2LQQA

Oxidized mrx1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
88
structure length
88
Chain Sequence
MVTAALTIYTTSWCGYCLRLKTALTANRIAYDEVDIEHNRAAAEFVGSVNGGNRTVPTVKFADGSTLTNPSADEVKAKLVKIAGLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative glutaredoxin Rv3198.1/MT3292
publication title Mycoredoxin-1 is one of the missing links in the oxidative stress defence mechanism of Mycobacteria.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 24
structure length 88
sequence length 88
ec nomenclature ec 1.-.-.-:
pdb deposition date 2012-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2lqqA00
5AISA 2H0GA 5AGYA 1V57A 4DSQA 1XOAA 3WT1A 2HZEA 4ZIJA 5ELAA 3TGZA 3J7Yk 3GH9A 5DALA 5KN2A 2V1MA 2YN1A 2ZNMA 3O76A 4YAPA 3N5OA 1TI1A 4WF5A 5G30A 6GSVA 3ZMKA 2DIYA 3G7YA 2QGVA 2I9HA 3HZ4A 1AW9A 1PX7A 4ECJA 4NHWA 2H72A 2LSTA 2TRCP 1BX9A 5EVOA 2N5BA 4TXVA 1Z6NA 1GTUA 3GUSA 1LU4A 3GL5A 3HY2A 4MF6A 3J7Yb 2R2JA 4MZBA 3M3MA 3GMFA 6GSXA 1OYJA 2F9SA 1XBSA 1VF4A 4MPGA 1PL1A 4FYUA 2JADA 2FWGA 1QGVA 3L0HA 2AV4A 5ELGA 1J0FA 1DUGA 5CAXA 2CAIA 4MMMA 4K1FA 4TVEA 1SKWB 2B5XA 2FWEA 5ECHB 2BMXA 2OA7A 2DMMA 2IFQA 3LG6A 2NDOA 2B7KA 2GT6A 4NV5A 1PX6A 2WULA 1Y6EA 5ECSA 1EOGA 1F3AA 3GRXA 5E4WA 3M8NA 2GSQA 4PGTA 1YJ6A 3APSA 4EL1A 4Q5FA 3HCZA 2IMFA 4PX1A 3D22A 2OACA 3I69A 3E0UA 5D96A 1X9SB 3O6TA 1B9XC 3C71A 1WPIA 1WRYA 2KHPA 1MDKA 5ECQB 3F6DA 5CP1A 2E7PA 2H6YA 1ZCPA 4MH3A 5ECMB 2HXKA 3QMXA 2MMOA 1IYHA 1W89A 2EIQA 3OR5A 3DWVA 3QPMA 4XIHA 2VO4A 2KP2A 2YZHA 1ERTA 4XHMA 4MK3A 3P7XA 2QSIA 2REMA 3F8UA 4X1UA 2IIYA 4F0BA 3QDNA 1K0AA 2VOCA 1E6BA 2QC7A 1GP1A 4XTSA 2M72A 4I2UA 5GSSA 2H76A 1V58A 2IPAA 3ZREA 2DLXA 3LXZA 2VUPA 1QMVA 1RK4A 1EGRA 5ID2B 1EGOA 4OD7A 4V2MA 2VCTA 3TKSC 2YP6A 1K0MA 2K9FA 1V9WA 4F03A 1QFNA 2J23A 5LNKe 5KEJA 2I1UA 4TR4A 5LD0A 1QK8A 2PWJA 1O73A 3TB2A 4IJ3A 5JCUA 3TOUA 3W8SA 3KXOA 2H19A 1EEJA 2OE0A 5IOXA 1OC3A 2V41A 1A2LA 2VLUA 4GTUA 4IP1A 5HQPA 3H79A 2FLSA 4JU5A 1FOVA 4WR4A 2LKUA 3LJRA 3IHQA 1M2AA 3KIJA 5FHIA 3WT2A 3F6FA 1HD2A 3KP9A 2ALBA 1UVZA 2NVLA 3KTBA 4GSNA 1FHEA 3VI5A 3EMPA 3KMOA 18GSA 3GSTA 3DD3A 4JR6A 1PQNA 3QAGA 5HFGA 2YANA 5KN1A 4J2FA 3QOUA 2MMAA 1K3LA 4TR1B 5G1KA 2LUSA 3TKPA 3DKSA 3IBHA 2PVOC 4GF0A 3LQ7A 4OO5A 1PGTA 3HKRA 5EY6A 2HFDA 3A2VA 2DJ1A 2F51A 2L5OA 2YWMA 2P5RA 1XW5A 4GSTA 1XVWA 3IE3A 4TR3A 2IMIA 3L4NA 4L5OA 2VCZA 1K0NA 2NTOA 2A4VA 3ZMLA 5F8BA 2GSTA 3U6VA 3W6GA 3IAS2 3P90A 4MP4A 5INYA 3KM6A 1GLQA 1WWJA 3WGEA 5IO2A 4EF0A 1Z5YE 4V2LA 3TDGA 16GSA 4IVFA 1A23A 1GL8A 2I3YA 3RDWA 1U3AA 5D9TA 3HJOA 4ZB8A 5JCWA 4HJMA 4E8HA 4NPBA 2H75A 1LBKA 2HYXA 1V2AA 3TJKA 3VURA 6GSSA 