OA 4I97A 4GTUA 5AGYA 1HQOA 2CQ9A 1R5PA 3TKSC 3DVWA 3F9UA 2LTKA 1XBSA 3IAM2 5B7CA 1AQVA 2DLXA 2PPTA 3MIXA 3EU3A 1JLWA 1WRYA 4TXOA 3DYRA 4X4JA 1EZKA 2QKEA 3NZNA 1XFLA 4OFNA 2HZEA 1X9WB 4ILFA 3IK7A 2G0FA 4KDXA 4ZL9A 2LNTA 3KGKA 1TU8A 3ZMKA 3CRTA 3TJJA 5IM9A 4NAXA 1ZYPA 2C0DA 1PL2A 1S3RA 1TK0B 4MH3A 5C04A 1TRVA 3HZ8A 2F3MA 3Q6OA 4WF5A 1ZCPA 2FCHA 2QGVA 1GULA 4KSOA 1N2AA 1GLPA 1K0AA 1YJ6A 2JZSA 4ECCA 4ZB6A 5FWGA 1UVZA 4BVXB 5B8AA 1XVWA 4OO5A 5IMAA 2YP6A 4AJ6A 3W8SA 2VAFA 1M3JA 1R7HA 2FNOA 2L5LA 2DBCA 3Q19A 4BL7B 1GSQA 1K0NA 3CRUA 4MJAA 2HE3A 4N10A 2CAIA 3IC8A 2QA2A 4YQVA 16GSA 1OC9B 2VL3A 1WPIA 3GX0A 1OVNA 2VOCA 2LQOA 3EC3A 3C1RA 4QQ7A 2O87A 2VD1A 3HZ4A 4IVFA 1YEXA 1NHYA 1I5GA 4KDYA 2FD3A 1ERTA 3IOSA 4TVEA 4YAVA 3QPMA 5D9WA 5D73A 2FWHA 3H4KA 3UAPA 1G7OA 3TRXA 5LCZA 4PX1A 1JLVA 1VF2A 2R4VA 3VWWA 4K6XA 4MMMA 4OCEA 2R3XA 3G7YA 2MYGA 4HEA2 2FWGA 1PGTA 4L5OA 4GWRA 5CYYA 1HD2A 1HNBA 1YQ1A 3ME7A 5IPGA 3H79A 1THOA 1TU7A 4RQXA 5GAPD 3MNGA 3ISOA 2IN3A 1U3IA 3LORA 1B9XC 4EDZA 4D73A 1GNWA 2R5GA 2GLRA 1TRUA 3D0ZA 1TJDA 2YN1A 5C00A 1O8WA 3O6TA 3EVIA 4MABA 3KMOA 2GS3A 4GRFA 4ZBAA 1GL8A 3IK9A 4DSRA 1X5DA 1U88A 2NVLA 4F2IA 4GSSA 5ECPB 1K0DA 4MF5A 2RM5A 1JZRA 1TKDB 3C1SA 4MZCA 2WCIA 5ID2A 2C80A 3ERGA 4I6XA 3U5RE 1Z6MA 3RHBA 4IP6A 4V1Ap 1A0FA 4FH8A 4K7NA 5CP1A 2HSMA 3FHKA 3E3EA 4PNGA 1SK2A 3LG6A 5G1KA 3VFIA 1V9WA 3LEFA 3F63A 3HY2A 1UC7A 4V1Ag 3TJKA 3I9V2 3TCOA 5IQYA 5J5NA 2X8GA 1BYEA 1ZOFA 3GNJA 1FW1A 2M80A 22GSA 4ECJA 2D2ZA 2FWEA 2IIYA 3ZIVA 2YWMA 5JWRB 3LFLA 3IRAA 3KIJA 3D22A 2TIRA 5IO2A 2H6YA 4N11A 4N0ZA 5GZZB 3FZAA 2EC4A 1Y6EA 2XBQA 5DJLA 5ECMB 2RIIA 1DBYA 4LA1A 3DD3A 1BJXA 2VM1A 4KUNA 2C3QA 2E7PA 2VCWA 3KM6A 3WT2A 2AAWA 4HI7A 3HKRA 3IXRA 4ML6A 3GMFA 3LYPA 2I9HA 1GTIA 5ID2B 3QD9A 3KH7A 3CYNA 3I6AA 5HFKA 1V2AA 3G9BA 1AQWA 5KN3A 4MPGA 1TDIA 4PUAA 2IFQA 4KAEA 1EV4A 5CREA 1JFUA 1FAAA 2KOKA 2N5AA 1MEKA 3FMWA 3L4NA 2NPBA 2GQKA 2VL9A 3F3QA 1Z9HA 1X5EA 4BIKA 4V2LA 4NV5A 1U3AA 4ID0A 1ML6A 4NPBA 3TKRA 1B4PA 1F6MC 4OFTA 3DEXA 3DXBA 3TKSA 3ZVJD 3FR3A 4HU7A 2K8SA 3CQFA 2GT5A 4F0CA 2GSTA 2PN8A 2LJKA 2MMAA 4KSMA 4QL9A 5A4WA 3KD0A 3GV1A 1M3IA 1WJKA 5J4UA 1ST9A 1A2JA 3CSIA 3FEUA 4Q5RA 4WBJA 4MZWA 5ECKB 1EEMA 4TR1A 2PBJA 2OA7A 2JZTA 3F4SA 3F6FA 3L0HA 2EIRA 2B5XA 4K0NA 2JSYA 2VO4A 4G2EA 2IFQB 4K8MA 5ECHB 5F05A 2WDUA 4ISDA 3Q18A 2R0GA 1MDIA 2OE1A 3C7MA 5BRTA 3F6DA 1T3BA 1WWJA 5ECIB 5CRHA 3ZFBA 2TRCP 4L8EA 1TTZA 14GSA 1T4YA 2GTUA 3O76A 3TJBA 4XS6A 2DMMA 2VL2C 2YNXA 3MDKA 1UA5A 2KLXA 1V57A 3TOTA 3IDVA 1SJ6A 4NHZA 1FB6A 1PN9A 2C8UA 2V1MA 3HJOA 3HVVA 3TDGA 5LNKe 3GX8A 2CV4A 5G5FA 2GZZA 2JSZA 1LBKA 3WGXA 1ON4A 5JCUA 3VK9A 4KW6A 2L4QA 3N5OA 5G31A 2V6OA 4WR5A 1HNCA 1EEJA 4TOPA 4BWQA 2X8HA 1TW9A 2MBTA 3CSHA 4TR1B 3RHCA 3FKFA 2ZNMA 1QMVA 2WFCA 4PQIA 2DC5A 1KTEA 2HI7A 5CNWA 4G0IA 2F8AA 2RUFA 3MYDA 2CZ2A 4JE1A 5DQYA 2GSRA 4WXTA 1FVKA 4H86A 2LV3A 2V41A 1O81A 1FB0A 4X1UA 4XCSA 4MJBA 6GSTA 3H1NA 2H0IA 3RPNA 4XS1A 3D21A 1T1VA 3QDNA 3EMPA 5L71A 4J2FA 3U6VA 1M9BA 3US3A 4E8EA 4MF7A 4XRAA 3EWLA 3ZYWA 4DSSB 1I9DA 1K3YA 2IMFA 4YQMA 4MDCA 3W6GA 1BQ7A 4G0LA 2XPDA 3LQ7A 4Z7XA 1DUGA 2G2QA 1MD4A 1XPVA 1OE8A 1V58A 4WKWA 2H30A 4F03A 2VLUA 1XW6A 5DCGA 3CSJA 4YH2A 5H5QA 2DKIA 2OJLA 5ENUA 4EKZA 2L4CA 2HT9A 3HJMA 1CQGA 1S3AA 2ES7A 3E9JB 3VWXA 3BOAA 4IQAA 1PX6A 3GFKA 1ZMAA 4NXIA 1A0RP 3RDWA 2AHEA 2OE3A 3C8EA 4WBRD 2IWTA 4ECIA 3HA9A 3LSZA 2AV4A 2L57A 1F3AA 4EL1A 1GH2A 1ZZYA 4KH7A 4TR3A 3ZTLA 4WETA 3ME8A 3ED3A 18GSA 6GSXA 1ZYQB 5B6MA 1VF4A 1YDKA 5ECSA 2FGXA 1BX9A 5AIVA 3GIXA 4GSTA 2I3YA 3I69A 1GTBA 1QGVA 4PXOA 1PX7A 1V98A 2JU5A 3GA4A 2F9SA 2FLSA 2IL3A 1SKSB 6GSSA 4HSCX 4HZ4A 5H5SA 3ZRDA 5F06A 4YAPA 1TK5B 4L5LA 3A2WA 3GURA 5CRWA 1K0BA 4DVCA 4EUYA 4HQSA 2CVKA 1M2BA 1T7PB 1A23A 4IN0A 1W4VA 2RLIA 4RQRA 1YF1A 6GSYA 2LRTA 2CX3A 2X99A 1PFOA 5CRGA 2H72A 2LSTA 2OADA 4OWYA 3VPTA 4TXOB 5LD0A 1PKWA 1YKCA 1U87A 3QCPA 2HZEB 2HRNA 2LRNA 2GVPA 2DSAA 4NWYA 1EV9A 2BTOT 2GSQA 2O7KA 1J9BA 2LJRA 5G2ZA 3SBCA 3H93A 4LL1B 3UOMA 3S9FA 3EU4A 4K1FA 2JADA 2HSYA 3QFBC 5IMZA 4RUVA 3HVXA 1F37A 3EURA 2XBIA 3M9KA 5ECOB 5KN0A 1R4WA 2B3SA 2H1BA 3F8UA 4IW9A 1JZOA 1TI3A 5KEJA 4Q5QA 2O85A 3M8NA 1Z6NA 4O92A 4K7IA 3MSZA 4LLRA 4AJ8A 3AY8A 2L6CA 4LL4B 5D93A 4TR0A 1G7EA 4HS1A 1PSQA 1VRSD 2H71A 2XPEA 4MK3A 1E2YA 3EE2A 4YKGA 2MBSA 5ELAA 3ZIJA 5D96A 2HNLA 2AYTA 3GYKA 5KOXA 2C0EA 1NHOA 3VI5A 2DIYA 1URMA 2HFDA 1GTAA 1O85A 2H6XA 2VUPA 2GDRA 2YWIA 3KZQA 4DSQA 1Z5YE 2I81A 3L9SA 4PURA 3A5WA 3IC4A 3VURA 1YZXA 1A8YA 2OE0A 1SYRA 2UZ8A 4OCFA 1T8EB 4ECBA 2N5BA 2VLVA 2CVDA 4I2TA 5D9VA 2HRFA 2WRTA 1KNGA 5JWOB 1GWCA 1SL0B 2LJAA 2L59A 3IR4A 4AGSA 1S3DA 1TRSA 3UBKA 2E2MA 3IHGA 2E2GA 3O3TA 4L0WA 3GSSA 3HHVA 1VGLA 4E8HA 10GSA 5AIXA 1H75A 2YZUA 4RI6A 6GSWA 1QUWA 2DIZA 4OFMA 1CQHA 2X64A 1USBA 2VCQA 3C71A 2LKUA 3GH9A 2YZHA 4HUAA 3D5JA 3VWVA 1YKAA 3D6IA 5A5KA 4EIPA 4ULXA 3EPTA 4D73B 3P7XA 5JWQB 3BBYA 4IJ3A 1SD8A 4L0UA 1TRWA 4MZBA 4JEDA 5DAKA 5ECQB 2M46A 3CBUA 5DJMA 4CY6A 3UARA 4IKHA 4HZ2A 1XW9A 2GZYA 5IOWA 3VI7A 2PVOC 1FVJA 5HR3A 3M1GA 2I1UA 1XWBA 5IMDA 1EGOA 3HVNA 2K9FA 5AN1A 1J08A 1YF0A 1GUHA 1UN2A 3ZREA 2EIQA 2NTOA 1GSDA 4EF0A 1AAZA 4BA7A 3KH9A 2IMDA 4PQ1A 1THXA 3MWHA 5IMVA 2WULA 4JR6A 2H6ZA 4RI7A 1SJIA 4N30A 4ML1A 2FA8A 3FYGA 3H8QA 1ACVA 1SK0A 1MDJA 5EY6A 4IELA 1XWGA 3L78A 3D4TA 1YY7A 3K8NA 3RPPA 1M99A 3GSTA 5CO3A 5D8IA 4GSNA 5AISA 1LU4A 1AC1A 3HCZA 1R5AA 3N9JA 1PKZA 3E0UA 3IPZA 5DAKB 1BEDA 4CHSA 2YV7A 4TKYA 2BJXA 2IPAA 4G9HA 1WIKA 1OE7A 1K3OA 3Q74A 2GSSA 1K0OA 3LXZA 1EP8A 1V40A 5A4VA 2P5RA 5IMFA 5DALA 3EYTA 2KHPA 2KP2A 3BCIA 20GSA 4HDEA 1EOGA 3DGQA 4JRRA 3TOUA 5J41A 4LMVA 3UVHA 4NV2A 1OYJA 3RBTA 4TW5A 2JZRA 1QK8A 3LW9A 3F0IA 5GAND 4Q5FA 2B1KA 1JHBA 4EO3A 2AB6A 4F9ZA 4JU5A 2XHFA 3LGCA 1W89A 3DIEA 4KDUA 2L6DA 3QAGA 1ABAA 4ZXGA 1ERWA 4CW9A 5EVOA 4ZIJA 2NBSA 2P5QA 1K0MA 2WGRA 1TI1A 1AW9A 2K8VA 4XS4A 4PUFC 1ZYEA 1KBNA 2H75A 2PGTA 3ZVJA 2PMTA 5EL8A 3W8JA 5HR2A 4EVMA 3ERWA 3GL3A 4PTSA 1H4OA 2H70A 1QXHA 4KA0A 1R26A 5FT3A 1A2MA 1Y25A 1DE1A 4K2XA 1K3LA 3L9VA 3WT1A 2IMEA 5F8BA 2H0HA 3NIVA 3FR9A 2BMXA 3TGZA 3L9UA 4POMA 3EINA 2V6KA 3QOUA 3PH9A 1X5CA 3LYKA 4K2DA 4ZBBA 2H74A 5HFIA 1O73A 3QMXA 5J9BA 3GUSA 2QSIA 1O8XA 3DKSA 2PUKC 2I4AA 3WGDA 2O89A 1SD9A 4YKFA 4ZILA 3UL3A 1B8XA 2C3TA 5H5RA 2KP1A 2DKHA 1GNEA 2A2SA 4Z2RA 4CDOA 4EDYA 1X9SB 3GKMA 3TRQA 1PN0A 3BCKA 1Q98A 4O5RA 3TJGA 4KB3A 5KN2A 4XTSA 4MNNA 1VF3A 3FRCA 4V2MA 1GSFA 1GSYA 4MH2A 3J7Yb 2IMIA 1ZGNA 2VM2A 3EMXA 1Q4JA 1ERVA 3OR5A 2RM6A 1X9MB 2OBIA 1TK8B 1GUKA 3QAWA 2ZCTA 1SKWB 1XG8A 3GN3A 3A5IA 3M9JA 1ZL9A 4I2UA 4BL7A 4ICYA 3UBLA 4GQCA 1PQNA 4AJ7A 1ILOA 1OC3A 2C4JA 8GSSA 4MJEA 3P90A 2YCDA 5GSTA 5G1LA 1SJZA 2MMZA 1OC9A 2ZUPA 4POKA 1F2EA 4JR4A 3F3RA 4ZL8A 4ZBDA 1XOBA 4QL7A 4GQFA 3WYWA 5CAXA 3HD5A 1Z3EA 1XWKA 4BPYA 2F51A 3GH6A 1C72A 4EIQA 2JL4A 1JZDA 3DRNA 2CA8A 4KX4A 2WB9A 1Z7PA 2X4AA 3GTUA 3TKPA 4KGIA 4EC0A 1HYUA 1SK1A 2B7JA 1FOVA 4GXZA 4TXVA 4MA9A 4XHMA 1FOHA 3PINA 1WOUA 4WR4A 1A8LA 1RQMA 1GP1A 1TP9A 4MP4A 1XIYA 3KTLA 3DMLA 3ZITA 2H8LA 3IAS2 3LXTA 4WF4A 3PGTA 4A5PA 2AJQB 1SU9A 1SENA 3CTGA 4MPFA 3FZ9A 2VD0A 2R0PA 4KE3A 3WD6A 4GCIA 5IO0A 3UEMA 4EE0A 4PNFA 5JCWA 4G19A 4P3YB 2DJKA 2N5FA 3G7IA 3KJYA 4FQUA 3F4TA 5HR0A 1A24A 5A4UA 2EIOA 3CTFA 3IE3A 2H0GA 5B6NA 2IMKA 1SL1B 1M0UA 1ERUA 5ECNB 2YV9A 2GGTA 2LUSA 4K0GA 4PGTA 4AF2A 3KXOA 2H01A 4X43A 3QAVA 3GTUB 2OACA 3LWAA 4ZB8A 3J7Yk 3IHQA 1EWXA 3NOFA 2PWJA 2FWFA 2C0GA 3VLNA 1XWAA 1S3CA 5HR1A 5DCHA 3TKSE 2CVBA 4EXJA 1G0TA 2YJ7A 3GKNA 3GRXA 2H19A 7GSSA 2FUG2 2AUVA 1M2AA 4NHWA 1RW1A 4BVYA 4K5SA 1FHEA 3HJPA 2ON7A 4ACSA 4TR4A 2B7KA 1JZWA 1K0CA 1ZYNA 4O5UA 3TJFA 1GUMA 3FZ5A 2LS5A 2V32A 1GLQA 5D9XA 3LJRA 1SYXA 3ZL5A 3C73A 4YQUA
chains in the Genus database with same CATH topology
2Z9SA 1DSBA 1GSEA 2H66A 2HZFA 2H76A 1TOFA 1FG4A 2TRXA 4Q5NA 4TN8A 2MMNA 4FYBA 4K5RA 4ZL7A 2HSHA 2MZCA 2VL2A 1LJRA 3KP9A 2QA1A 3M0FA 3JCML 4O7HA 4K9ZA 4F82A 1M2DA 1KEBA 5FHIA 3G7JA 3CXGA 1XVQA 3KCMA 9GSSA 1G6YA 3QR6A 5DBQA 1MTCA 2HRAA 3F4RA 1SL2B 2OBKA 3P2AA 2B5YA 3UVTA 5E59A 1MD3A 1SKRB 2E0QA 2ON5A 1IYIA 4MCUA 4BVYB 2P31A 3P8WA 3WGEA 3D4MA 2PERA 2NDOA 1B4QA 3A2XA 1HNAA 4V2NA 3TB2A 4XRDA 1PD21 3FY7A 2WZ9A 4HJMA 3TUEA 4FIWA 1WE0A 3IBHA 2CX4A 3R3EA 1O6JA 2R0CA 3ZLPA 2LEGA 2XC2A 1RK4A 4MLYA 1YEPA 1DE2A 2LNSA 5ABRA 4NMUA 1VF1A 1EGRA 2ALBA 5G5EA 1F9MA 2J23A 3APSA 2GQLA 1WP0A 2VCZA 4IGJA 4IS0A 2RUEA 13GSA 4WEYA 1J0FA 19GSA 2GT6A 4FO5A 2C3NA 5IPHA 1OKTA 2YANA 2X49A 3FZ4A 4XIHA 1XW5A 2R6KA 3BJ5A 4O32A 12GSA 3VWUA 2QC7A 5B8BA 2PU9C 1AUCA 3VPQA 2HLSA 2X8CA 3HXSA 3ERFA 3IA1A 5CRDA 1A2LA 2YPMA 3FW2A 2PVQA 2C0FA 5F07A 1N8JA 5EPFA 2DJJA 5ECRB 1U6TA 4G10A 1TXXA 3R2QA 4KCEA 1QQ2A 4Z2UA 1NM3A 3FK8A 4JBBA 1XXUA 5KN1A 2O8VB 4FYCA 2REMA 2M72A 1OAZA 5GSSA 3KTBA 4J57E 2VCXA 4IBPA 3ZMLA 2DJ3A 2KUCA 2VCTA 3QFAC 5ELGA 1T4ZA 4CY8A 3KMNA 2OKAA 4HOJA 3DVXA 1EOHA 3UJ1A 2A2RA 2LRCA 1MDKA 3FR6A 5J3RA 2GZPA 1M9AA 3MAKA 5DVBA 3ZZXA 2DMLA 2JACA 1T00A 3A2VA 3KP8A 1XZOA 2GQMA 2J9HA 3GKXA 2YWOA 4OO4A 4LMWA 5DQSA 3DWVA 2CAQA 2WS2A 1XWCA 1AIUA 2B6MA 3SWLA 4MF6A 4JZQA 4J56E 3GKKA 4PQHA 2R2JA 2B5EA 4HJ2A 5IIZA 11GSA 1Z7RA 2HXKA 4OMVA 1G6WA 4HQZA 1O7UA 4USSA 1FO5A 3RAZA 3V1WA 4BWSA 2YOIA 1AXDA 4IP1A 4IQ1A 1B48A 2L5OA 3KEBA 2LQQA 2A4VA 4OD7A 3M3MA 1F3BA 5HFGA 2VLTA 2H1AA 1GSUA 2A2PA 1M7TA 2MMOA 4DSSA 1EP7A 1AQXA 4G0KA 2IJYA 1PA3A 3GL5A 2WJUA 2H1GA 4GLTA 4Z2TA 4IJIA 2YJHA 5IMCA 5INYA 5COHA 5DALB 5KOWA 1E6BA 1XCCA 1X0RA 4X0XA 2A4HA 5E4WA 2FA4A 3IV4A 5HQPA 3PPUA 5F0GA 2B1LA 2F8FA 1BAYA 1WMJA 3PR8A 4O5QA 1GTUA 2C1YA 4KF9A 1PL1A 2DJ0A 1BG5A 1B9YC 1GSSA 1XOAA 4DEJA 3APQA 5DDLA 2CZ3A 4IHUA 2HRKA 1GRXA 6GSUA 2H73A 4KCAA 1QFNA 2K18A 3ZFLA 4XS4B 2V2GA 2YWNA 3UMAA 4I5QA 2K6VA 4POLA 1PRXA 3APOA 4KNDA 3UIWA 1PMTA 2VIMA 4MJCA 5BMUA 1NSWA 3HVSA 4I8BA 6GSVA 4N0VA 2DJ2A 3HYPA 4F0BA 5J9CA 4GF0A 3TRPA 3CMIA 17GSA 2VCVA 2R37A 2H1DA 3GHAA 3HDCA 2P0GA 4BVXA 4ZB9A 5G30A 2HYXA 4TRXA 5IOXA 5D9TA 2DJ1A 2FY6A 3A3TA 4FYUA 1IYHA 4POBA 3TKQA 1NW2A 3I43A 3BD2A 5ECLB 1OC8A 2FHEA 5JCGA 4HU9A 2CT6A 1OKDA 4K7OA 4I97A 4GTUA 5AGYA 1HQOA 2CQ9A 1R5PA 3TKSC 3DVWA 3F9UA 2LTKA 1XBSA 3IAM2 5B7CA 1AQVA 2DLXA 2PPTA 3MIXA 3EU3A 1JLWA 1WRYA 4TXOA 3DYRA 4X4JA 1EZKA 2QKEA 3NZNA 1XFLA 4OFNA 2HZEA 1X9WB 4ILFA 3IK7A 2G0FA 4KDXA 4ZL9A 2LNTA 3KGKA 1TU8A 3ZMKA 3CRTA 3TJJA 5IM9A 4NAXA 1ZYPA 2C0DA 1PL2A 1TK0B 4MH3A 5C04A 1TRVA 3HZ8A 2F3MA 3Q6OA 4WF5A 1ZCPA 2FCHA 2QGVA 1GULA 4KSOA 1N2AA 1GLPA 1K0AA 1YJ6A 2JZSA 4ECCA 4ZB6A 5FWGA 1UVZA 4BVXB 5B8AA 1XVWA 4OO5A 5IMAA 2YP6A 4AJ6A 3W8SA 2VAFA 1R7HA 2FNOA 2L5LA 2DBCA 3Q19A 4BL7B 1GSQA 1K0NA 3CRUA 4MJAA 2HE3A 4N10A 2CAIA 3IC8A 2QA2A 4YQVA 16GSA 1OC9B 2VL3A 1WPIA 3GX0A 1OVNA 2VOCA 2LQOA 3EC3A 3C1RA 4QQ7A 2O87A 2VD1A 3HZ4A 4IVFA 1YEXA 1NHYA 1I5GA 4KDYA 2FD3A 1ERTA 3IOSA 4TVEA 4YAVA 3QPMA 5D9WA 5D73A 2FWHA 3H4KA 3UAPA 1G7OA 3TRXA 5LCZA 4PX1A 1JLVA 1VF2A 2R4VA 3VWWA 4K6XA 4MMMA 4OCEA 2R3XA 3G7YA 2MYGA 4HEA2 2FWGA 1PGTA 4L5OA 4GWRA 5CYYA 1HD2A 1HNBA 1YQ1A 3ME7A 5IPGA 3H79A 1THOA 1TU7A 4RQXA 5GAPD 3MNGA 3ISOA 2IN3A 1U3IA 3LORA 1B9XC 4EDZA 4D73A 1GNWA 2R5GA 2GLRA 1TRUA 3D0ZA 1TJDA 2YN1A 5C00A 1O8WA 3O6TA 3EVIA 4MABA 3KMOA 2GS3A 4GRFA 4ZBAA 1GL8A 3IK9A 4DSRA 1X5DA 1U88A 2NVLA 4F2IA 4GSSA 5ECPB 1K0DA 4MF5A 2RM5A 1JZRA 1TKDB 3C1SA 4MZCA 2WCIA 5ID2A 2C80A 3ERGA 4I6XA 3U5RE 1Z6MA 3RHBA 4IP6A 4V1Ap 1A0FA 4FH8A 4K7NA 5CP1A 2HSMA 3FHKA 3E3EA 4PNGA 1SK2A 3LG6A 5G1KA 3VFIA 1V9WA 3LEFA 3F63A 3HY2A 1UC7A 4V1Ag 3TJKA 3I9V2 3TCOA 5IQYA 5J5NA 2X8GA 1BYEA 1ZOFA 3GNJA 1FW1A 2M80A 22GSA 4ECJA 2D2ZA 2FWEA 2IIYA 3ZIVA 2YWMA 5JWRB 3LFLA 3IRAA 3KIJA 3D22A 2TIRA 5IO2A 2H6YA 4N11A 4N0ZA 5GZZB 3FZAA 2EC4A 1Y6EA 2XBQA 5DJLA 5ECMB 2RIIA 1DBYA 4LA1A 3DD3A 1BJXA 2VM1A 4KUNA 2C3QA 2E7PA 2VCWA 3KM6A 3WT2A 2AAWA 4HI7A 3HKRA 3IXRA 4ML6A 3GMFA 3LYPA 2I9HA 1GTIA 5ID2B 3QD9A 3KH7A 3CYNA 3I6AA 5HFKA 1V2AA 3G9BA 1AQWA 5KN3A 4MPGA 1TDIA 4PUAA 2IFQA 4KAEA 1EV4A 5CREA 1JFUA 1FAAA 2KOKA 2N5AA 1MEKA 3FMWA 3L4NA 2NPBA 2GQKA 2VL9A 3F3QA 1Z9HA 1X5EA 4V2LA 4NV5A 1U3AA 4ID0A 1ML6A 4NPBA 3TKRA 1B4PA 1F6MC 4OFTA 3DEXA 3DXBA 3TKSA 3ZVJD 3FR3A 4HU7A 2K8SA 2GT5A 4F0CA 2GSTA 2PN8A 2LJKA 2MMAA 4KSMA 4QL9A 5A4WA 3KD0A 3GV1A 1WJKA 5J4UA 1ST9A 1A2JA 3CSIA 3FEUA 4Q5RA 4WBJA 4MZWA 5ECKB 1EEMA 4TR1A 2PBJA 2OA7A 2JZTA 3F4SA 3F6FA 3L0HA 2EIRA 2B5XA 4K0NA 2JSYA 2VO4A 4G2EA 2IFQB 4K8MA 5ECHB 5F05A 2WDUA 4ISDA 3Q18A 2R0GA 1MDIA 2OE1A 3C7MA 5BRTA 3F6DA 1T3BA 1WWJA 5ECIB 5CRHA 3ZFBA 2TRCP 4L8EA 1TTZA 14GSA 1T4YA 2GTUA 3O76A 3TJBA 4XS6A 2DMMA 2VL2C 2YNXA 3MDKA 1UA5A 2KLXA 1V57A 3TOTA 3IDVA 1SJ6A 4NHZA 1FB6A 1PN9A 2C8UA 2V1MA 3HJOA 3HVVA 3TDGA 5LNKe 3GX8A 2CV4A 5G5FA 2GZZA 2JSZA 1LBKA 3WGXA 1ON4A 5JCUA 3VK9A 4KW6A 2L4QA 3N5OA 5G31A 2V6OA 4WR5A 1HNCA 1EEJA 4TOPA 4BWQA 2X8HA 1TW9A 2MBTA 3CSHA 4TR1B 3RHCA 3FKFA 2ZNMA 1QMVA 2WFCA 4PQIA 2DC5A 1KTEA 2HI7A 5CNWA 4G0IA 2F8AA 2RUFA 3MYDA 2CZ2A 4JE1A 5DQYA 2GSRA 4WXTA 1FVKA 4H86A 2LV3A 2V41A 1O81A 1FB0A 4X1UA 4XCSA 4MJBA 6GSTA 3H1NA 2H0IA 3RPNA 4XS1A 3D21A 1T1VA 3QDNA 3EMPA 5L71A 4J2FA 3U6VA 1M9BA 3US3A 4E8EA 4MF7A 4XRAA 3EWLA 3ZYWA 4DSSB 1I9DA 1K3YA 2IMFA 4YQMA 4MDCA 3W6GA 1BQ7A 4G0LA 2XPDA 3LQ7A 4Z7XA 1DUGA 2G2QA 1MD4A 1XPVA 1OE8A 1V58A 4WKWA 2H30A 4F03A 2VLUA 1XW6A 5DCGA 3CSJA 4YH2A 5H5QA 2DKIA 2OJLA 5ENUA 4EKZA 2L4CA 2HT9A 3HJMA 1CQGA 1S3AA 2ES7A 3E9JB 3VWXA 3BOAA 4IQAA 1PX6A 3GFKA 1ZMAA 4NXIA 1A0RP 3RDWA 2AHEA 2OE3A 3C8EA 4WBRD 2IWTA 4ECIA 3HA9A 3LSZA 2AV4A 2L57A 1F3AA 4EL1A 1GH2A 1ZZYA 4KH7A 4TR3A 3ZTLA 4WETA 3ME8A 3ED3A 18GSA 6GSXA 1ZYQB 5B6MA 1VF4A 1YDKA 5ECSA 2FGXA 1BX9A 5AIVA 3GIXA 4GSTA 2I3YA 3I69A 1GTBA 1QGVA 4PXOA 1PX7A 1V98A 2JU5A 3GA4A 2F9SA 2FLSA 2IL3A 1SKSB 6GSSA 4HZ4A 5H5SA 3ZRDA 5F06A 4YAPA 1TK5B 4L5LA 3A2WA 3GURA 5CRWA 1K0BA 4DVCA 4EUYA 4HQSA 2CVKA 1M2BA 1T7PB 1A23A 4IN0A 1W4VA 2RLIA 4RQRA 1YF1A 6GSYA 2LRTA 2CX3A 2X99A 5CRGA 2H72A 2LSTA 2OADA 4OWYA 3VPTA 4TXOB 5LD0A 1PKWA 1YKCA 1U87A 3QCPA 2HZEB 2HRNA 2LRNA 2GVPA 2DSAA 4NWYA 1EV9A 2BTOT 2GSQA 2O7KA 1J9BA 2LJRA 5G2ZA 3SBCA 3H93A 4LL1B 3UOMA 3S9FA 3EU4A 4K1FA 2JADA 2HSYA 3QFBC 5IMZA 4RUVA 3HVXA 1F37A 3EURA 2XBIA 3M9KA 5ECOB 5KN0A 1R4WA 2B3SA 2H1BA 3F8UA 4IW9A 1JZOA 1TI3A 5KEJA 4Q5QA 2O85A 3M8NA 1Z6NA 4O92A 4K7IA 3MSZA 4LLRA 4AJ8A 3AY8A 2L6CA 4LL4B 5D93A 4TR0A 1G7EA 4HS1A 1PSQA 1VRSD 2H71A 2XPEA 4MK3A 1E2YA 3EE2A 4YKGA 2MBSA 5ELAA 3ZIJA 5D96A 2HNLA 2AYTA 3GYKA 5KOXA 2C0EA 1NHOA 3VI5A 2DIYA 1URMA 2HFDA 1GTAA 1O85A 2H6XA 2VUPA 2GDRA 2YWIA 3KZQA 4DSQA 1Z5YE 2I81A 3L9SA 4PURA 3A5WA 3IC4A 3VURA 1YZXA 1A8YA 2OE0A 1SYRA 2UZ8A 4OCFA 1T8EB 4ECBA 2N5BA 2VLVA 2CVDA 4I2TA 5D9VA 2HRFA 2WRTA 1KNGA 5JWOB 1GWCA 1SL0B 2LJAA 2L59A 3IR4A 4AGSA 1S3DA 1TRSA 3UBKA 2E2MA 3IHGA 2E2GA 3O3TA 4L0WA 3GSSA 3HHVA 1VGLA 4E8HA 10GSA 5AIXA 1H75A 2YZUA 4RI6A 6GSWA 1QUWA 2DIZA 4OFMA 1CQHA 2X64A 1USBA 2VCQA 3C71A 2LKUA 3GH9A 2YZHA 4HUAA 3D5JA 3VWVA 1YKAA 3D6IA 5A5KA 4EIPA 4ULXA 3EPTA 4D73B 3P7XA 5JWQB 3BBYA 4IJ3A 1SD8A 4L0UA 1TRWA 4MZBA 4JEDA 5DAKA 5ECQB 2M46A 3CBUA 5DJMA 4CY6A 3UARA 4IKHA 4HZ2A 1XW9A 2GZYA 5IOWA 3VI7A 2PVOC 1FVJA 5HR3A 3M1GA 2I1UA 1XWBA 5IMDA 1EGOA 2K9FA 5AN1A 1J08A 1YF0A 1GUHA 1UN2A 3ZREA 2EIQA 2NTOA 1GSDA 4EF0A 1AAZA 4BA7A 3KH9A 2IMDA 4PQ1A 1THXA 3MWHA 5IMVA 2WULA 4JR6A 2H6ZA 4RI7A 1SJIA 4N30A 4ML1A 2FA8A 3FYGA 3H8QA 1ACVA 1SK0A 1MDJA 5EY6A 4IELA 1XWGA 3L78A 3D4TA 1YY7A 3K8NA 3RPPA 1M99A 3GSTA 5CO3A 5D8IA 4GSNA 5AISA 1LU4A 1AC1A 3HCZA 1R5AA 3N9JA 1PKZA 3E0UA 3IPZA 5DAKB 1BEDA 4CHSA 2YV7A 4TKYA 2BJXA 2IPAA 4G9HA 1WIKA 1OE7A 1K3OA 3Q74A 2GSSA 1K0OA 3LXZA 1EP8A 1V40A 5A4VA 