3QFAC 1TTZA 4BPYA 3KH9A 5F05A 1KTEA 4NMUA 9GSSA 2B5EA 1WMJA 5HR1A 5F06A 1M0UA 3IK7A 2NPBA 3UOMA 4XS1A 4KCEA 2P31A 4KDUA 5F07A 4K2DA 2EC4A 2WDUA 1TDIA 1SD8A 3HJPA 1MD3A 2CVBA 3FR3A 4K7NA 3KZQA 2N5AA 2GZPA 2C0DA 2JZSA 1NHYA 1V40A 1LJRA 5IQYA 4DVCA 2VM2A 3DYRA 2CX4A 3FZAA 3DVXA 2FD3A 1Z6MA 1GNEA 3FR9A 4MJEA 4TW5A 2C3TA 4PQ1A 1XOBA 5JWOB 4IJIA 1UN2A 2X8CA 5E59A 1BQ7A 1WJKA 3ERFA 2K6VA 2HLSA 1YKCA 3ERWA 1FB0A 2C80A 2PPTA 3TRPA 4KW6A 5L71A 2VLTA 5KN0A 3EU3A 1ERWA 2E2MA 5ECRB 1ZYQB 2H0HA 2R5GA 2C0GA 2H73A 3H93A 5D9XA 2LV3A 4HI7A 4KNDA 1XWAA 3UBKA 1ERVA 1ILOA 1C72A 3GKMA 1XWKA 4F9ZA 3GKXA 2IMDA 2JSYA 3TRXA 4AJ8A 1THXA 2H71A 4ZL9A 4BVXA 3TOTA 4HEA2 5ECKB 2FNOA 1Q98A 5AIXA 2DJKA 2RUFA 4OFMA 3VFIA 2B6MA 1MTCA 5CO3A 2PGTA 2VL2A 3PH9A 3VWWA 1OE8A 2GQLA 1FVJA 5ECIB 2F3MA 2A2RA 1RQMA 4D73B 1OKTA 2PBJA 2VD0A 2MMNA 1XW9A 1EV9A 3IA1A 4QL7A 3FHKA 3KEBA 5CRGA 4IBPA 2E0QA 3WYWA 2JZTA 1YKAA 2YV7A 10GSA 2YJHA 3LXTA 1B8XA 3KGKA 14GSA 5DVBA 3L9VA 4XS4B 4IELA 2ON7A 1USBA 2JL4A 1NW2A 2KP1A 2V32A 4L0UA 1H4OA 4OMVA 4I5QA 4KB3A 1TP9A 1YF1A 1NSWA 2DJ2A 3QAVA 1TI3A 1XXUA 2RM6A 3QAWA 2AYTA 1Z9HA 1SJIA 3BD2A 2VL3A 2JACA 3UIWA 4EXJA 2J9HA 2DJJA 4XS6A 2XPDA 3CRTA 2F8FA 1G6YA 1B9YC 4HQZA 2IFQB 3L9SA 1DSBA 1H75A 2H6XA 3F4SA 5ECOB 2H1AA 4L8EA 3C1SA 5JWRB 1PSQA 4YQUA 1K0DA 1JFUA 4LA1A 4WEYA 5EL8A 2FGXA 3PINA 2LEGA 3UJ1A 2KUCA 4OCEA 3VWVA 4I2TA 1SD9A 5IM9A 3SWLA 1A8YA 1G0TA 4GSSA 1GH2A 2N5FA 2GLRA 1EOHA 3WD6A 3ME8A 3VLNA 1K0CA 2HZFA 2B1LA 1TRSA 2RIIA 3VWUA 5DJLA 2IJYA 1ON4A 2O7KA 2WJUA 3FW2A 3D4MA 2RM5A 3TJJA 4QL9A 2PVQA 2VLVA 5H5RA 1U6TA 4GCIA 2GSSA 4MH2A 1AIUA 3HD5A 2LRCA 1F2EA 3EE2A 2AB6A 5IMAA 2XC2A 4P3YB 2HE3A 3CYNA 4N10A 1AQVA 3IRAA 1Z7RA 2C3NA 2B7JA 3G7JA 4RQXA 1ACVA 1PD21 2GZYA 1B48A 1TRWA 2AHEA 1WIKA 3GL3A 2H1GA 4HQSA 1VF1A 5B8BA 1RW1A 2EIRA 5IIZA 1HYUA 4PNGA 2X8HA 4PQHA 5ECNB 5AN1A 1TK5B 3IDVA 2H74A 4MLYA 1AC1A 1BEDA 2YPMA 3GX8A 3LEFA 2FUG2 4MJBA 3ZVJA 3G7IA 2H1DA 3IC4A 2B1KA 4MJCA 4IP6A 2GVPA 3HZ8A 5H5QA 1X9WB 4OCFA 3LWAA 3U5RE 2OE3A 5ENUA 2WB9A 1GSYA 2OBIA 4WETA 3RHBA 5AIVA 3ZIJA 3E3EA 3CXGA 4LL4B 2CAQA 4HS1A 4HUAA 4G9HA 3HXSA 3ZIVA 2B3SA 3HJMA 1T00A 1GSDA 1KBNA 4WBJA 4MDCA 2JSZA 1JLVA 5A4UA 1YY7A 1TRVA 4NHZA 4YQMA 4OFNA 5GZZB 2O87A 1T1VA 1QUWA 3BOAA 1XWBA 4J56E 4ZL8A 2CT6A 3GIXA 1WE0A 4Z7XA 3KD0A 1SL0B 1XCCA 3F63A 3ZTLA 5DJMA 4KH7A 2VD1A 2H01A 2PMTA 4TXOB 2VCVA 1PA3A 1O6JA 2PN8A 3MSZA 4NAXA 4PNFA 1W4VA 3GH6A 5J3RA 2B5YA 1PKWA 4QQ7A 4IN0A 3IXRA 3PR8A 3GKKA 4K6XA 2HSYA 1TKDB 2IMKA 1GLPA 5B6MA 2F8AA 3TKQA 1HNCA 5IMZA 1URMA 1EP8A 4IS0A 2WCIA 2GQKA 3APQA 2CVKA 1FG4A 2FWHA 1GUMA 4ZBBA 2YJ7A 5ID2A 