2P5RA 5IMFA 5DALA 3EYTA 2KHPA 2KP2A 3BCIA 20GSA 4HDEA 1EOGA 3DGQA 4JRRA 3TOUA 5J41A 4LMVA 3UVHA 4NV2A 1OYJA 3RBTA 4TW5A 2JZRA 1QK8A 3LW9A 3F0IA 5GAND 4Q5FA 2B1KA 1JHBA 4EO3A 2AB6A 4F9ZA 4JU5A 2XHFA 3LGCA 1W89A 3DIEA 4KDUA 2L6DA 3QAGA 1ABAA 4ZXGA 1ERWA 4CW9A 5EVOA 4ZIJA 2NBSA 2P5QA 1K0MA 2WGRA 1TI1A 1AW9A 2K8VA 4XS4A 4PUFC 1ZYEA 1KBNA 2H75A 2PGTA 3ZVJA 2PMTA 5EL8A 3W8JA 5HR2A 4EVMA 3ERWA 3GL3A 4PTSA 1H4OA 2H70A 1QXHA 4KA0A 1R26A 5FT3A 1A2MA 1Y25A 1DE1A 4K2XA 1K3LA 3L9VA 3WT1A 2IMEA 5F8BA 2H0HA 3NIVA 3FR9A 2BMXA 3TGZA 3L9UA 4POMA 3EINA 2V6KA 3QOUA 3PH9A 1X5CA 3LYKA 4K2DA 4ZBBA 2H74A 5HFIA 1O73A 3QMXA 5J9BA 3GUSA 2QSIA 1O8XA 3DKSA 2PUKC 2I4AA 3WGDA 2O89A 1SD9A 4YKFA 4ZILA 3UL3A 1B8XA 2C3TA 5H5RA 2KP1A 2DKHA 1GNEA 2A2SA 4Z2RA 4CDOA 4EDYA 1X9SB 3GKMA 3TRQA 1PN0A 3BCKA 1Q98A 4O5RA 3TJGA 4KB3A 5KN2A 4XTSA 4MNNA 1VF3A 3FRCA 4V2MA 1GSFA 1GSYA 4MH2A 3J7Yb 2IMIA 1ZGNA 2VM2A 3EMXA 1Q4JA 1ERVA 3OR5A 2RM6A 1X9MB 2OBIA 1TK8B 1GUKA 3QAWA 2ZCTA 1SKWB 3GN3A 3A5IA 3M9JA 1ZL9A 4I2UA 4BL7A 4ICYA 3UBLA 4GQCA 1PQNA 4AJ7A 1ILOA 1OC3A 2C4JA 8GSSA 4MJEA 3P90A 2YCDA 5GSTA 5G1LA 1SJZA 2MMZA 1OC9A 2ZUPA 4POKA 1F2EA 4JR4A 3F3RA 4ZL8A 4ZBDA 1XOBA 4QL7A 4GQFA 3WYWA 5CAXA 3HD5A 1Z3EA 1XWKA 4BPYA 2F51A 3GH6A 1C72A 4EIQA 2JL4A 1JZDA 3DRNA 2CA8A 4KX4A 2WB9A 1Z7PA 2X4AA 3GTUA 3TKPA 4KGIA 4EC0A 1HYUA 1SK1A 2B7JA 1FOVA 4GXZA 4TXVA 4MA9A 4XHMA 1FOHA 3PINA 1WOUA 4WR4A 1A8LA 1RQMA 1GP1A 1TP9A 4MP4A 1XIYA 3KTLA 3DMLA 3ZITA 2H8LA 3IAS2 3LXTA 4WF4A 3PGTA 4A5PA 2AJQB 1SU9A 1SENA 3CTGA 4MPFA 3FZ9A 2VD0A 2R0PA 4KE3A 3WD6A 4GCIA 5IO0A 3UEMA 4EE0A 4PNFA 5JCWA 4G19A 4P3YB 2DJKA 2N5FA 3G7IA 3KJYA 4FQUA 3F4TA 5HR0A 1A24A 5A4UA 2EIOA 3CTFA 3IE3A 2H0GA 5B6NA 2IMKA 1SL1B 1M0UA 1ERUA 5ECNB 2YV9A 2GGTA 2LUSA 4K0GA 4PGTA 4AF2A 3KXOA 2H01A 4X43A 3QAVA 3GTUB 2OACA 3LWAA 4ZB8A 3J7Yk 3IHQA 1EWXA 3NOFA 2PWJA 2FWFA 2C0GA 3VLNA 1XWAA 1S3CA 5HR1A 5DCHA 3TKSE 2CVBA 4EXJA 1G0TA 2YJ7A 3GKNA 3GRXA 2H19A 7GSSA 2FUG2 2AUVA 1M2AA 4NHWA 1RW1A 4BVYA 4K5SA 1FHEA 3HJPA 2ON7A 4ACSA 4TR4A 2B7KA 1JZWA 1K0CA 1ZYNA 4O5UA 3TJFA 1GUMA 3FZ5A 2LS5A 2V32A 1GLQA 5D9XA 3LJRA 1SYXA 3ZL5A 3C73A 4YQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z9S A;  1DSB A;  1GSE A;  2H66 A;  2HZF A;  2H76 A;  1TOF A;  1FG4 A;  2TRX A;  4Q5N A;  4TN8 A;  2MMN A;  4FYB A;  4ZL7 A;  2HSH A;  2MZC A;  2VL2 A;  1LJR A;  3KP9 A;  3M0F A;  3JCM L;  4O7H A;  4K9Z A;  4F82 A;  1M2D A;  1KEB A;  5FHI A;  3G7J A;  3CXG A;  1XVQ A;  3KCM A;  9GSS A;  1G6Y A;  3QR6 A;  5DBQ A;  1MTC A;  1SL2 B;  3F4R A;  2OBK A;  3P2A A;  2B5Y A;  3UVT A;  5E59 A;  1MD3 A;  1SKR B;  2E0Q A;  2ON5 A;  1IYI A;  4MCU A;  2P31 A;  3P8W A;  3WGE A;  3D4M A;  2PER A;  2NDO A;  1B4Q A;  3A2X A;  1HNA A;  4V2N A;  3TB2 A;  4XRD A;  1PD2 1;  3FY7 A;  2WZ9 A;  4HJM A;  3TUE A;  4FIW A;  1WE0 A;  3IBH A;  2CX4 A;  1O6J A;  3ZLP A;  2LEG A;  2XC2 A;  1RK4 A;  4MLY A;  1YEP A;  1DE2 A;  2LNS A;  5ABR A;  4NMU A;  1VF1 A;  1EGR A;  2ALB A;  5G5E A;  1F9M A;  2J23 A;  3APS A;  2GQL A;  1WP0 A;  2VCZ A;  4IGJ A;  4IS0 A;  2RUE A;  13GS A;  4WEY A;  1J0F A;  19GS A;  2GT6 A;  4FO5 A;  2C3N A;  5IPH A;  1OKT A;  2YAN A;  3FZ4 A;  4XIH A;  1XW5 A;  2R6K A;  3BJ5 A;  4O32 A;  12GS A;  3VWU A;  2QC7 A;  5B8B A;  2PU9 C;  1AUC A;  3VPQ A;  2HLS A;  2X8C A;  3HXS A;  3ERF A;  3IA1 A;  5CRD A;  1A2L A;  2YPM A;  3FW2 A;  2PVQ A;  2C0F A;  5F07 A;  1N8J A;  5EPF A;  2DJJ A;  5ECR B;  1U6T A;  4G10 A;  1TXX A;  3R2Q A;  4KCE A;  1QQ2 A;  1NM3 A;  3FK8 A;  4JBB A;  1XXU A;  5KN1 A;  2O8V B;  4FYC A;  2REM A;  2M72 A;  1OAZ A;  5GSS A;  3KTB A;  4J57 E;  2VCX A;  4IBP A;  3ZML A;  2DJ3 A;  2KUC A;  2VCT A;  3QFA C;  5ELG A;  1T4Z A;  3KMN A;  2OKA A;  4HOJ A;  3DVX A;  1EOH A;  3UJ1 A;  2A2R A;  2LRC A;  1MDK A;  3FR6 A;  5J3R A;  2GZP A;  1M9A A;  3MAK A;  5DVB A;  3ZZX A;  2DML A;  2JAC A;  1T00 A;  3A2V A;  3KP8 A;  1XZO A;  2GQM A;  2J9H A;  3GKX A;  2YWO A;  4OO4 A;  4LMW A;  5DQS A;  3DWV A;  2CAQ A;  2WS2 A;  1XWC A;  1AIU A;  2B6M A;  3SWL A;  4MF6 A;  4JZQ A;  4J56 E;  3GKK A;  4PQH A;  2R2J A;  2B5E A;  4HJ2 A;  5IIZ A;  11GS A;  1Z7R A;  2HXK A;  4OMV A;  1G6W A;  4HQZ A;  1O7U A;  1FO5 A;  3RAZ A;  3V1W A;  4BWS A;  2YOI A;  1AXD A;  4IP1 A;  4IQ1 A;  1B48 A;  2L5O A;  3KEB A;  2LQQ A;  2A4V A;  4OD7 A;  3M3M A;  1F3B A;  5HFG A;  2VLT A;  2H1A A;  1GSU A;  1M7T A;  2MMO A;  4DSS A;  1EP7 A;  1AQX A;  2IJY A;  1PA3 A;  3GL5 A;  2WJU A;  2H1G A;  4GLT A;  4IJI A;  2YJH A;  5IMC A;  5INY A;  5COH A;  5DAL B;  1E6B A;  1XCC A;  1X0R A;  4X0X A;  5E4W A;  2FA4 A;  3IV4 A;  5HQP A;  5F0G A;  2B1L A;  2F8F A;  1BAY A;  1WMJ A;  3PR8 A;  1GTU A;  2C1Y A;  1PL1 A;  2DJ0 A;  1BG5 A;  1B9Y C;  1GSS A;  1XOA A;  4DEJ A;  3APQ A;  5DDL A;  2CZ3 A;  4IHU A;  1GRX A;  6GSU A;  2H73 A;  4KCA A;  1QFN A;  2K18 A;  3ZFL A;  4XS4 B;  2V2G A;  2YWN A;  3UMA A;  4I5Q A;  2K6V A;  4POL A;  1PRX A;  3APO A;  4KND A;  3UIW A;  1PMT A;  2VIM A;  4MJC A;  1NSW A;  3HVS A;  4I8B A;  6GSV A;  4N0V A;  2DJ2 A;  3HYP A;  4F0B A;  5J9C A;  4GF0 A;  3TRP A;  3CMI A;  17GS A;  2VCV A;  2R37 A;  2H1D A;  3GHA A;  3HDC A;  2P0G A;  4BVX A;  4ZB9 A;  5G30 A;  2HYX A;  4TRX A;  5IOX A;  5D9T A;  2DJ1 A;  2FY6 A;  3A3T A;  4FYU A;  1IYH A;  4POB A;  3TKQ A;  1NW2 A;  3I43 A;  3BD2 A;  5ECL B;  1OC8 A;  2FHE A;  5JCG A;  4HU9 A;  2CT6 A;  1OKD A;  4K7O A;  4I97 A;  4GTU A;  5AGY A;  1HQO A;  2CQ9 A;  1R5P A;  3TKS C;  3DVW A;  3F9U A;  2LTK A;  1XBS A;  3IAM 2;  5B7C A;  1AQV A;  2DLX A;  2PPT A;  3EU3 A;  1JLW A;  1WRY A;  4TXO A;  3DYR A;  1EZK A;  2QKE A;  3NZN A;  1XFL A;  4OFN A;  2HZE A;  1X9W B;  4ILF A;  3IK7 A;  2G0F A;  4KDX A;  4ZL9 A;  2LNT A;  3KGK A;  1TU8 A;  3ZMK A;  3CRT A;  3TJJ A;  5IM9 A;  4NAX A;  2C0D A;  1PL2 A;  1TK0 B;  4MH3 A;  5C04 A;  1TRV A;  3HZ8 A;  2F3M A;  3Q6O A;  4WF5 A;  1ZCP A;  2FCH A;  2QGV A;  1GUL A;  4KSO A;  1N2A A;  1GLP A;  1K0A A;  1YJ6 A;  2JZS A;  4ECC A;  4ZB6 A;  5FWG A;  1UVZ A;  5B8A A;  1XVW A;  4OO5 A;  5IMA A;  2YP6 A;  4AJ6 A;  3W8S A;  2VAF A;  1R7H A;  2FNO A;  2L5L A;  2DBC A;  3Q19 A;  1GSQ A;  1K0N A;  3CRU A;  4MJA A;  2HE3 A;  4N10 A;  2CAI A;  4YQV A;  16GS A;  1OC9 B;  2VL3 A;  1WPI A;  3GX0 A;  1OVN A;  2VOC A;  2LQO A;  3EC3 A;  3C1R A;  4QQ7 A;  2O87 A;  2VD1 A;  3HZ4 A;  4IVF A;  1YEX A;  1NHY A;  1I5G A;  4KDY A;  2FD3 A;  1ERT A;  3IOS A;  4TVE A;  4YAV A;  3QPM A;  5D9W A;  5D73 A;  2FWH A;  3H4K A;  3UAP A;  1G7O A;  3TRX A;  5LCZ A;  4PX1 A;  1JLV A;  1VF2 A;  2R4V A;  3VWW A;  4K6X A;  4MMM A;  4OCE A;  2R3X A;  3G7Y A;  2MYG A;  4HEA 2;  2FWG A;  1PGT A;  4L5O A;  4GWR A;  5CYY A;  1HD2 A;  1HNB A;  1YQ1 A;  3ME7 A;  5IPG A;  3H79 A;  1THO A;  1TU7 A;  4RQX A;  5GAP D;  3MNG A;  3ISO A;  2IN3 A;  1U3I A;  3LOR A;  1B9X C;  4EDZ A;  4D73 A;  1GNW A;  2R5G A;  2GLR A;  1TRU A;  3D0Z A;  1TJD A;  2YN1 A;  5C00 A;  1O8W A;  3O6T A;  3EVI A;  4MAB A;  3KMO A;  2GS3 A;  4GRF A;  4ZBA A;  1GL8 A;  3IK9 A;  4DSR A;  1X5D A;  1U88 A;  2NVL A;  4F2I A;  4GSS A;  5ECP B;  1K0D A;  4MF5 A;  2RM5 A;  1JZR A;  1TKD B;  3C1S A;  4MZC A;  2WCI A;  5ID2 A;  2C80 A;  3ERG A;  4I6X A;  3U5R E;  1Z6M A;  3RHB A;  4IP6 A;  4V1A p;  1A0F A;  4FH8 A;  4K7N A;  5CP1 A;  3FHK A;  3E3E A;  4PNG A;  1SK2 A;  3LG6 A;  5G1K A;  3VFI A;  1V9W A;  3LEF A;  3F63 A;  3HY2 A;  1UC7 A;  4V1A g;  3TJK A;  3I9V 2;  3TCO A;  5IQY A;  5J5N A;  2X8G A;  1BYE A;  1ZOF A;  3GNJ A;  1FW1 A;  2M80 A;  22GS A;  4ECJ A;  2D2Z A;  2FWE A;  2IIY A;  3ZIV A;  2YWM A;  5JWR B;  3LFL A;  3IRA A;  3KIJ A;  3D22 A;  2TIR A;  5IO2 A;  2H6Y A;  4N11 A;  4N0Z A;  5GZZ B;  3FZA A;  2EC4 A;  1Y6E A;  2XBQ A;  5DJL A;  5ECM B;  2RII A;  1DBY A;  4LA1 A;  3DD3 A;  1BJX A;  2VM1 A;  4KUN A;  2C3Q A;  2E7P A;  2VCW A;  3KM6 A;  3WT2 A;  2AAW A;  4HI7 A;  3HKR A;  3IXR A;  4ML6 A;  3GMF A;  3LYP A;  2I9H A;  1GTI A;  5ID2 B;  3QD9 A;  3KH7 A;  3CYN A;  3I6A A;  5HFK A;  1V2A A;  3G9B A;  1AQW A;  5KN3 A;  4MPG A;  1TDI A;  4PUA A;  2IFQ A;  4KAE A;  1EV4 A;  5CRE A;  1JFU A;  1FAA A;  2KOK A;  2N5A A;  1MEK A;  3L4N A;  2NPB A;  2GQK A;  2VL9 A;  3F3Q A;  1Z9H A;  1X5E A;  4V2L A;  4NV5 A;  1U3A A;  4ID0 A;  1ML6 A;  4NPB A;  3TKR A;  1B4P A;  1F6M C;  4OFT A;  3DEX A;  3DXB A;  3TKS A;  3ZVJ D;  3FR3 A;  4HU7 A;  2K8S A;  2GT5 A;  4F0C A;  2GST A;  2PN8 A;  2LJK A;  2MMA A;  4KSM A;  4QL9 A;  5A4W A;  3KD0 A;  3GV1 A;  1WJK A;  5J4U A;  1ST9 A;  1A2J A;  3CSI A;  3FEU A;  4Q5R A;  4WBJ A;  4MZW A;  5ECK B;  1EEM A;  4TR1 A;  2PBJ A;  2OA7 A;  2JZT A;  3F4S A;  3F6F A;  3L0H A;  2EIR A;  2B5X A;  4K0N A;  2JSY A;  2VO4 A;  4G2E A;  2IFQ B;  4K8M A;  5ECH B;  5F05 A;  2WDU A;  4ISD A;  3Q18 A;  1MDI A;  2OE1 A;  3C7M A;  3F6D A;  1T3B A;  1WWJ A;  5ECI B;  5CRH A;  3ZFB A;  2TRC P;  4L8E A;  1TTZ A;  14GS A;  1T4Y A;  2GTU A;  3O76 A;  3TJB A;  4XS6 A;  2DMM A;  2VL2 C;  2YNX A;  3MDK A;  1UA5 A;  2KLX A;  1V57 A;  3TOT A;  3IDV A;  1SJ6 A;  4NHZ A;  1FB6 A;  1PN9 A;  2C8U A;  2V1M A;  3HJO A;  3HVV A;  3TDG A;  5LNK e;  3GX8 A;  2CV4 A;  5G5F A;  2GZZ A;  2JSZ A;  1LBK A;  3WGX A;  1ON4 A;  5JCU A;  3VK9 A;  4KW6 A;  2L4Q A;  3N5O A;  5G31 A;  2V6O A;  4WR5 A;  1HNC A;  1EEJ A;  4TOP A;  4BWQ A;  2X8H A;  1TW9 A;  2MBT A;  3CSH A;  4TR1 B;  3RHC A;  3FKF A;  2ZNM A;  1QMV A;  2WFC A;  4PQI A;  2DC5 A;  1KTE A;  2HI7 A;  5CNW A;  2F8A A;  2RUF A;  2CZ2 A;  4JE1 A;  5DQY A;  2GSR A;  4WXT A;  1FVK A;  4H86 A;  2LV3 A;  2V41 A;  1O81 A;  1FB0 A;  4X1U A;  4XCS A;  4MJB A;  6GST A;  3H1N A;  2H0I A;  3RPN A;  4XS1 A;  3D21 A;  1T1V A;  3QDN A;  3EMP A;  5L71 A;  4J2F A;  3U6V A;  1M9B A;  3US3 A;  4E8E A;  4MF7 A;  4XRA A;  3EWL A;  3ZYW A;  4DSS B;  1I9D A;  1K3Y A;  2IMF A;  4YQM A;  4MDC A;  3W6G A;  1BQ7 A;  2XPD A;  3LQ7 A;  4Z7X A;  1DUG A;  2G2Q A;  1MD4 A;  1XPV A;  1OE8 A;  1V58 A;  4WKW A;  2H30 A;  4F03 A;  2VLU A;  1XW6 A;  5DCG A;  3CSJ A;  4YH2 A;  5H5Q A;  2OJL A;  5ENU A;  4EKZ A;  2L4C A;  2HT9 A;  3HJM A;  1CQG A;  1S3A A;  2ES7 A;  3E9J B;  3VWX A;  3BOA A;  4IQA A;  1PX6 A;  3GFK A;  1ZMA A;  4NXI A;  1A0R P;  3RDW A;  2AHE A;  2OE3 A;  3C8E A;  4WBR D;  2IWT A;  4ECI A;  3HA9 A;  3LSZ A;  2AV4 A;  2L57 A;  1F3A A;  4EL1 A;  1GH2 A;  1ZZY A;  4KH7 A;  4TR3 A;  3ZTL A;  4WET A;  3ME8 A;  3ED3 A;  18GS A;  6GSX A;  1ZYQ B;  5B6M A;  1VF4 A;  1YDK A;  5ECS A;  2FGX A;  1BX9 A;  5AIV A;  3GIX A;  4GST A;  2I3Y A;  3I69 A;  1GTB A;  1QGV A;  4PXO A;  1PX7 A;  1V98 A;  2JU5 A;  3GA4 A;  2F9S A;  2FLS A;  2IL3 A;  1SKS B;  6GSS A;  4HZ4 A;  5H5S A;  3ZRD A;  5F06 A;  4YAP A;  1TK5 B;  4L5L A;  3A2W A;  3GUR A;  5CRW A;  1K0B A;  4DVC A;  4EUY A;  4HQS A;  2CVK A;  1M2B A;  1T7P B;  1A23 A;  4IN0 A;  1W4V A;  2RLI A;  4RQR A;  1YF1 A;  6GSY A;  2LRT A;  2CX3 A;  2X99 A;  5CRG A;  2H72 A;  2LST A;  2OAD A;  4OWY A;  3VPT A;  4TXO B;  5LD0 A;  1PKW A;  1YKC A;  1U87 A;  3QCP A;  2HZE B;  2HRN A;  2LRN A;  2GVP A;  2DSA A;  4NWY A;  1EV9 A;  2BTO T;  2GSQ A;  2O7K A;  1J9B A;  2LJR A;  5G2Z A;  3SBC A;  3H93 A;  4LL1 B;  3UOM A;  3S9F A;  3EU4 A;  4K1F A;  2JAD A;  2HSY A;  3QFB C;  5IMZ A;  4RUV A;  3HVX A;  1F37 A;  3EUR A;  2XBI A;  3M9K A;  5ECO B;  5KN0 A;  1R4W A;  2B3S A;  2H1B A;  3F8U A;  4IW9 A;  1JZO A;  1TI3 A;  5KEJ A;  4Q5Q A;  2O85 A;  3M8N A;  1Z6N A;  4O92 A;  4K7I A;  3MSZ A;  4LLR A;  4AJ8 A;  3AY8 A;  2L6C A;  4LL4 B;  5D93 A;  4TR0 A;  1G7E A;  4HS1 A;  1PSQ A;  1VRS D;  2H71 A;  2XPE A;  4MK3 A;  1E2Y A;  3EE2 A;  2MBS A;  5ELA A;  3ZIJ A;  5D96 A;  2HNL A;  2AYT A;  3GYK A;  2C0E A;  1NHO A;  3VI5 A;  2DIY A;  1URM A;  2HFD A;  1GTA A;  1O85 A;  2H6X A;  2VUP A;  2GDR A;  2YWI A;  3KZQ A;  4DSQ A;  1Z5Y E;  2I81 A;  3L9S A;  4PUR A;  3A5W A;  3IC4 A;  3VUR A;  1YZX A;  1A8Y A;  2OE0 A;  1SYR A;  4OCF A;  1T8E B;  4ECB A;  2N5B A;  2VLV A;  2CVD A;  4I2T A;  5D9V A;  2HRF A;  2WRT A;  1KNG A;  5JWO B;  1GWC A;  1SL0 B;  2LJA A;  2L59 A;  3IR4 A;  4AGS A;  1S3D A;  1TRS A;  3UBK A;  2E2M A;  2E2G A;  3O3T A;  4L0W A;  3GSS A;  3HHV A;  1VGL A;  4E8H A;  10GS A;  5AIX A;  1H75 A;  2YZU A;  4RI6 A;  6GSW A;  1QUW A;  2DIZ A;  4OFM A;  1CQH A;  2X64 A;  1USB A;  2VCQ A;  3C71 A;  2LKU A;  3GH9 A;  2YZH A;  4HUA A;  3D5J A;  3VWV A;  1YKA A;  3D6I A;  5A5K A;  4ULX A;  4D73 B;  3P7X A;  5JWQ B;  3BBY A;  4IJ3 A;  1SD8 A;  4L0U A;  1TRW A;  4MZB A;  4JED A;  5DAK A;  5ECQ B;  2M46 A;  3CBU A;  5DJM A;  3UAR A;  4IKH A;  4HZ2 A;  1XW9 A;  2GZY A;  5IOW A;  3VI7 A;  2PVO C;  1FVJ A;  5HR3 A;  3M1G A;  2I1U A;  1XWB A;  5IMD A;  1EGO A;  2K9F A;  5AN1 A;  1J08 A;  1YF0 A;  1GUH A;  1UN2 A;  3ZRE A;  2EIQ A;  2NTO A;  1GSD A;  4EF0 A;  1AAZ A;  4BA7 A;  3KH9 A;  2IMD A;  4PQ1 A;  1THX A;  3MWH A;  5IMV A;  2WUL A;  4JR6 A;  2H6Z A;  4RI7 A;  1SJI A;  4N30 A;  4ML1 A;  2FA8 A;  3FYG A;  3H8Q A;  1ACV A;  1SK0 A;  1MDJ A;  5EY6 A;  4IEL A;  1XWG A;  3L78 A;  3D4T A;  1YY7 A;  3K8N A;  3RPP A;  1M99 A;  3GST A;  5CO3 A;  5D8I A;  4GSN A;  5AIS A;  1LU4 A;  1AC1 A;  3HCZ A;  1R5A A;  3N9J A;  1PKZ A;  3E0U A;  3IPZ A;  5DAK B;  1BED A;  4CHS A;  2YV7 A;  4TKY A;  2BJX A;  2IPA A;  4G9H A;  1WIK A;  1OE7 A;  1K3O A;  3Q74 A;  2GSS A;  1K0O A;  3LXZ A;  1EP8 A;  1V40 A;  5A4V A;  2P5R A;  5IMF A;  5DAL A;  3EYT A;  2KHP A;  2KP2 A;  3BCI A;  20GS A;  4HDE A;  1EOG A;  3DGQ A;  4JRR A;  3TOU A;  5J41 A;  4LMV A;  3UVH A;  4NV2 A;  1OYJ A;  3RBT A;  4TW5 A;  2JZR A;  1QK8 A;  3F0I A;  5GAN D;  4Q5F A;  2B1K A;  1JHB A;  4EO3 A;  2AB6 A;  4F9Z A;  4JU5 A;  2XHF A;  3LGC A;  1W89 A;  3DIE A;  4KDU A;  2L6D A;  3QAG A;  1ABA A;  4ZXG A;  1ERW A;  4CW9 A;  5EVO A;  4ZIJ A;  2NBS A;  2P5Q A;  1K0M A;  2WGR A;  1TI1 A;  1AW9 A;  2K8V A;  4XS4 A;  4PUF C;  1ZYE A;  1KBN A;  2H75 A;  2PGT A;  3ZVJ A;  2PMT A;  5EL8 A;  3W8J A;  5HR2 A;  4EVM A;  3ERW A;  3GL3 A;  1H4O A;  2H70 A;  1QXH A;  4KA0 A;  1R26 A;  5FT3 A;  1A2M A;  1Y25 A;  1DE1 A;  1K3L A;  3L9V A;  3WT1 A;  2IME A;  5F8B A;  2H0H A;  3NIV A;  3FR9 A;  2BMX A;  3TGZ A;  3L9U A;  4POM A;  3EIN A;  2V6K A;  3QOU A;  3PH9 A;  1X5C A;  3LYK A;  4K2D A;  4ZBB A;  2H74 A;  5HFI A;  1O73 A;  3QMX A;  5J9B A;  3GUS A;  2QSI A;  1O8X A;  3DKS A;  2PUK C;  2I4A A;  3WGD A;  2O89 A;  1SD9 A;  4ZIL A;  3UL3 A;  1B8X A;  2C3T A;  5H5R A;  2KP1 A;  1GNE A;  2A2S A;  4CDO A;  4EDY A;  1X9S B;  3GKM A;  3TRQ A;  3BCK A;  1Q98 A;  4O5R A;  3TJG A;  4KB3 A;  5KN2 A;  4XTS A;  1VF3 A;  3FRC A;  4V2M A;  1GSF A;  1GSY A;  4MH2 A;  3J7Y b;  2IMI A;  1ZGN A;  2VM2 A;  3EMX A;  1Q4J A;  1ERV A;  3OR5 A;  2RM6 A;  1X9M B;  2OBI A;  1TK8 B;  1GUK A;  3QAW A;  2ZCT A;  1SKW B;  3GN3 A;  3M9J A;  1ZL9 A;  4I2U A;  4BL7 A;  3UBL A;  4GQC A;  1PQN A;  4AJ7 A;  1ILO A;  1OC3 A;  2C4J A;  8GSS A;  4MJE A;  3P90 A;  2YCD A;  5GST A;  5G1L A;  1SJZ A;  2MMZ A;  1OC9 A;  2ZUP A;  4POK A;  1F2E A;  4JR4 A;  3F3R A;  4ZL8 A;  4ZBD A;  1XOB A;  4QL7 A;  4GQF A;  3WYW A;  5CAX A;  3HD5 A;  1Z3E A;  1XWK A;  4BPY A;  2F51 A;  3GH6 A;  1C72 A;  2JL4 A;  1JZD A;  3DRN A;  2CA8 A;  4KX4 A;  2WB9 A;  1Z7P A;  3GTU A;  3TKP A;  4KGI A;  4EC0 A;  1HYU A;  1SK1 A;  2B7J A;  1FOV A;  4GXZ A;  4TXV A;  4MA9 A;  4XHM A;  3PIN A;  1WOU A;  4WR4 A;  1A8L A;  1RQM A;  1GP1 A;  1TP9 A;  4MP4 A;  1XIY A;  3KTL A;  3DML A;  3ZIT A;  2H8L A;  3IAS 2;  3LXT A;  4WF4 A;  3PGT A;  2AJQ B;  1SU9 A;  1SEN A;  3CTG A;  4MPF A;  3FZ9 A;  2VD0 A;  4KE3 A;  3WD6 A;  4GCI A;  5IO0 A;  3UEM A;  4EE0 A;  4PNF A;  5JCW A;  4G19 A;  4P3Y B;  2DJK A;  2N5F A;  3G7I A;  3KJY A;  5HR0 A;  3F4T A;  1A24 A;  5A4U A;  2EIO A;  3CTF A;  3IE3 A;  2H0G A;  5B6N A;  2IMK A;  1SL1 B;  1M0U A;  1ERU A;  5ECN B;  2YV9 A;  2GGT A;  2LUS A;  4K0G A;  4PGT A;  4AF2 A;  3KXO A;  2H01 A;  4X43 A;  3QAV A;  3GTU B;  2OAC A;  3LWA A;  4ZB8 A;  3J7Y k;  3IHQ A;  1EWX A;  3NOF A;  2PWJ A;  2FWF A;  2C0G A;  3VLN A;  1XWA A;  1S3C A;  5HR1 A;  5DCH A;  3TKS E;  2CVB A;  4EXJ A;  1G0T A;  2YJ7 A;  3GKN A;  3GRX A;  2H19 A;  7GSS A;  2FUG 2;  2AUV A;  1M2A A;  4NHW A;  1RW1 A;  4BVY A;  1FHE A;  3HJP A;  2ON7 A;  4ACS A;  4TR4 A;  2B7K A;  1JZW A;  1K0C A;  3TJF A;  1GUM A;  3FZ5 A;  2LS5 A;  2V32 A;  1GLQ A;  5D9X A;  3LJR A;  1SYX A;  3ZL5 A;  3C73 A;  4YQU A; 