4RI7A 4V1Ap 1SYRA 3AY8A 3ME7A 3GV1A 1JLWA 2OBKA 2FY6A 2AJQB 1OKDA 1M2BA 3KMNA 1R7HA 4GWRA 3WGDA 1DE2A 2VAFA 4KE3A 1XFLA 3ISOA 1B4QA 1UC7A 2DBCA 3NOFA 1O7UA 1PRXA 4L5LA 1SL1B 3ZL5A 4E8EA 2L4QA 3FRCA 5J5NA 3GFKA 1K3YA 3MAKA 3TKSE 1XWGA 3R2QA 3HDCA 19GSA 2LNSA 1R5AA 2IN3A 4DSSA 4KUNA 3CSIA 5HFKA 12GSA 3UVHA 3UL3A 4HOJA 1GTBA 4AGSA 4H86A 4FO5A 4MPFA 5DQYA 1TK0B 1SKRB 1U87A 3QFBC 1SK1A 3UMAA 1OC9B 5CNWA 3EMXA 3KH7A 1UA5A 1F9MA 1SYXA 4HZ2A 4O32A 5IPHA 4FH8A 2H8LA 4X43A 2XHFA 2L6CA 4LMWA 2FA4A 3F3RA 3LYPA 3KJYA 3KTLA 11GSA 2XBIA 4V2NA 2ON5A 3LORA 3QCPA 1T3BA 13GSA 3BCKA 2MBSA 4ZXGA 2FWFA 2OE1A 5CREA 1XVQA 1BJXA 3LFLA 3GTUA 1DE1A 1YQ1A 2R4VA 2P5QA 5DAKA 1PMTA 2D2ZA 3GKNA 3ZYWA 3G9BA 3DMLA 2YZUA 3H8QA 4Q5RA 3GX0A 2CZ3A 1U88A 4NV2A 4CHSA 3HVSA 5DCGA 4EDYA 1HNBA 4JEDA 8GSSA 4AJ7A 3VWXA 1XWCA 2LQOA 1EV4A 2L59A 2DJ3A 1FW1A 2DJ0A 22GSA 3GURA 4LL1B 1JHBA 5C00A 1S3DA 5IMFA 4WBRD 3A2XA 1F37A 3S9FA 1PN9A 2LS5A 3FR6A 4ISDA 1AQWA 2L6DA 2OKAA 1B4PA 1FB6A 5CYYA 2QKEA 3H1NA 3DRNA 2CQ9A 1EP7A 3UBLA 3I9V2 2LJKA 3F9UA 2FHEA 2GS3A 1VGLA 3TKRA 4POLA 3MWHA 4TR0A 1CQHA 2DMLA 2HNLA 1A2MA 1FVKA 1K3OA 1GRXA 2WRTA 3UVTA 4RUVA 5B7CA 3ZZXA 4ULXA 2C0EA 2L5LA 4PXOA 1ZL9A 5H5SA 1V98A 3D0ZA 3MNGA 5JWQB 4POMA 3TUEA 3ZITA 2GGTA 4YH2A 2XPEA 1VF3A 1KEBA 4GRFA 2VIMA 5FWGA 2X8GA 3EVIA 2R6KA 4F0CA 4MZCA 1YEPA 3FKFA 3RPPA 3L9UA 1N2AA 1EZKA 4MF5A 1GNWA 3QD9A 2TRXA 4J57E 5DQSA 3TKSA 4ML1A 5IMDA 1ST9A 2HZEB 4EUYA 1TW9A 1X9MB 4BVYA 2H6ZA 1M7TA 5DALB 4BWSA 4EVMA 1E2YA 1A2JA 4K8MA 1A24A 3TCOA 3GSSA 1SL2B 4FYBA 1TXXA 1MDIA 2GQMA 2A2SA 1AUCA 4XRAA 2K8VA 4MABA 2C1YA 3FYGA 5LCZA 3I6AA 1T8EB 1Y25A 3CMIA 1R26A 1BG5A 2YWOA 4PUAA 5GSTA 4IW9A 2WGRA 2GT5A 3N9JA 1NHOA 4WXTA 3TJGA 3CSHA 2MMZA 5GAND 1FO5A 3MDKA 2GTUA 2RUEA 2C3QA 3ERGA 5A4WA 2R37A 4K0GA 5G5EA 5CRWA 3M0FA 3HVVA 5DCHA 1X5DA 3EC3A 3Q18A 3RPNA 4D73A 1ZOFA 3WGXA 3CBUA 2O85A 5G31A 4F82A 1A0RP 5HR0A 4TKYA 2O89A 3Q6OA 1T4ZA 4EE0A 1JZOA 5C04A 2HI7A 4IGJA 5IPGA 2C8UA 4POKA 1N8JA 3ED3A 4WR5A 1X0RA 2GSRA 2FCHA 2YWNA 4G2EA 3US3A 2DC5A 1K0BA 1EEMA 1JZRA 2RLIA 4XS4A 2YOIA 2TIRA 2H0IA 4AF2A 3UEMA 3FZ4A 3Q19A 4WKWA 4WF4A 1TJDA 1Z3EA 3ZFBA 4KCAA 1GULA 2LQQA 4HJ2A 3O3TA 4ID0A 5G5FA 4HDEA 2WS2A 2K8SA 3LGCA 3IOSA 1XPVA 1R4WA 1X5CA 4Q5NA 5G2ZA 4ILFA 1J9BA 3K8NA 4KAEA 3C73A 3P2AA 1EWXA 3VPQA 2R3XA 2VCWA 2O8VB 1TU7A 3Q74A 2IWTA 2OADA 2X64A 1OE7A 5HR3A 1GTAA 4POBA 4GLTA 1O81A 2BJXA 3BCIA 4RQRA 1OVNA 3EURA 2KLXA 2V6OA 4X0XA 5IMVA 3GA4A 4BL7A 3IPZA 2IMEA 1GSEA 3A2WA 2V6KA 6GSYA 4EDZA 1NM3A 5IO0A 5A5KA 1BAYA 3W8JA 2HRNA 2DSAA 1T4YA 2H1BA 3F4RA 4G10A 1GSUA 17GSA 4KX4A 1Z7PA 3F4TA 4ML6A 3HA9A 