#chains in the Genus database with same CATH topology
 2Z9S A;  1DSB A;  1GSE A;  2H66 A;  2HZF A;  2H76 A;  1TOF A;  1FG4 A;  2TRX A;  4Q5N A;  4TN8 A;  2MMN A;  4FYB A;  4K5R A;  4ZL7 A;  2HSH A;  2MZC A;  2VL2 A;  1LJR A;  3KP9 A;  2QA1 A;  3M0F A;  3JCM L;  4O7H A;  4K9Z A;  4F82 A;  1M2D A;  1KEB A;  5FHI A;  3G7J A;  3CXG A;  1XVQ A;  3KCM A;  9GSS A;  1G6Y A;  3QR6 A;  5DBQ A;  1MTC A;  2HRA A;  3F4R A;  1SL2 B;  2OBK A;  3P2A A;  2B5Y A;  3UVT A;  5E59 A;  1MD3 A;  1SKR B;  2E0Q A;  2ON5 A;  1IYI A;  4MCU A;  4BVY B;  2P31 A;  3P8W A;  3WGE A;  3D4M A;  2PER A;  2NDO A;  1B4Q A;  3A2X A;  1HNA A;  4V2N A;  3TB2 A;  4XRD A;  1PD2 1;  3FY7 A;  2WZ9 A;  4HJM A;  3TUE A;  4FIW A;  1WE0 A;  3IBH A;  2CX4 A;  3R3E A;  1O6J A;  2R0C A;  3ZLP A;  2LEG A;  2XC2 A;  1RK4 A;  4MLY A;  1YEP A;  1DE2 A;  2LNS A;  5ABR A;  4NMU A;  1VF1 A;  1EGR A;  2ALB A;  5G5E A;  1F9M A;  2J23 A;  3APS A;  2GQL A;  1WP0 A;  2VCZ A;  4IGJ A;  4IS0 A;  2RUE A;  13GS A;  4WEY A;  1J0F A;  19GS A;  2GT6 A;  4FO5 A;  2C3N A;  5IPH A;  1OKT A;  2YAN A;  2X49 A;  3FZ4 A;  4XIH A;  1XW5 A;  2R6K A;  3BJ5 A;  4O32 A;  12GS A;  3VWU A;  2QC7 A;  5B8B A;  2PU9 C;  1AUC A;  3VPQ A;  2HLS A;  2X8C A;  3HXS A;  3ERF A;  3IA1 A;  5CRD A;  1A2L A;  2YPM A;  3FW2 A;  2PVQ A;  2C0F A;  5F07 A;  1N8J A;  5EPF A;  2DJJ A;  5ECR B;  1U6T A;  4G10 A;  1TXX A;  3R2Q A;  4KCE A;  1QQ2 A;  4Z2U A;  1NM3 A;  3FK8 A;  4JBB A;  1XXU A;  5KN1 A;  2O8V B;  4FYC A;  2REM A;  2M72 A;  1OAZ A;  5GSS A;  3KTB A;  4J57 E;  2VCX A;  4IBP A;  3ZML A;  2DJ3 A;  2KUC A;  2VCT A;  3QFA C;  5ELG A;  1T4Z A;  4CY8 A;  3KMN A;  2OKA A;  4HOJ A;  3DVX A;  1EOH A;  3UJ1 A;  2A2R A;  2LRC A;  1MDK A;  3FR6 A;  5J3R A;  2GZP A;  1M9A A;  3MAK A;  5DVB A;  3ZZX A;  2DML A;  2JAC A;  1T00 A;  3A2V A;  3KP8 A;  1XZO A;  2GQM A;  2J9H A;  3GKX A;  2YWO A;  4OO4 A;  4LMW A;  5DQS A;  3DWV A;  2CAQ A;  2WS2 A;  1XWC A;  1AIU A;  2B6M A;  3SWL A;  4MF6 A;  4JZQ A;  4J56 E;  3GKK A;  4PQH A;  2R2J A;  2B5E A;  4HJ2 A;  5IIZ A;  11GS A;  1Z7R A;  2HXK A;  4OMV A;  1G6W A;  4HQZ A;  1O7U A;  4USS A;  1FO5 A;  3RAZ A;  3V1W A;  4BWS A;  2YOI A;  1AXD A;  4IP1 A;  4IQ1 A;  1B48 A;  2L5O A;  3KEB A;  2LQQ A;  2A4V A;  4OD7 A;  3M3M A;  1F3B A;  5HFG A;  2VLT A;  2H1A A;  1GSU A;  2A2P A;  1M7T A;  2MMO A;  4DSS A;  1EP7 A;  1AQX A;  4G0K A;  2IJY A;  1PA3 A;  3GL5 A;  2WJU A;  2H1G A;  4GLT A;  4Z2T A;  4IJI A;  2YJH A;  5IMC A;  5INY A;  5COH A;  5DAL B;  5KOW A;  1E6B A;  1XCC A;  1X0R A;  4X0X A;  2A4H A;  5E4W A;  2FA4 A;  3IV4 A;  5HQP A;  3PPU A;  5F0G A;  2B1L A;  2F8F A;  1BAY A;  1WMJ A;  3PR8 A;  4O5Q A;  1GTU A;  2C1Y A;  4KF9 A;  1PL1 A;  2DJ0 A;  1BG5 A;  1B9Y C;  1GSS A;  1XOA A;  4DEJ A;  3APQ A;  5DDL A;  2CZ3 A;  4IHU A;  2HRK A;  1GRX A;  6GSU A;  2H73 A;  4KCA A;  1QFN A;  2K18 A;  3ZFL A;  4XS4 B;  2V2G A;  2YWN A;  3UMA A;  4I5Q A;  2K6V A;  4POL A;  1PRX A;  3APO A;  4KND A;  3UIW A;  1PMT A;  2VIM A;  4MJC A;  5BMU A;  1NSW A;  3HVS A;  4I8B A;  6GSV A;  4N0V A;  2DJ2 A;  3HYP A;  4F0B A;  5J9C A;  4GF0 A;  3TRP A;  3CMI A;  17GS A;  2VCV A;  2R37 A;  2H1D A;  3GHA A;  3HDC A;  2P0G A;  4BVX A;  4ZB9 A;  5G30 A;  2HYX A;  4TRX A;  5IOX A;  5D9T A;  2DJ1 A;  2FY6 A;  3A3T A;  4FYU A;  1IYH A;  4POB A;  3TKQ A;  1NW2 A;  3I43 A;  3BD2 A;  5ECL B;  1OC8 A;  2FHE A;  5JCG A;  4HU9 A;  2CT6 A;  1OKD A;  4K7O A;  4I97 A;  4GTU A;  5AGY A;  1HQO A;  2CQ9 A;  1R5P A;  3TKS C;  3DVW A;  3F9U A;  2LTK A;  1XBS A;  3IAM 2;  5B7C A;  1AQV A;  2DLX A;  2PPT A;  3MIX A;  3EU3 A;  1JLW A;  1WRY A;  4TXO A;  3DYR A;  4X4J A;  1EZK A;  2QKE A;  3NZN A;  1XFL A;  4OFN A;  2HZE A;  1X9W B;  4ILF A;  3IK7 A;  2G0F A;  4KDX A;  4ZL9 A;  2LNT A;  3KGK A;  1TU8 A;  3ZMK A;  3CRT A;  3TJJ A;  5IM9 A;  4NAX A;  1ZYP A;  2C0D A;  1PL2 A;  1S3R A;  1TK0 B;  4MH3 A;  5C04 A;  1TRV A;  3HZ8 A;  2F3M A;  3Q6O A;  4WF5 A;  1ZCP A;  2FCH A;  2QGV A;  1GUL A;  4KSO A;  1N2A A;  1GLP A;  1K0A A;  1YJ6 A;  2JZS A;  4ECC A;  4ZB6 A;  5FWG A;  1UVZ A;  4BVX B;  5B8A A;  1XVW A;  4OO5 A;  5IMA A;  2YP6 A;  4AJ6 A;  3W8S A;  2VAF A;  1M3J A;  1R7H A;  2FNO A;  2L5L A;  2DBC A;  3Q19 A;  4BL7 B;  1GSQ A;  1K0N A;  3CRU A;  4MJA A;  2HE3 A;  4N10 A;  2CAI A;  3IC8 A;  2QA2 A;  4YQV A;  16GS A;  1OC9 B;  2VL3 A;  1WPI A;  3GX0 A;  1OVN A;  2VOC A;  2LQO A;  3EC3 A;  3C1R A;  4QQ7 A;  2O87 A;  2VD1 A;  3HZ4 A;  4IVF A;  1YEX A;  1NHY A;  1I5G A;  4KDY A;  2FD3 A;  1ERT A;  3IOS A;  4TVE A;  4YAV A;  3QPM A;  5D9W A;  5D73 A;  2FWH A;  3H4K A;  3UAP A;  1G7O A;  3TRX A;  5LCZ A;  4PX1 A;  1JLV A;  1VF2 A;  2R4V A;  3VWW A;  4K6X A;  4MMM A;  4OCE A;  2R3X A;  3G7Y A;  2MYG A;  4HEA 2;  2FWG A;  1PGT A;  4L5O A;  4GWR A;  5CYY A;  1HD2 A;  1HNB A;  1YQ1 A;  3ME7 A;  5IPG A;  3H79 A;  1THO A;  1TU7 A;  4RQX A;  5GAP D;  3MNG A;  3ISO A;  2IN3 A;  1U3I A;  3LOR A;  1B9X C;  4EDZ A;  4D73 A;  1GNW A;  2R5G A;  2GLR A;  1TRU A;  3D0Z A;  1TJD A;  2YN1 A;  5C00 A;  1O8W A;  3O6T A;  3EVI A;  4MAB A;  3KMO A;  2GS3 A;  4GRF A;  4ZBA A;  1GL8 A;  3IK9 A;  4DSR A;  1X5D A;  1U88 A;  2NVL A;  4F2I A;  4GSS A;  5ECP B;  1K0D A;  4MF5 A;  2RM5 A;  1JZR A;  1TKD B;  3C1S A;  4MZC A;  2WCI A;  5ID2 A;  2C80 A;  3ERG A;  4I6X A;  3U5R E;  1Z6M A;  3RHB A;  4IP6 A;  4V1A p;  1A0F A;  4FH8 A;  4K7N A;  5CP1 A;  2HSM A;  3FHK A;  3E3E A;  4PNG A;  1SK2 A;  3LG6 A;  5G1K A;  3VFI A;  1V9W A;  3LEF A;  3F63 A;  3HY2 A;  1UC7 A;  4V1A g;  3TJK A;  3I9V 2;  3TCO A;  5IQY A;  5J5N A;  2X8G A;  1BYE A;  1ZOF A;  3GNJ A;  1FW1 A;  2M80 A;  22GS A;  4ECJ A;  2D2Z A;  2FWE A;  2IIY A;  3ZIV A;  2YWM A;  5JWR B;  3LFL A;  3IRA A;  3KIJ A;  3D22 A;  2TIR A;  5IO2 A;  2H6Y A;  4N11 A;  4N0Z A;  5GZZ B;  3FZA A;  2EC4 A;  1Y6E A;  2XBQ A;  5DJL A;  5ECM B;  2RII A;  1DBY A;  4LA1 A;  3DD3 A;  1BJX A;  2VM1 A;  4KUN A;  2C3Q A;  2E7P A;  2VCW A;  3KM6 A;  3WT2 A;  2AAW A;  4HI7 A;  3HKR A;  3IXR A;  4ML6 A;  3GMF A;  3LYP A;  2I9H A;  1GTI A;  5ID2 B;  3QD9 A;  3KH7 A;  3CYN A;  3I6A A;  5HFK A;  1V2A A;  3G9B A;  1AQW A;  5KN3 A;  4MPG A;  1TDI A;  4PUA A;  2IFQ A;  4KAE A;  1EV4 A;  5CRE A;  1JFU A;  1FAA A;  2KOK A;  2N5A A;  1MEK A;  3FMW A;  3L4N A;  2NPB A;  2GQK A;  2VL9 A;  3F3Q A;  1Z9H A;  1X5E A;  4BIK A;  4V2L A;  4NV5 A;  1U3A A;  4ID0 A;  1ML6 A;  4NPB A;  3TKR A;  1B4P A;  1F6M C;  4OFT A;  3DEX A;  3DXB A;  3TKS A;  3ZVJ D;  3FR3 A;  4HU7 A;  2K8S A;  3CQF A;  2GT5 A;  4F0C A;  2GST A;  2PN8 A;  2LJK A;  2MMA A;  4KSM A;  4QL9 A;  5A4W A;  3KD0 A;  3GV1 A;  1M3I A;  1WJK A;  5J4U A;  1ST9 A;  1A2J