4JBBA 3L78A 3NZNA 4ZILA 3CSJA 3ZFLA 3DEXA 5JCGA 1YF0A 3APOA 2YWIA 1JZWA 2JU5A 2LNTA 4IQAA 4JRRA 5D9WA 5ECPB 3C7MA 2PERA 5B6NA 3HHVA 1T7PB 4ZBDA 2YNXA 5DBQA 6GSWA 3D4TA 2LRNA 4ZBAA 2ES7A 2VM1A 4K0NA 1BYEA 4CW9A 2G2QA 2XBQA 5D9VA 7GSSA 4MZWA 2LRTA 2L57A 2AAWA 3HVXA 1SJZA 4GXZA 2VL2C 2CV4A 3CTGA 3FEUA 5DDLA 1J08A 3DXBA 1ML6A 2WFCA 1IYIA 1FAAA 4NXIA 4I97A 5D93A 4ZB6A 4ECCA 1XIYA 3F0IA 1O8WA 1GWCA 1DBYA 1TU8A 2I81A 3D21A 1AAZA 1SK0A 2DIZA 3GN3A 1I9DA 1Q4JA 1SENA 2C4JA 2PU9C 2IL3A 2X99A 1TK8B 5D8IA 4N11A 5HFIA 4I6XA 4DSSB 1QXHA 3C1RA 3BJ5A 2YV9A 1XZOA 2JZRA 4FIWA 1F6MC 3H4KA 3A5WA 3I43A 5J4UA 2MBTA 2LTKA 1GSFA 2EIOA 3UAPA 1HNAA 1M9BA 3DIEA 4ECBA 1AXDA 3GYKA 4JR4A 2CA8A 4N30A 4XRDA 2LJRA 1TRUA 4YAVA 3P8WA 3IR4A 1ABAA 1PL2A 2HSHA 4F2IA 3FZ5A 1S3AA 4V1Ag 3E9JB 3M9JA 1F3BA 5D73A 4LLRA 4IHUA 3GTUB 3LYKA 1SK2A 5F0GA 3D5JA 1AQXA 1MEKA 4KGIA 1CQGA 2OJLA 4TXOA 3V1WA 5DAKB 3BBYA 4PURA 1OC8A 2WZ9A 1KNGA 4KSOA 4MJAA 4MF7A 3IAM2 1ZMAA 1YZXA 3D6IA 1K0OA 4KDYA 3ZRDA 4JE1A 6GSUA 5B8AA 4FYCA 2HRFA 1ZYEA 1U3IA 2MYGA 3RAZA 4EO3A 4ECIA 4GQCA 1MDJA 3CRUA 1THOA 4BA7A 2NBSA 4TR1A 4G19A 2VL9A 2GDRA 1PKZA 2H66A 3FY7A 3M1GA 1S3CA 4KA0A 1GUHA 3GHAA 2AUVA 3VI7A 1ZZYA 3KCMA 3M9KA 3EINA 1GTIA 2VCXA 4IQ1A 4HZ4A 3IV4A 4MA9A 2CX3A 1YDKA 2I4AA 5J9CA 4CDOA 4GQFA 4K7IA 5IMCA 4ZL7A 4PUFC 2GZZA 4K7OA 4O5RA 1WP0A 1OC9A 4DEJA 1GSQA 1X5EA 4IKHA 2G0FA 4JZQA 5EPFA 1YEXA 3TJFA 1SKSB 3TRQA 4O92A 6GSTA 4OO4A 1SU9A 5CRDA 1M2DA 3F3QA 1VF2A 4TRXA 2VCQA 4EC0A 5CRHA 4EKZA 4ZB9A 4LMVA 2E2GA 3C8EA 1QQ2A 2BTOT 5ABRA 3FK8A 4AJ6A 3FZ9A 20GSA 3RHCA 1G7OA 5GAPD 3LSZA 4KSMA 1SJ6A 1ZGNA 1M9AA 4RI6A 1JZDA 4OFTA 3A3TA 5COHA 3SBCA 3CTFA 4KDXA 4OWYA 4PQIA 5KN3A 1I5GA 5J9BA 3HYPA 4K9ZA 3VK9A 4HU9A 1A8LA 4HU7A 2H30A 1GSSA 1WOUA 2K18A 2KOKA 4XCSA 1TOFA 1O8XA 4N0VA 3ZLPA 2C0FA 2HT9A 3NIVA 1HQOA 2PUKC 3KP8A 3EU4A 5ECLB 1G7EA 2H70A 1A0FA 3UARA 4BWQA 2Z9SA 4N0ZA 3EYTA 1R5PA 3EWLA 4TN8A 3DVWA 1GUKA 3TJBA 3IK9A 2FA8A 5J41A 4NWYA 5A4VA 3PGTA 4DSRA 2M80A 2ZUPA 1O85A 3QR6A 4YQVA 2L4CA 5FT3A 5HR2A 1G6WA 4MCUA 2ZCTA 2CVDA 1VRSD 3RBTA 2CZ2A 4O7HA 2P0GA 1ERUA 1OAZA 4I8BA 3DGQA 4L0WA 1XW6A 2LJAA 4Q5QA 1MD4A 4TOPA 3VPTA 2M46A 2YCDA 5G1LA 3JCML 3ZVJD 3GNJA 4ACSA 2V2GA 1M99A 5IOWA 2MZCA
chains in the Genus database with same CATH superfamily
5AISA 2H0GA 5AGYA 1V57A 4DSQA 1XOAA 3WT1A 2HZEA 4ZIJA 5ELAA 3TGZA 3J7Yk 3GH9A 5DALA 5KN2A 2V1MA 2YN1A 2ZNMA 3O76A 4YAPA 3N5OA 1TI1A 4WF5A 5G30A 6GSVA 3ZMKA 2DIYA 3G7YA 2QGVA 2I9HA 3HZ4A 1AW9A 1PX7A 4ECJA 4NHWA 2H72A 2LSTA 4G0KA 2TRCP 1BX9A 5EVOA 2N5BA 4TXVA 1Z6NA 1GTUA 3GUSA 1LU4A 3GL5A 3HY2A 4MF6A 3J7Yb 2R2JA 4K2XA 4MZBA 3M3MA 3GMFA 6GSXA 1OYJA 2F9SA 1XBSA 1VF4A 4MPGA 1PL1A 4FYUA 2JADA 2FWGA 1QGVA 3L0HA 2AV4A 5ELGA 1J0FA 1DUGA 5CAXA 2CAIA 4MMMA 4K1FA 4TVEA 1SKWB 2B5XA 2FWEA 5ECHB 2BMXA 2OA7A 2DMMA 2IFQA 3LG6A 2NDOA 2B7KA 2GT6A 4NV5A 1PX6A 2WULA 1Y6EA 5ECSA 1EOGA 1F3AA 3GRXA 5E4WA 4O5UA 3M8NA 2GSQA 4PGTA 1YJ6A 3APSA 4EL1A 4Q5FA 3HCZA 2IMFA 4PX1A 3D22A 2OACA 3I69A 3E0UA 5D96A 1X9SB 3O6TA 1B9XC 3C71A 1WPIA 1WRYA 2KHPA 1MDKA 5ECQB 3F6DA 5CP1A 2E7PA 2H6YA 1ZCPA 4MH3A 5ECMB 2HXKA 3QMXA 2MMOA 1IYHA 1W89A 2EIQA 3OR5A 3DWVA 3QPMA 4XIHA 2VO4A 2KP2A 2YZHA 1ERTA 4XHMA 4MK3A 3P7XA 2QSIA 2REMA 3F8UA 4X1UA 2IIYA 4F0BA 3QDNA 1K0AA 2VOCA 1E6BA 2QC7A 1GP1A 4XTSA 2M72A 4I2UA 5GSSA 2H76A 1V58A 2IPAA 3ZREA 2DLXA 3LXZA 2VUPA 2DKHA 1QMVA 1RK4A 1EGRA 5ID2B 1EGOA 4OD7A 4G0LA 4V2MA 2VCTA 3TKSC 2YP6A 1K0MA 2K9FA 1V9WA 4F03A 1QFNA 2X4AA 2J23A 5LNKe 5KEJA 2I1UA 4TR4A 5LD0A 1QK8A 2PWJA 1O73A 3TB2A 4IJ3A 5JCUA 3TOUA 3W8SA 3KXOA 2H19A 1EEJA 2OE0A 5IOXA 1OC3A 2V41A 1A2LA 2VLUA 4GTUA 4IP1A 5HQPA 3H79A 2FLSA 4JU5A 1FOVA 4WR4A 2LKUA 3LJRA 3IHQA 1M2AA 3KIJA 5FHIA 3WT2A 3F6FA 1HD2A 3KP9A 2ALBA 1UVZA 2NVLA 3KTBA 4CY6A 4GSNA 1FHEA 3VI5A 3EMPA 4A5PA 3KMOA 18GSA 3GSTA 3DD3A 4JR6A 1PQNA 3QAGA 5HFGA 2YANA 5KN1A 4J2FA 3QOUA 2MMAA 1K3LA 4TR1B 5G1KA 2LUSA 3TKPA 3DKSA 3IBHA 2PVOC 4GF0A 3LQ7A 4OO5A 1PGTA 3HKRA 4ICYA 1S3RA 5EY6A 2HFDA 3A2VA 2DJ1A 2F51A 2L5OA 2YWMA 2P5RA 1XW5A 4GSTA 1XVWA 3IE3A 4TR3A 2IMIA 3L4NA 1M3JA 4L5OA 1XG8A 2VCZA 1K0NA 2NTOA 2A4VA 3ZMLA 5F8BA 2GSTA 3U6VA 3W6GA 3IAS2 3P90A 4MP4A 5INYA 3KM6A 1GLQA 1WWJA 3WGEA 5IO2A 4EF0A 1Z5YE 4V2LA 3TDGA 16GSA 4IVFA 1A23A 1GL8A 2I3YA 3RDWA 1U3AA 5D9TA 3HJOA 4ZB8A 5JCWA 4HJMA 4E8HA 4NPBA 2H75A 1LBKA 2HYXA 1V2AA 3TJKA 3VURA 6GSSA 3QFAC 1TTZA 4BPYA 3KH9A 5F05A 1KTEA 4NMUA 9GSSA 2B5EA 1WMJA 5HR1A 5F06A 1M0UA 3IK7A 2NPBA 3UOMA 4XS1A 4KCEA 2P31A 4KDUA 5F07A 4K2DA 2EC4A 2WDUA 2R0GA 1TDIA 1SD8A 3R3EA 3HJPA 1MD3A 2CVBA 3FR3A 4K7NA 3CQFA 3KZQA 2N5AA 2GZPA 2C0DA 2JZSA 1NHYA 1V40A 1LJRA 5IQYA 4DVCA 2VM2A 3DYRA 5KOWA 2CX4A 3FZAA 3DVXA 2FD3A 1Z6MA 1GNEA 3FR9A 4MJEA 4TW5A 2C3TA 4PQ1A 1XOBA 5JWOB 4IJIA 1UN2A 2X8CA 1BQ7A 5E59A 1ZYPA 1WJKA 3ERFA 2K6VA 2HLSA 1YKCA 3ERWA 1FB0A 2C80A 2PPTA 3TRPA 4KW6A 5L71A 2VLTA 5KN0A 3EU3A 1ERWA 2E2MA 5ECRB 1ZYQB 2H0HA 2R5GA 2C0GA 2H73A 3H93A 5D9XA 2LV3A 4HI7A 4KNDA 1XWAA 3UBKA 1ERVA 1ILOA 1C72A 3GKMA 1XWKA 4F9ZA 3GKXA 2IMDA 2JSYA 3TRXA 4AJ8A 1THXA 2H71A 4ZL9A 4BVXA 3TOTA 4HEA2 5ECKB 2FNOA 1Q98A 5AIXA 2DJKA 2RUFA 4OFMA 3VFIA 2B6MA 1MTCA 2HRAA 5CO3A 2PGTA 2VL2A 3PH9A 3VWWA 1OE8A 2GQLA 1FVJA 5ECIB 2F3MA 2A2RA 1RQMA 4D73B 1OKTA 2PBJA 2VD0A 2MMNA 1XW9A 1EV9A 