A;  3CSI A;  3FEU A;  4Q5R A;  4WBJ A;  4MZW A;  5ECK B;  1EEM A;  4TR1 A;  2PBJ A;  2OA7 A;  2JZT A;  3F4S A;  3F6F A;  3L0H A;  2EIR A;  2B5X A;  4K0N A;  2JSY A;  2VO4 A;  4G2E A;  2IFQ B;  4K8M A;  5ECH B;  5F05 A;  2WDU A;  4ISD A;  3Q18 A;  2R0G A;  1MDI A;  2OE1 A;  3C7M A;  5BRT A;  3F6D A;  1T3B A;  1WWJ A;  5ECI B;  5CRH A;  3ZFB A;  2TRC P;  4L8E A;  1TTZ A;  14GS A;  1T4Y A;  2GTU A;  3O76 A;  3TJB A;  4XS6 A;  2DMM A;  2VL2 C;  2YNX A;  3MDK A;  1UA5 A;  2KLX A;  1V57 A;  3TOT A;  3IDV A;  1SJ6 A;  4NHZ A;  1FB6 A;  1PN9 A;  2C8U A;  2V1M A;  3HJO A;  3HVV A;  3TDG A;  5LNK e;  3GX8 A;  2CV4 A;  5G5F A;  2GZZ A;  2JSZ A;  1LBK A;  3WGX A;  1ON4 A;  5JCU A;  3VK9 A;  4KW6 A;  2L4Q A;  3N5O A;  5G31 A;  2V6O A;  4WR5 A;  1HNC A;  1EEJ A;  4TOP A;  4BWQ A;  2X8H A;  1TW9 A;  2MBT A;  3CSH A;  4TR1 B;  3RHC A;  3FKF A;  2ZNM A;  1QMV A;  2WFC A;  4PQI A;  2DC5 A;  1KTE A;  2HI7 A;  5CNW A;  4G0I A;  2F8A A;  2RUF A;  3MYD A;  2CZ2 A;  4JE1 A;  5DQY A;  2GSR A;  4WXT A;  1FVK A;  4H86 A;  2LV3 A;  2V41 A;  1O81 A;  1FB0 A;  4X1U A;  4XCS A;  4MJB A;  6GST A;  3H1N A;  2H0I A;  3RPN A;  4XS1 A;  3D21 A;  1T1V A;  3QDN A;  3EMP A;  5L71 A;  4J2F A;  3U6V A;  1M9B A;  3US3 A;  4E8E A;  4MF7 A;  4XRA A;  3EWL A;  3ZYW A;  4DSS B;  1I9D A;  1K3Y A;  2IMF A;  4YQM A;  4MDC A;  3W6G A;  1BQ7 A;  4G0L A;  2XPD A;  3LQ7 A;  4Z7X A;  1DUG A;  2G2Q A;  1MD4 A;  1XPV A;  1OE8 A;  1V58 A;  4WKW A;  2H30 A;  4F03 A;  2VLU A;  1XW6 A;  5DCG A;  3CSJ A;  4YH2 A;  5H5Q A;  2DKI A;  2OJL A;  5ENU A;  4EKZ A;  2L4C A;  2HT9 A;  3HJM A;  1CQG A;  1S3A A;  2ES7 A;  3E9J B;  3VWX A;  3BOA A;  4IQA A;  1PX6 A;  3GFK A;  1ZMA A;  4NXI A;  1A0R P;  3RDW A;  2AHE A;  2OE3 A;  3C8E A;  4WBR D;  2IWT A;  4ECI A;  3HA9 A;  3LSZ A;  2AV4 A;  2L57 A;  1F3A A;  4EL1 A;  1GH2 A;  1ZZY A;  4KH7 A;  4TR3 A;  3ZTL A;  4WET A;  3ME8 A;  3ED3 A;  18GS A;  6GSX A;  1ZYQ B;  5B6M A;  1VF4 A;  1YDK A;  5ECS A;  2FGX A;  1BX9 A;  5AIV A;  3GIX A;  4GST A;  2I3Y A;  3I69 A;  1GTB A;  1QGV A;  4PXO A;  1PX7 A;  1V98 A;  2JU5 A;  3GA4 A;  2F9S A;  2FLS A;  2IL3 A;  1SKS B;  6GSS A;  4HSC X;  4HZ4 A;  5H5S A;  3ZRD A;  5F06 A;  4YAP A;  1TK5 B;  4L5L A;  3A2W A;  3GUR A;  5CRW A;  1K0B A;  4DVC A;  4EUY A;  4HQS A;  2CVK A;  1M2B A;  1T7P B;  1A23 A;  4IN0 A;  1W4V A;  2RLI A;  4RQR A;  1YF1 A;  6GSY A;  2LRT A;  2CX3 A;  2X99 A;  1PFO A;  5CRG A;  2H72 A;  2LST A;  2OAD A;  4OWY A;  3VPT A;  4TXO B;  5LD0 A;  1PKW A;  1YKC A;  1U87 A;  3QCP A;  2HZE B;  2HRN A;  2LRN A;  2GVP A;  2DSA A;  4NWY A;  1EV9 A;  2BTO T;  2GSQ A;  2O7K A;  1J9B A;  2LJR A;  5G2Z A;  3SBC A;  3H93 A;  4LL1 B;  3UOM A;  3S9F A;  3EU4 A;  4K1F A;  2JAD A;  2HSY A;  3QFB C;  5IMZ A;  4RUV A;  3HVX A;  1F37 A;  3EUR A;  2XBI A;  3M9K A;  5ECO B;  5KN0 A;  1R4W A;  2B3S A;  2H1B A;  3F8U A;  4IW9 A;  1JZO A;  1TI3 A;  5KEJ A;  4Q5Q A;  2O85 A;  3M8N A;  1Z6N A;  4O92 A;  4K7I A;  3MSZ A;  4LLR A;  4AJ8 A;  3AY8 A;  2L6C A;  4LL4 B;  5D93 A;  4TR0 A;  1G7E A;  4HS1 A;  1PSQ A;  1VRS D;  2H71 A;  2XPE A;  4MK3 A;  1E2Y A;  3EE2 A;  4YKG A;  2MBS A;  5ELA A;  3ZIJ A;  5D96 A;  2HNL A;  2AYT A;  3GYK A;  5KOX A;  2C0E A;  1NHO A;  3VI5 A;  2DIY A;  1URM A;  2HFD A;  1GTA A;  1O85 A;  2H6X A;  2VUP A;  2GDR A;  2YWI A;  3KZQ A;  4DSQ A;  1Z5Y E;  2I81 A;  3L9S A;  4PUR A;  3A5W A;  3IC4 A;  3VUR A;  1YZX A;  1A8Y A;  2OE0 A;  1SYR A;  2UZ8 A;  4OCF A;  1T8E B;  4ECB A;  2N5B A;  2VLV A;  2CVD A;  4I2T A;  5D9V A;  2HRF A;  2WRT A;  1KNG A;  5JWO B;  1GWC A;  1SL0 B;  2LJA A;  2L59 A;  3IR4 A;  4AGS A;  1S3D A;  1TRS A;  3UBK A;  2E2M A;  3IHG A;  2E2G A;  3O3T A;  4L0W A;  3GSS A;  3HHV A;  1VGL A;  4E8H A;  10GS A;  5AIX A;  1H75 A;  2YZU A;  4RI6 A;  6GSW A;  1QUW A;  2DIZ A;  4OFM A;  1CQH A;  2X64 A;  1USB A;  2VCQ A;  3C71 A;  2LKU A;  3GH9 A;  2YZH A;  4HUA A;  3D5J A;  3VWV A;  1YKA A;  3D6I A;  5A5K A;  4EIP A;  4ULX A;  3EPT A;  4D73 B;  3P7X A;  5JWQ B;  3BBY A;  4IJ3 A;  1SD8 A;  4L0U A;  1TRW A;  4MZB A;  4JED A;  5DAK A;  5ECQ B;  2M46 A;  3CBU A;  5DJM A;  4CY6 A;  3UAR A;  4IKH A;  4HZ2 A;  1XW9 A;  2GZY A;  5IOW A;  3VI7 A;  2PVO C;  1FVJ A;  5HR3 A;  3M1G A;  2I1U A;  1XWB A;  5IMD A;  1EGO A;  3HVN A;  2K9F A;  5AN1 A;  1J08 A;  1YF0 A;  1GUH A;  1UN2 A;  3ZRE A;  2EIQ A;  2NTO A;  1GSD A;  4EF0 A;  1AAZ A;  4BA7 A;  3KH9 A;  2IMD A;  4PQ1 A;  1THX A;  3MWH A;  5IMV A;  2WUL A;  4JR6 A;  2H6Z A;  4RI7 A;  1SJI A;  4N30 A;  4ML1 A;  2FA8 A;  3FYG A;  3H8Q A;  1ACV A;  1SK0 A;  1MDJ A;  5EY6 A;  4IEL A;  1XWG A;  3L78 A;  3D4T A;  1YY7 A;  3K8N A;  3RPP A;  1M99 A;  3GST A;  5CO3 A;  5D8I A;  4GSN A;  5AIS A;  1LU4 A;  1AC1 A;  3HCZ A;  1R5A A;  3N9J A;  1PKZ A;  3E0U A;  3IPZ A;  5DAK B;  1BED A;  4CHS A;  2YV7 A;  4TKY A;  2BJX A;  2IPA A;  4G9H A;  1WIK A;  1OE7 A;  1K3O A;  3Q74 A;  2GSS A;  1K0O A;  3LXZ A;  1EP8 A;  1V40 A;  5A4V A;  2P5R A;  5IMF A;  5DAL A;  3EYT A;  2KHP A;  2KP2 A;  3BCI A;  20GS A;  4HDE A;  1EOG A;  3DGQ A;  4JRR A;  3TOU A;  5J41 A;  4LMV A;  3UVH A;  4NV2 A;  1OYJ A;  3RBT A;  4TW5 A;  2JZR A;  1QK8 A;  3LW9 A;  3F0I A;  5GAN D;  4Q5F A;  2B1K A;  1JHB A;  4EO3 A;  2AB6 A;  4F9Z A;  4JU5 A;  2XHF A;  3LGC A;  1W89 A;  3DIE A;  4KDU A;  2L6D A;  3QAG A;  1ABA A;  4ZXG A;  1ERW A;  4CW9 A;  5EVO A;  4ZIJ A;  2NBS A;  2P5Q A;  1K0M A;  2WGR A;  1TI1 A;  1AW9 A;  2K8V A;  4XS4 A;  4PUF C;  1ZYE A;  1KBN A;  2H75 A;  2PGT A;  3ZVJ A;  2PMT A;  5EL8 A;  3W8J A;  5HR2 A;  4EVM A;  3ERW A;  3GL3 A;  4PTS A;  1H4O A;  2H70 A;  1QXH A;  4KA0 A;  1R26 A;  5FT3 A;  1A2M A;  1Y25 A;  1DE1 A;  4K2X A;  1K3L A;  3L9V A;  3WT1 A;  2IME A;  5F8B A;  2H0H A;  3NIV A;  3FR9 A;  2BMX A;  3TGZ A;  3L9U A;  4POM A;  3EIN A;  2V6K A;  3QOU A;  3PH9 A;  1X5C A;  3LYK A;  4K2D A;  4ZBB A;  2H74 A;  5HFI A;  1O73 A;  3QMX A;  5J9B A;  3GUS A;  2QSI A;  1O8X A;  3DKS A;  2PUK C;  2I4A A;  3WGD A;  2O89 A;  1SD9 A;  4YKF A;  4ZIL A;  3UL3 A;  1B8X A;  2C3T A;  5H5R A;  2KP1 A;  2DKH A;  1GNE A;  2A2S A;  4Z2R A;  4CDO A;  4EDY A;  1X9S B;  3GKM A;  3TRQ A;  1PN0 A;  3BCK A;  1Q98 A;  4O5R A;  3TJG A;  4KB3 A;  5KN2 A;  4XTS A;  4MNN A;  1VF3 A;  3FRC A;  4V2M A;  1GSF A;  1GSY A;  4MH2 A;  3J7Y b;  2IMI A;  1ZGN A;  2VM2 A;  3EMX A;  1Q4J A;  1ERV A;  3OR5 A;  2RM6 A;  1X9M B;  2OBI A;  1TK8 B;  1GUK A;  3QAW A;  2ZCT A;  1SKW B;  1XG8 A;  3GN3 A;  3A5I A;  3M9J A;  1ZL9 A;  4I2U A;  4BL7 A;  4ICY A;  3UBL A;  4GQC A;  1PQN A;  4AJ7 A;  1ILO A;  1OC3 A;  2C4J A;  8GSS A;  4MJE A;  3P90 A;  2YCD A;  5GST A;  5G1L A;  1SJZ A;  2MMZ A;  1OC9 A;  2ZUP A;  4POK A;  1F2E A;  4JR4 A;  3F3R A;  4ZL8 A;  4ZBD A;  1XOB A;  4QL7 A;  4GQF A;  3WYW A;  5CAX A;  3HD5 A;  1Z3E A;  1XWK A;  4BPY A;  2F51 A;  3GH6 A;  1C72 A;  4EIQ A;  2JL4 A;  1JZD A;  3DRN A;  2CA8 A;  4KX4 A;  2WB9 A;  1Z7P A;  2X4A A;  3GTU A;  3TKP A;  4KGI A;  4EC0 A;  1HYU A;  1SK1 A;  2B7J A;  1FOV A;  4GXZ A;  4TXV A;  4MA9 A;  4XHM A;  1FOH A;  3PIN A;  1WOU A;  4WR4 A;  1A8L A;  1RQM A;  1GP1 A;  1TP9 A;  4MP4 A;  1XIY A;  3KTL A;  3DML A;  3ZIT A;  2H8L A;  3IAS 2;  3LXT A;  4WF4 A;  3PGT A;  4A5P A;  2AJQ B;  1SU9 A;  1SEN A;  3CTG A;  4MPF A;  3FZ9 A;  2VD0 A;  2R0P A;  4KE3 A;  3WD6 A;  4GCI A;  5IO0 A;  3UEM A;  4EE0 A;  4PNF A;  5JCW A;  4G19 A;  4P3Y B;  2DJK A;  2N5F A;  3G7I A;  3KJY A;  4FQU A;  3F4T A;  5HR0 A;  1A24 A;  5A4U A;  2EIO A;  3CTF A;  3IE3 A;  2H0G A;  5B6N A;  2IMK A;  1SL1 B;  1M0U A;  1ERU A;  5ECN B;  2YV9 A;  2GGT A;  2LUS A;  4K0G A;  4PGT A;  4AF2 A;  3KXO A;  2H01 A;  4X43 A;  3QAV A;  3GTU B;  2OAC A;  3LWA A;  4ZB8 A;  3J7Y k;  3IHQ A;  1EWX A;  3NOF A;  2PWJ A;  2FWF A;  2C0G A;  3VLN A;  1XWA A;  1S3C A;  5HR1 A;  5DCH A;  3TKS E;  2CVB A;  4EXJ A;  1G0T A;  2YJ7 A;  3GKN A;  3GRX A;  2H19 A;  7GSS A;  2FUG 2;  2AUV A;  1M2A A;  4NHW A;  1RW1 A;  4BVY A;  4K5S A;  1FHE A;  3HJP A;  2ON7 A;  4ACS A;  4TR4 A;  2B7K A;  1JZW A;  1K0C A;  1ZYN A;  4O5U A;  3TJF A;  1GUM A;  3FZ5 A;  2LS5 A;  2V32 A;  1GLQ A;  5D9X A;  3LJR A;  1SYX A;  3ZL5 A;  3C73 A;  4YQU A; 