3IA1A 4QL7A 3FHKA 3KEBA 3MIXA 5CRGA 4IBPA 2E0QA 3WYWA 2JZTA 1YKAA 2YV7A 10GSA 2YJHA 3LXTA 1B8XA 3KGKA 14GSA 5DVBA 3L9VA 4XS4B 4IELA 2ON7A 1USBA 2JL4A 1NW2A 2KP1A 2V32A 4L0UA 1H4OA 4OMVA 4I5QA 4KB3A 1TP9A 1YF1A 1NSWA 2DJ2A 3QAVA 1TI3A 1XXUA 2RM6A 3QAWA 2AYTA 1Z9HA 1SJIA 3BD2A 2VL3A 2JACA 3UIWA 4EXJA 2J9HA 2DJJA 4XS6A 2XPDA 3CRTA 2F8FA 1G6YA 4CY8A 4K5SA 1B9YC 4HQZA 2IFQB 3L9SA 1DSBA 1H75A 2H6XA 3F4SA 2QA1A 5ECOB 2H1AA 4L8EA 3C1SA 5JWRB 1PSQA 4YQUA 4BL7B 1K0DA 1JFUA 4LA1A 4WEYA 5EL8A 2FGXA 3PINA 2LEGA 3UJ1A 2KUCA 4OCEA 3VWVA 4I2TA 1SD9A 5IM9A 3SWLA 1A8YA 1G0TA 4GSSA 1GH2A 2N5FA 2GLRA 1EOHA 3WD6A 3ME8A 3VLNA 1K0CA 2HZFA 2B1LA 1TRSA 2RIIA 3VWUA 5DJLA 2IJYA 1ON4A 2O7KA 2WJUA 3FW2A 3D4MA 2RM5A 3TJJA 4QL9A 2PVQA 4K5RA 2VLVA 5H5RA 1U6TA 4GCIA 2GSSA 4MH2A 1AIUA 3MYDA 2UZ8A 3HD5A 4Z2RA 2LRCA 1F2EA 3EE2A 2AB6A 5IMAA 4MNNA 2XC2A 4P3YB 2HE3A 3CYNA 4N10A 1AQVA 3IRAA 1Z7RA 2C3NA 2B7JA 5KOXA 3G7JA 4RQXA 1ACVA 1PD21 2GZYA 1B48A 1TRWA 2AHEA 1WIKA 3GL3A 2H1GA 4HQSA 1VF1A 5B8BA 1RW1A 2EIRA 5IIZA 1HYUA 4PNGA 2X8HA 4PQHA 5ECNB 5AN1A 1TK5B 3IDVA 2H74A 4MLYA 1AC1A 1BEDA 2YPMA 3GX8A 3LEFA 2FUG2 4MJBA 3ZVJA 3G7IA 2H1DA 3IC4A 2B1KA 4MJCA 4IP6A 2GVPA 3HZ8A 5H5QA 1X9WB 4OCFA 3LWAA 3U5RE 2OE3A 5ENUA 2WB9A 1GSYA 2OBIA 4WETA 3RHBA 5AIVA 3ZIJA 3E3EA 3CXGA 4LL4B 2CAQA 4HS1A 4HUAA 4G9HA 3HXSA 3ZIVA 2B3SA 3HJMA 1T00A 1GSDA 1KBNA 4WBJA 4MDCA 2JSZA 1JLVA 5A4UA 1YY7A 4EIPA 1TRVA 4NHZA 4YQMA 4OFNA 5GZZB 2O87A 1T1VA 1QUWA 3BOAA 1XWBA 4J56E 4ZL8A 2CT6A 3GIXA 1WE0A 4Z7XA 3KD0A 1SL0B 1PN0A 1XCCA 3F63A 3ZTLA 5DJMA 4KH7A 2VD1A 2H01A 2PMTA 4TXOB 2VCVA 1PA3A 1O6JA 2PN8A 3MSZA 4NAXA 2R0PA 4PNFA 3EPTA 1W4VA 3GH6A 5J3RA 2B5YA 1PKWA 4QQ7A 4IN0A 3IXRA 3PR8A 3GKKA 4K6XA 2HSYA 1TKDB 2IMKA 1GLPA 5B6MA 2F8AA 3TKQA 1HNCA 5IMZA 1URMA 1EP8A 4IS0A 2WCIA 2GQKA 3APQA 2CVKA 1FG4A 2FWHA 1GUMA 4ZBBA 2YJ7A 5ID2A 4RI7A 4V1Ap 1SYRA 4USSA 3AY8A 3ME7A 3GV1A 1JLWA 2OBKA 2FY6A 2AJQB 1OKDA 1M2BA 3KMNA 1R7HA 4GWRA 3WGDA 1DE2A 2VAFA 4KE3A 1XFLA 3ISOA 1B4QA 1UC7A 2DBCA 3NOFA 1O7UA 3IC8A 1PRXA 4L5LA 1SL1B 3ZL5A 4E8EA 2L4QA 3FRCA 5J5NA 3GFKA 1K3YA 3MAKA 3TKSE 1XWGA 3R2QA 3HDCA 19GSA 2LNSA 1R5AA 2IN3A 4DSSA 4KUNA 3CSIA 5HFKA 12GSA 3UVHA 3UL3A 4HOJA 1GTBA 4AGSA 4H86A 4FO5A 4MPFA 5DQYA 1TK0B 1SKRB 1U87A 3QFBC 1SK1A 3UMAA 1OC9B 5CNWA 3EMXA 3KH7A 1UA5A 1F9MA 1SYXA 4HZ2A 4O32A 5IPHA 4FH8A 2H8LA 4X43A 2XHFA 2L6CA 4LMWA 2FA4A 3F3RA 3LYPA 3KJYA 3KTLA 11GSA 2XBIA 4V2NA 2ON5A 3LORA 3QCPA 3LW9A 1T3BA 13GSA 3BCKA 2MBSA 4ZXGA 2FWFA 2OE1A 5CREA 1XVQA 1BJXA 2HRKA 3LFLA 3GTUA 1DE1A 1YQ1A 2R4VA 2P5QA 2DKIA 5DAKA 1PMTA 2D2ZA 3GKNA 3ZYWA 3G9BA 3DMLA 2YZUA 3H8QA 4Q5RA 3GX0A 2CZ3A 1U88A 4NV2A 4CHSA 3HVSA 5DCGA 4EDYA 1HNBA 4JEDA 8GSSA 4AJ7A 3VWXA 1XWCA 2A2PA 2LQOA 1EV4A 2L59A 2DJ3A 1FW1A 2DJ0A 22GSA 3GURA 4LL1B 1JHBA 5C00A 4X4JA 1S3DA 5IMFA 4WBRD 3A2XA 1F37A 3S9FA 1PN9A 2LS5A 3FR6A 4ISDA 1AQWA 2L6DA 2OKAA 1B4PA 1FB6A 5CYYA 2QKEA 3H1NA 3DRNA 2CQ9A 1EP7A 3UBLA 3I9V2 2LJKA 3F9UA 2FHEA 2GS3A 1VGLA 3TKRA 4POLA 3MWHA 4TR0A 1CQHA 2DMLA 2HNLA 1A2MA 1FVKA 1K3OA 1GRXA 2WRTA 3UVTA 3HVNA 4RUVA 5B7CA 3ZZXA 4ULXA 2C0EA 2L5LA 4PXOA 1ZL9A 4FQUA 3PPUA 5H5SA 1V98A 3D0ZA 3MNGA 5JWQB 4POMA 3TUEA 3ZITA 2GGTA 4YH2A 2XPEA 1VF3A 1KEBA 4GRFA 4PTSA 2VIMA 5FWGA 2X8GA 3EVIA 2R6KA 4F0CA 4MZCA 1YEPA 3FKFA 3RPPA 3L9UA 1N2AA 1EZKA 3FMWA 4MF5A 1GNWA 3QD9A 2TRXA 4J57E 5DQSA 3TKSA 4ML1A 5IMDA 1ST9A 2HZEB 4EUYA 1TW9A 1X9MB 4BVYA 2H6ZA 1M7TA 5DALB 4BWSA 4EVMA 1E2YA 1A2JA 4K8MA 1A24A 3TCOA 3GSSA 1SL2B 4FYBA 1TXXA 1MDIA 2GQMA 2A2SA 1AUCA 4XRAA 2K8VA 4MABA 2C1YA 3FYGA 5LCZA 3I6AA 1T8EB 1Y25A 3CMIA 1R26A 1BG5A 2YWOA 4PUAA 5GSTA 4IW9A 2WGRA 2GT5A 3N9JA 1NHOA 4WXTA 3TJGA 3CSHA 2MMZA 5GAND 1FO5A 3MDKA 2GTUA 2RUEA 2C3QA 3ERGA 5A4WA 2R37A 4K0GA 5G5EA 5CRWA 3M0FA 3HVVA 5DCHA 1X5DA 3EC3A 3Q18A 3RPNA 4D73A 1ZOFA 3WGXA 4Z2TA 3CBUA 2O85A 5G31A 4YKGA 4F82A 1A0RP 5HR0A 4TKYA 2O89A 3Q6OA 1T4ZA 4EE0A 1JZOA 5C04A 2HI7A 4IGJA 4G0IA 5IPGA 2C8UA 4POKA 1N8JA 3ED3A 4WR5A 1X0RA 2GSRA 2FCHA 2YWNA 3A5IA 4G2EA 3US3A 2DC5A 1K0BA 1EEMA 1JZRA 2RLIA 4XS4A 2YOIA 2TIRA 2H0IA 4AF2A 3UEMA 3FZ4A 3Q19A 4WKWA 4WF4A 1TJDA 1Z3EA 3ZFBA 4KCAA 1GULA 2LQQA 4HJ2A 3O3TA 4ID0A 5G5FA 4HDEA 2WS2A 2K8SA 3LGCA 3IOSA 1XPVA 1R4WA 1X5CA 4Q5NA 5G2ZA 4ILFA 1J9BA 2X49A 3K8NA 4KAEA 3C73A 3P2AA 1EWXA 3VPQA 2R3XA 1PFOA 2VCWA 2O8VB 1TU7A 3Q74A 2IWTA 2OADA 2X64A 1OE7A 5HR3A 1GTAA 4POBA 4GLTA 1O81A 2BJXA 3BCIA 4RQRA 1OVNA 3EURA 2KLXA 2V6OA 4X0XA 5IMVA 3GA4A 4BL7A 3IPZA 2IMEA 2HSMA 1GSEA 3A2WA 2V6KA 6GSYA 4EDZA 1NM3A 5IO0A 5A5KA 1ZYNA 1BAYA 3W8JA 2HRNA 2DSAA 1T4YA 2H1BA 3F4RA 4G10A 1GSUA 17GSA 4KX4A 1Z7PA 3F4TA 4ML6A 3HA9A 4JBBA 3L78A 3NZNA 4ZILA 3CSJA 3ZFLA 3DEXA 5JCGA 1YF0A 3APOA 2YWIA 1JZWA 2JU5A 2LNTA 4IQAA 4JRRA 5D9WA 5ECPB 3C7MA 2PERA 5B6NA 3HHVA 1T7PB 4ZBDA 2YNXA 4KF9A 4EIQA 5DBQA 6GSWA 3D4TA 2LRNA 4ZBAA 2ES7A 2VM1A 4K0NA 1BYEA 4CW9A 2G2QA 2XBQA 5D9VA 7GSSA 4MZWA 2LRTA 2L57A 2AAWA 3HVXA 1SJZA 4GXZA 2VL2C 2CV4A 5BMUA 3CTGA 3FEUA 5DDLA 1J08A 3DXBA 1ML6A 2WFCA 1IYIA 1FAAA 4NXIA 4I97A 5D93A 4ZB6A 4ECCA 1XIYA 3F0IA 1O8WA 1GWCA 1DBYA 1TU8A 2I81A 3D21A 1AAZA 1SK0A 2DIZA 3GN3A 1I9DA 4HSCX 1Q4JA 1SENA 2C4JA 2PU9C 2IL3A 2X99A 1TK8B 5D8IA 4N11A 5HFIA 4I6XA 4DSSB 1QXHA 3C1RA 3BJ5A 2YV9A 1XZOA 2JZRA 4FIWA 1F6MC 3H4KA 3A5WA 3I43A 5J4UA 