#chains in the Genus database with same CATH homology
 2Z9S A;  1DSB A;  1GSE A;  2H66 A;  2HZF A;  2H76 A;  1TOF A;  1FG4 A;  2TRX A;  4Q5N A;  4TN8 A;  2MMN A;  4FYB A;  4K5R A;  4ZL7 A;  2HSH A;  2MZC A;  2VL2 A;  1LJR A;  3KP9 A;  2QA1 A;  3M0F A;  3JCM L;  4O7H A;  4K9Z A;  4F82 A;  1M2D A;  1KEB A;  5FHI A;  3G7J A;  3CXG A;  1XVQ A;  3KCM A;  9GSS A;  1G6Y A;  3QR6 A;  5DBQ A;  1MTC A;  2HRA A;  3F4R A;  1SL2 B;  2OBK A;  3P2A A;  2B5Y A;  3UVT A;  5E59 A;  1MD3 A;  1SKR B;  2E0Q A;  2ON5 A;  1IYI A;  4MCU A;  4BVY B;  2P31 A;  3P8W A;  3WGE A;  3D4M A;  2PER A;  2NDO A;  1B4Q A;  3A2X A;  1HNA A;  4V2N A;  3TB2 A;  4XRD A;  1PD2 1;  3FY7 A;  2WZ9 A;  4HJM A;  3TUE A;  4FIW A;  1WE0 A;  3IBH A;  2CX4 A;  3R3E A;  1O6J A;  2R0C A;  3ZLP A;  2LEG A;  2XC2 A;  1RK4 A;  4MLY A;  1YEP A;  1DE2 A;  2LNS A;  5ABR A;  4NMU A;  1VF1 A;  1EGR A;  2ALB A;  5G5E A;  1F9M A;  2J23 A;  3APS A;  2GQL A;  1WP0 A;  2VCZ A;  4IGJ A;  4IS0 A;  2RUE A;  13GS A;  4WEY A;  1J0F A;  19GS A;  2GT6 A;  4FO5 A;  2C3N A;  5IPH A;  1OKT A;  2YAN A;  2X49 A;  3FZ4 A;  4XIH A;  1XW5 A;  2R6K A;  3BJ5 A;  4O32 A;  12GS A;  3VWU A;  2QC7 A;  5B8B A;  2PU9 C;  1AUC A;  3VPQ A;  2HLS A;  2X8C A;  3HXS A;  3ERF A;  3IA1 A;  5CRD A;  1A2L A;  2YPM A;  3FW2 A;  2PVQ A;  2C0F A;  5F07 A;  1N8J A;  5EPF A;  2DJJ A;  5ECR B;  1U6T A;  4G10 A;  1TXX A;  3R2Q A;  4KCE A;  1QQ2 A;  4Z2U A;  1NM3 A;  3FK8 A;  4JBB A;  1XXU A;  5KN1 A;  2O8V B;  4FYC A;  2REM A;  2M72 A;  1OAZ A;  5GSS A;  3KTB A;  4J57 E;  2VCX A;  4IBP A;  3ZML A;  2DJ3 A;  2KUC A;  2VCT A;  3QFA C;  5ELG A;  1T4Z A;  4CY8 A;  3KMN A;  2OKA A;  4HOJ A;  3DVX A;  1EOH A;  3UJ1 A;  2A2R A;  2LRC A;  1MDK A;  3FR6 A;  5J3R A;  2GZP A;  1M9A A;  3MAK A;  5DVB A;  3ZZX A;  2DML A;  2JAC A;  1T00 A;  3A2V A;  3KP8 A;  1XZO A;  2GQM A;  2J9H A;  3GKX A;  2YWO A;  4OO4 A;  4LMW A;  5DQS A;  3DWV A;  2CAQ A;  2WS2 A;  1XWC A;  1AIU A;  2B6M A;  3SWL A;  4MF6 A;  4JZQ A;  4J56 E;  3GKK A;  4PQH A;  2R2J A;  2B5E A;  4HJ2 A;  5IIZ A;  11GS A;  1Z7R A;  2HXK A;  4OMV A;  1G6W A;  4HQZ A;  1O7U A;  4USS A;  1FO5 A;  3RAZ A;  3V1W A;  4BWS A;  2YOI A;  1AXD A;  4IP1 A;  4IQ1 A;  1B48 A;  2L5O A;  3KEB A;  2LQQ A;  2A4V A;  4OD7 A;  3M3M A;  1F3B A;  5HFG A;  2VLT A;  2H1A A;  1GSU A;  2A2P A;  1M7T A;  2MMO A;  4DSS A;  1EP7 A;  1AQX A;  4G0K A;  2IJY A;  1PA3 A;  3GL5 A;  2WJU A;  2H1G A;  4GLT A;  4Z2T A;  4IJI A;  2YJH A;  5IMC A;  5INY A;  5COH A;  5DAL B;  5KOW A;  1E6B A;  1XCC A;  1X0R A;  4X0X A;  2A4H A;  5E4W A;  2FA4 A;  3IV4 A;  5HQP A;  3PPU A;  5F0G A;  2B1L A;  2F8F A;  1BAY A;  1WMJ A;  3PR8 A;  4O5Q A;  1GTU A;  2C1Y A;  4KF9 A;  1PL1 A;  2DJ0 A;  1BG5 A;  1B9Y C;  1GSS A;  1XOA A;  4DEJ A;  3APQ A;  5DDL A;  2CZ3 A;  4IHU A;  2HRK A;  1GRX A;  6GSU A;  2H73 A;  4KCA A;  1QFN A;  2K18 A;  3ZFL A;  4XS4 B;  2V2G A;  2YWN A;  3UMA A;  4I5Q A;  2K6V A;  4POL A;  1PRX A;  3APO A;  4KND A;  3UIW A;  1PMT A;  2VIM A;  4MJC A;  5BMU A;  1NSW A;  3HVS A;  4I8B A;  6GSV A;  4N0V A;  2DJ2 A;  3HYP A;  4F0B A;  5J9C A;  4GF0 A;  3TRP A;  3CMI A;  17GS A;  2VCV A;  2R37 A;  2H1D A;  3GHA A;  3HDC A;  2P0G A;  4BVX A;  4ZB9 A;  5G30 A;  2HYX A;  4TRX A;  5IOX A;  5D9T A;  2DJ1 A;  2FY6 A;  3A3T A;  4FYU A;  1IYH A;  4POB A;  3TKQ A;  1NW2 A;  3I43 A;  3BD2 A;  5ECL B;  1OC8 A;  2FHE A;  5JCG A;  4HU9 A;  2CT6 A;  1OKD A;  4K7O A;  4I97 A;  4GTU A;  5AGY A;  1HQO A;  2CQ9 A;  1R5P A;  3TKS C;  3DVW A;  3F9U A;  2LTK A;  1XBS A;  3IAM 2;  5B7C A;  1AQV A;  2DLX A;  2PPT A;  3MIX A;  3EU3 A;  1JLW A;  1WRY A;  4TXO A;  3DYR A;  4X4J A;  1EZK A;  2QKE A;  3NZN A;  1XFL A;  4OFN A;  2HZE A;  1X9W B;  4ILF A;  3IK7 A;  2G0F A;  4KDX A;  4ZL9 A;  2LNT A;  3KGK A;  1TU8 A;  3ZMK A;  3CRT A;  3TJJ A;  5IM9 A;  4NAX A;  1ZYP A;  2C0D A;  1PL2 A;  1TK0 B;  4MH3 A;  5C04 A;  1TRV A;  3HZ8 A;  2F3M A;  3Q6O A;  4WF5 A;  1ZCP A;  2FCH A;  2QGV A;  1GUL A;  4KSO A;  1N2A A;  1GLP A;  1K0A A;  1YJ6 A;  2JZS A;  4ECC A;  4ZB6 A;  5FWG A;  1UVZ A;  4BVX B;  5B8A A;  1XVW A;  4OO5 A;  5IMA A;  2YP6 A;  4AJ6 A;  3W8S A;  2VAF A;  1R7H A;  2FNO A;  2L5L A;  2DBC A;  3Q19 A;  4BL7 B;  1GSQ A;  1K0N A;  3CRU A;  4MJA A;  2HE3 A;  4N10 A;  2CAI A;  3IC8 A;  2QA2 A;  4YQV A;  16GS A;  1OC9 B;  2VL3 A;  1WPI A;  3GX0 A;  1OVN A;  2VOC A;  2LQO A;  3EC3 A;  3C1R A;  4QQ7 A;  2O87 A;  2VD1 A;  3HZ4 A;  4IVF A;  1YEX A;  1NHY A;  1I5G A;  4KDY A;  2FD3 A;  1ERT A;  3IOS A;  4TVE A;  4YAV A;  3QPM A;  5D9W A;  5D73 A;  2FWH A;  3H4K A;  3UAP A;  1G7O A;  3TRX A;  5LCZ A;  4PX1 A;  1JLV A;  1VF2 A;  2R4V A;  3VWW A;  4K6X A;  4MMM A;  4OCE A;  2R3X A;  3G7Y A;  2MYG A;  4HEA 2;  2FWG A;  1PGT A;  4L5O A;  4GWR A;  5CYY A;  1HD2 A;  1HNB A;  1YQ1 A;  3ME7 A;  5IPG A;  3H79 A;  1THO A;  1TU7 A;  4RQX A;  5GAP D;  3MNG A;  3ISO A;  2IN3 A;  1U3I A;  3LOR A;  1B9X C;  4EDZ A;  4D73 A;  1GNW A;  2R5G A;  2GLR A;  1TRU A;  3D0Z A;  1TJD A;  2YN1 A;  5C00 A;  1O8W A;  3O6T A;  3EVI A;  4MAB A;  3KMO A;  2GS3 A;  4GRF A;  4ZBA A;  1GL8 A;  3IK9 A;  4DSR A;  1X5D A;  1U88 A;  2NVL A;  4F2I A;  4GSS A;  5ECP B;  1K0D A;  4MF5 A;  2RM5 A;  1JZR A;  1TKD B;  3C1S A;  4MZC A;  2WCI A;  5ID2 A;  2C80 A;  3ERG A;  4I6X A;  3U5R E;  1Z6M A;  3RHB A;  4IP6 A;  4V1A p;  1A0F A;  4FH8 A;  4K7N A;  5CP1 A;  2HSM A;  3FHK A;  3E3E A;  4PNG A;  1SK2 A;  3LG6 A;  5G1K A;  3VFI A;  1V9W A;  3LEF A;  3F63 A;  3HY2 A;  1UC7 A;  4V1A g;  3TJK A;  3I9V 2;  3TCO A;  5IQY A;  5J5N A;  2X8G A;  1BYE A;  1ZOF A;  3GNJ A;  1FW1 A;  2M80 A;  22GS A;  4ECJ A;  2D2Z A;  2FWE A;  2IIY A;  3ZIV A;  2YWM A;  5JWR B;  3LFL A;  3IRA A;  3KIJ A;  3D22 A;  2TIR A;  5IO2 A;  2H6Y A;  4N11 A;  4N0Z A;  5GZZ B;  3FZA A;  2EC4 A;  1Y6E A;  2XBQ A;  5DJL A;  5ECM B;  2RII A;  1DBY A;  4LA1 A;  3DD3 A;  1BJX A;  2VM1 A;  4KUN A;  2C3Q A;  2E7P A;  2VCW A;  3KM6 A;  3WT2 A;  2AAW A;  4HI7 A;  3HKR A;  3IXR A;  4ML6 A;  3GMF A;  3LYP A;  2I9H A;  1GTI A;  5ID2 B;  3QD9 A;  3KH7 A;  3CYN A;  3I6A A;  5HFK A;  1V2A A;  3G9B A;  1AQW A;  5KN3 A;  4MPG A;  1TDI A;  4PUA A;  2IFQ A;  4KAE A;  1EV4 A;  5CRE A;  1JFU A;  1FAA A;  2KOK A;  2N5A A;  1MEK A;  3FMW A;  3L4N A;  2NPB A;  2GQK A;  2VL9 A;  3F3Q A;  1Z9H A;  1X5E A;  4V2L A;  4NV5 A;  1U3A A;  4ID0 A;  1ML6 A;  4NPB A;  3TKR A;  1B4P A;  1F6M C;  4OFT A;  3DEX A;  3DXB A;  3TKS A;  3ZVJ D;  3FR3 A;  4HU7 A;  2K8S A;  2GT5 A;  4F0C A;  2GST A;  2PN8 A;  2LJK A;  2MMA A;  4KSM A;  4QL9 A;  5A4W A;  3KD0 A;  3GV1 A;  1WJK A;  5J4U A;  1ST9 A;  1A2J A;  3CSI A;  3FEU A;  4Q5R A;  4WBJ A;  4MZW A;  5ECK B;  1EEM A;  4TR1 A;  2PBJ A;  2OA7 A;  2JZT A;  3F4S A;  3F6F A;  3L0H A;  2EIR A;  2B5X A;  4K0N A;  2JSY A;  2VO4 A;  4G2E A;  2IFQ B;  4K8M A;  5ECH B;  5F05 A;  2WDU A;  4ISD A;  3Q18 A;  2R0G A;  1MDI A;  2OE1 A;  3C7M A;  5BRT A;  3F6D A;  1T3B A;  1WWJ A;  5ECI B;  5CRH A;  3ZFB A;  2TRC P;  4L8E A;  1TTZ A;  14GS A;  1T4Y A;  2GTU A;  3O76 A;  3TJB A;  4XS6 A;  2DMM A;  2VL2 C;  2YNX A;  3MDK A;  1UA5 A;  2KLX A;  1V57 A;  3TOT A;  3IDV A;  1SJ6 A;  4NHZ A;  1FB6 A;  1PN9 A;  2C8U A;  2V1M A;  3HJO A;  3HVV A;  3TDG A;  5LNK e;  3GX8 A;  2CV4 A;  5G5F A;  2GZZ A;  2JSZ A;  1LBK A;  3WGX A;  1ON4 A;  5JCU A;  3VK9 A;  4KW6 A;  2L4Q A;  3N5O A;  5G31 A;  2V6O A;  4WR5 A;  1HNC A;  1EEJ A;  4TOP A;  4BWQ A;  2X8H A;  1TW9 A;  2MBT A;  3CSH A;  4TR1 B;  3RHC A;  3FKF A;  2ZNM A;  1QMV A;  2WFC A;  4PQI A;  2DC5 A;  1KTE A;  2HI7 A;  5CNW A;  4G0I A;  2F8A A;  2RUF A;  3MYD A;  2CZ2 A;  4JE1 A;  5DQY A;  2GSR A;  4WXT A;  1FVK A;  4H86 A;  2LV3 A;  2V41 A;  1O81 A;  1FB0 A;  4X1U A;  4XCS A;  4MJB A;  6GST A;  3H1N A;  2H0I A;  3RPN A;  4XS1 A;  3D21 A;  1T1V A;  3QDN A;  3EMP A;  5L71 A;  4J2F A;  3U6V A;  1M9B A;  3US3 A;  4E8E A;  4MF7 A;  4XRA A;  3EWL A;  3ZYW A;  4DSS B;  1I9D A;  1K3Y A;  2IMF A;  4YQM A;  4MDC A;  3W6G A;  1BQ7 A;  4G0L A;  2XPD A;  3LQ7 A;  4Z7X A;  1DUG A;  2G2Q A;  1MD4 A;  1XPV A;  1OE8 A;  1V58 A;  4WKW A;  2H30 A;  4F03 A;  2VLU A;  1XW6 A;  5DCG A;  3CSJ A;  4YH2 A;  5H5Q A;  2DKI A;  2OJL A;  5ENU A;  4EKZ A;  2L4C A;  2HT9 A;  3HJM A;  1CQG A;  1S3A A;  2ES7 A;  3E9J B;  3VWX A;  3BOA A;  4IQA A;  1PX6 A;  3GFK A;  1ZMA A;  4NXI A;  1A0R P;  3RDW A;  2AHE A;  2OE3 A;  3C8E A;  4WBR D;  2IWT A;  4ECI A;  3HA9 A;  3LSZ A;  2AV4 A;  2L57 A;  1F3A A;  4EL1 A;  1GH2 A;  1ZZY A;  4KH7 A;  4TR3 A;  3ZTL A;  4WET A;  3ME8 A;  3ED3 A;  18GS A;  6GSX A;  1ZYQ B;  5B6M A;  1VF4 A;  1YDK A;  5ECS A;  2FGX A;  1BX9 A;  5AIV A;  3GIX A;  4GST A;  2I3Y A;  3I69 A;  1GTB A;  1QGV A;  4PXO A;  1PX7 A;  1V98 A;  2JU5 A;  3GA4 A;  2F9S A;  2FLS A;  2IL3 A;  1SKS B;  6GSS A;  4HZ4 A;  5H5S A;  3ZRD A;  5F06 A;  4YAP A;  1TK5 B;  4L5L A;  3A2W A;  3GUR A;  5CRW A;  1K0B A;  4DVC A;  4EUY A;  4HQS A;  2CVK A;  1M2B A;  1T7P B;  1A23 A;  4IN0 A;  1W4V A;  2RLI A;  4RQR A;  1YF1 A;  6GSY A;  2LRT A;  2CX3 A;  2X99 A;  5CRG A;  2H72 A;  2LST A;  2OAD A;  4OWY A;  3VPT A;  4TXO B;  5LD0 A;  1PKW A;  1YKC A;  1U87 A;  3QCP A;  2HZE B;  2HRN A;  2LRN A;  2GVP A;  2DSA A;  4NWY A;  1EV9 A;  2BTO T;  2GSQ A;  2O7K A;  1J9B A;  2LJR A;  5G2Z A;  3SBC A;  3H93 A;  4LL1 B;  3UOM A;  3S9F A;  3EU4 A;  4K1F A;  2JAD A;  2HSY A;  3QFB C;  5IMZ A;  4RUV A;  3HVX A;  1F37 A;  3EUR A;  2XBI A;  3M9K A;  5ECO B;  5KN0 A;  1R4W A;  2B3S A;  2H1B A;  3F8U A;  4IW9 A;  1JZO A;  1TI3 A;  5KEJ A;  4Q5Q A;  2O85 A;  3M8N A;  1Z6N A;  4O92 A;  4K7I A;  3MSZ A;  4LLR A;  4AJ8 A;  3AY8 A;  2L6C A;  4LL4 B;  5D93 A;  4TR0 A;  1G7E A;  4HS1 A;  1PSQ A;  1VRS D;  2H71 A;  2XPE A;  4MK3 A;  1E2Y A;  3EE2 A;  4YKG A;  2MBS A;  5ELA A;  3ZIJ A;  5D96 A;  2HNL A;  2AYT A;  3GYK A;  5KOX A;  2C0E A;  1NHO A;  3VI5 A;  2DIY A;  1URM A;  2HFD A;  1GTA A;  1O85 A;  2H6X A;  2VUP A;  2GDR A;  2YWI A;  3KZQ A;  4DSQ A;  1Z5Y E;  2I81 A;  3L9S A;  4PUR A;  3A5W A;  3IC4 A;  3VUR A;  1YZX A;  1A8Y A;  2OE0 A;  1SYR A;  2UZ8 A;  4OCF A;  1T8E B;  4ECB A;  2N5B A;  2VLV A;  2CVD A;  4I2T A;  5D9V A;  2HRF A;  2WRT A;  1KNG A;  5JWO B;  1GWC A;  1SL0 B;  2LJA A;  2L59 A;  3IR4 A;  4AGS A;  1S3D A;  1TRS A;  3UBK A;  2E2M A;  3IHG A;  2E2G A;  3O3T A;  4L0W A;  3GSS A;  3HHV A;  1VGL A;  4E8H A;  10GS A;  5AIX A;  1H75 A;  2YZU A;  4RI6 A;  6GSW A;  1QUW A;  2DIZ A;  4OFM A;  1CQH A;  2X64 A;  1USB A;  2VCQ A;  3C71 A;  2LKU A;  3GH9 A;  2YZH A;  4HUA A;  3D5J A;  3VWV A;  1YKA A;  3D6I A;  5A5K A;  4EIP A;  4ULX A;  3EPT A;  4D73 B;  3P7X A;  5JWQ B;  3BBY A;  4IJ3 A;  1SD8 A;  4L0U A;  1TRW A;  4MZB A;  4JED A;  5DAK A;  5ECQ B;  2M46 A;  3CBU A;  5DJM A;  4CY6 A;  3UAR A;  4IKH A;  4HZ2 A;  1XW9 A;  2GZY A;  5IOW A;  3VI7 A;  2PVO C;  1FVJ A;  5HR3 A;  3M1G A;  2I1U A;  1XWB A;  5IMD A;  1EGO A;  2K9F A;  5AN1 A;  1J08 A;  1YF0 A;  1GUH A;  1UN2 A;  3ZRE A;  2EIQ A;  2NTO A;  1GSD A;  4EF0 A;  1AAZ A;  4BA7 A;  3KH9 A;  2IMD A;  4PQ1 A;  1THX A;  3MWH A;  5IMV A;  2WUL A;  4JR6 A;  2H6Z A;  4RI7 A;  1SJI A;  4N30 A;  4ML1 A;  2FA8 A;  3FYG A;  3H8Q A;  1ACV A;  1SK0 A;  1MDJ A;  5EY6 A;  4IEL A;  1XWG A;  3L78 A;  3D4T A;  1YY7 A;  3K8N A;  3RPP A;  1M99 A;  3GST A;  5CO3 A;  5D8I A;  4GSN A;  5AIS A;  1LU4 A;  1AC1 A;  3HCZ A;  1R5A A;  3N9J A;  1PKZ A;  3E0U A;  3IPZ A;  5DAK B;  1BED A;  4CHS A;  2YV7 A;  4TKY A;  2BJX A;  2IPA A;  4G9H A;  1WIK A;  1OE7 A;  1K3O A;  3Q74 A;  2GSS A;  1K0O A;  3LXZ A;  1EP8 A;  1V40 A;  5A4V A;  2P5R A;  5IMF A;  5DAL A;  3EYT A;  2KHP A;  2KP2 A;  3BCI A;  20GS A;  4HDE A;  1EOG A;  3DGQ A;  4JRR A;  3TOU A;  5J41 A;  4LMV A;  3UVH A;  4NV2 A;  1OYJ A;  3RBT A;  4TW5 A;  2JZR A;  1QK8 A;  3LW9 A;  3F0I A;  5GAN D;  4Q5F A;  2B1K A;  1JHB A;  4EO3 A;  2AB6 A;  4F9Z A;  4JU5 A;  2XHF A;  3LGC A;  1W89 A;  3DIE A;  4KDU A;  2L6D A;  3QAG A;  1ABA A;  4ZXG A;  1ERW A;  4CW9 A;  5EVO A;  4ZIJ A;  2NBS A;  2P5Q A;  1K0M A;  2WGR A;  1TI1 A;  1AW9 A;  2K8V A;  4XS4 A;  4PUF C;  1ZYE A;  1KBN A;  2H75 A;  2PGT A;  3ZVJ A;  2PMT A;  5EL8 A;  3W8J A;  5HR2 A;  4EVM A;  3ERW A;  3GL3 A;  4PTS A;  1H4O A;  2H70 A;  1QXH A;  4KA0 A;  1R26 A;  5FT3 A;  1A2M A;  1Y25 A;  1DE1 A;  4K2X A;  1K3L A;  3L9V A;  3WT1 A;  2IME A;  5F8B A;  2H0H A;  3NIV A;  3FR9 A;  2BMX A;  3TGZ A;  3L9U A;  4POM A;  3EIN A;  2V6K A;  3QOU A;  3PH9 A;  1X5C A;  3LYK A;  4K2D A;  4ZBB A;  2H74 A;  5HFI A;  1O73 A;  3QMX A;  5J9B A;  3GUS A;  2QSI A;  1O8X A;  3DKS A;  2PUK C;  2I4A A;  3WGD A;  2O89 A;  1SD9 A;  4YKF A;  4ZIL A;  3UL3 A;  1B8X A;  2C3T A;  5H5R A;  2KP1 A;  2DKH A;  1GNE A;  2A2S A;  4Z2R A;  4CDO A;  4EDY A;  1X9S B;  3GKM A;  3TRQ A;  1PN0 A;  3BCK A;  1Q98 A;  4O5R A;  3TJG A;  4KB3 A;  5KN2 A;  4XTS A;  4MNN A;  1VF3 A;  3FRC A;  4V2M A;  1GSF A;  1GSY A;  4MH2 A;  3J7Y b;  2IMI A;  1ZGN A;  2VM2 A;  3EMX A;  1Q4J A;  1ERV A;  3OR5 A;  2RM6 A;  1X9M B;  2OBI A;  1TK8 B;  1GUK A;  3QAW A;  2ZCT A;  1SKW B;  3GN3 A;  3A5I A;  3M9J A;  1ZL9 A;  4I2U A;  4BL7 A;  4ICY A;  3UBL A;  4GQC A;  1PQN A;  4AJ7 A;  1ILO A;  1OC3 A;  2C4J A;  8GSS A;  4MJE A;  3P90 A;  2YCD A;  5GST A;  5G1L A;  1SJZ A;  2MMZ A;  1OC9 A;  2ZUP A;  4POK A;  1F2E A;  4JR4 A;  3F3R A;  4ZL8 A;  4ZBD A;  1XOB A;  4QL7 A;  4GQF A;  3WYW A;  5CAX A;  3HD5 A;  1Z3E A;  1XWK A;  4BPY A;  2F51 A;  3GH6 A;  1C72 A;  4EIQ A;  2JL4 A;  1JZD A;  3DRN A;  2CA8 A;  4KX4 A;  2WB9 A;  1Z7P A;  2X4A A;  3GTU A;  3TKP A;  4KGI A;  4EC0 A;  1HYU A;  1SK1 A;  2B7J A;  1FOV A;  4GXZ A;  4TXV A;  4MA9 A;  4XHM A;  1FOH A;  3PIN A;  1WOU A;  4WR4 A;  1A8L A;  1RQM A;  1GP1 A;  1TP9 A;  4MP4 A;  1XIY A;  3KTL A;  3DML A;  3ZIT A;  2H8L A;  3IAS 2;  3LXT A;  4WF4 A;  3PGT A;  4A5P A;  2AJQ B;  1SU9 A;  1SEN A;  3CTG A;  4MPF A;  3FZ9 A;  2VD0 A;  2R0P A;  4KE3 A;  3WD6 A;  4GCI A;  5IO0 A;  3UEM A;  4EE0 A;  4PNF A;  5JCW A;  4G19 A;  4P3Y B;  2DJK A;  2N5F A;  3G7I A;  3KJY A;  4FQU A;  3F4T A;  5HR0 A;  1A24 A;  5A4U A;  2EIO A;  3CTF A;  3IE3 A;  2H0G A;  5B6N A;  2IMK A;  1SL1 B;  1M0U A;  1ERU A;  5ECN B;  2YV9 A;  2GGT A;  2LUS A;  4K0G A;  4PGT A;  4AF2 A;  3KXO A;  2H01 A;  4X43 A;  3QAV A;  3GTU B;  2OAC A;  3LWA A;  4ZB8 A;  3J7Y k;  3IHQ A;  1EWX A;  3NOF A;  2PWJ A;  2FWF A;  2C0G A;  3VLN A;  1XWA A;  1S3C A;  5HR1 A;  5DCH A;  3TKS E;  2CVB A;  4EXJ A;  1G0T A;  2YJ7 A;  3GKN A;  3GRX A;  2H19 A;  7GSS A;  2FUG 2;  2AUV A;  1M2A A;  4NHW A;  1RW1 A;  4BVY A;  4K5S A;  1FHE A;  3HJP A;  2ON7 A;  4ACS A;  4TR4 A;  2B7K A;  1JZW A;  1K0C A;  1ZYN A;  4O5U A;  3TJF A;  1GUM A;  3FZ5 A;  2LS5 A;  2V32 A;  1GLQ A;  5D9X A;  3LJR A;  1SYX A;  3ZL5 A;  3C73 A;  4YQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...