2MBTA 2LTKA 1GSFA 2EIOA 3UAPA 1HNAA 1M9BA 3DIEA 4ECBA 1AXDA 3GYKA 4JR4A 2CA8A 4N30A 4XRDA 2LJRA 2QA2A 1TRUA 4YAVA 3P8WA 3IR4A 1ABAA 1PL2A 2HSHA 4F2IA 3FZ5A 1S3AA 4V1Ag 3E9JB 3M9JA 1F3BA 5D73A 4LLRA 4IHUA 3GTUB 3LYKA 1SK2A 5F0GA 3D5JA 1AQXA 1MEKA 4KGIA 1CQGA 2OJLA 4TXOA 3V1WA 5DAKB 3BBYA 4PURA 1OC8A 2WZ9A 1KNGA 4KSOA 4MJAA 4MF7A 3IAM2 1ZMAA 1YZXA 3D6IA 1K0OA 4KDYA 3ZRDA 4JE1A 6GSUA 5B8AA 4FYCA 2HRFA 1ZYEA 1U3IA 2MYGA 3RAZA 4EO3A 4ECIA 3IHGA 4GQCA 1MDJA 3CRUA 1THOA 2R0CA 4BA7A 2NBSA 4TR1A 4G19A 2VL9A 1FOHA 2GDRA 1PKZA 2H66A 3FY7A 3M1GA 1S3CA 4KA0A 1GUHA 3GHAA 2AUVA 3VI7A 1ZZYA 3KCMA 3M9KA 3EINA 1GTIA 2VCXA 4IQ1A 4HZ4A 3IV4A 4MA9A 2CX3A 1YDKA 2I4AA 5J9CA 4CDOA 5BRTA 4GQFA 4K7IA 5IMCA 4ZL7A 4PUFC 2GZZA 4K7OA 4O5RA 1WP0A 1OC9A 4DEJA 1GSQA 4BVXB 1X5EA 4IKHA 2G0FA 4JZQA 5EPFA 1YEXA 3TJFA 1SKSB 3TRQA 4O92A 6GSTA 4OO4A 1SU9A 5CRDA 1M2DA 3F3QA 1VF2A 4TRXA 2VCQA 4EC0A 5CRHA 4EKZA 4ZB9A 4BVYB 4LMVA 2E2GA 3C8EA 1QQ2A 2BTOT 5ABRA 3FK8A 4AJ6A 3FZ9A 20GSA 3RHCA 1G7OA 5GAPD 3LSZA 4KSMA 1SJ6A 1ZGNA 1M9AA 4RI6A 1JZDA 4OFTA 3A3TA 5COHA 3SBCA 3CTFA 4KDXA 4OWYA 4PQIA 5KN3A 1I5GA 5J9BA 4BIKA 3HYPA 4K9ZA 3VK9A 4HU9A 1A8LA 1M3IA 4HU7A 2H30A 1GSSA 1WOUA 2K18A 2KOKA 4XCSA 1TOFA 1O8XA 4N0VA 3ZLPA 2C0FA 2HT9A 3NIVA 1HQOA 2PUKC 3KP8A 3EU4A 4YKFA 5ECLB 1G7EA 2H70A 1A0FA 3UARA 4BWQA 2Z9SA 4N0ZA 3EYTA 1R5PA 3EWLA 4TN8A 3DVWA 1GUKA 3TJBA 4Z2UA 3IK9A 2FA8A 5J41A 4NWYA 5A4VA 3PGTA 4DSRA 2A4HA 2M80A 2ZUPA 1O85A 3QR6A 4YQVA 2L4CA 5FT3A 5HR2A 1G6WA 4MCUA 2ZCTA 2CVDA 1VRSD 3RBTA 2CZ2A 4O7HA 2P0GA 1ERUA 1OAZA 4I8BA 3DGQA 4L0WA 1XW6A 2LJAA 4Q5QA 1MD4A 4TOPA 3VPTA 2M46A 2YCDA 5G1LA 3JCML 3ZVJD 3GNJA 4O5QA 4ACSA 2V2GA 1M99A 5IOWA 2MZCA
chains in the Genus database with same CATH topology
5AISA 2H0GA 5AGYA 1V57A 4DSQA 1XOAA 3WT1A 2HZEA 4ZIJA 5ELAA 3TGZA 3J7Yk 3GH9A 5DALA 5KN2A 2V1MA 2YN1A 2ZNMA 3O76A 4YAPA 3N5OA 1TI1A 4WF5A 5G30A 6GSVA 3ZMKA 2DIYA 3G7YA 2QGVA 2I9HA 3HZ4A 1AW9A 1PX7A 4ECJA 4NHWA 2H72A 2LSTA 4G0KA 2TRCP 1BX9A 5EVOA 2N5BA 4TXVA 1Z6NA 1GTUA 3GUSA 1LU4A 3GL5A 3HY2A 4MF6A 3J7Yb 2R2JA 4K2XA 4MZBA 3M3MA 3GMFA 6GSXA 1OYJA 2F9SA 1XBSA 1VF4A 4MPGA 1PL1A 4FYUA 2JADA 2FWGA 1QGVA 3L0HA 2AV4A 5ELGA 1J0FA 1DUGA 5CAXA 2CAIA 4MMMA 4K1FA 4TVEA 1SKWB 2B5XA 2FWEA 5ECHB 2BMXA 2OA7A 2DMMA 2IFQA 3LG6A 2NDOA 2B7KA 2GT6A 4NV5A 1PX6A 2WULA 1Y6EA 5ECSA 1EOGA 1F3AA 3GRXA 5E4WA 4O5UA 3M8NA 2GSQA 4PGTA 1YJ6A 3APSA 4EL1A 4Q5FA 3HCZA 2IMFA 4PX1A 3D22A 2OACA 3I69A 3E0UA 5D96A 1X9SB 3O6TA 1B9XC 3C71A 1WPIA 1WRYA 2KHPA 1MDKA 5ECQB 3F6DA 5CP1A 2E7PA 2H6YA 1ZCPA 4MH3A 5ECMB 2HXKA 3QMXA 2MMOA 1IYHA 1W89A 2EIQA 3OR5A 3DWVA 3QPMA 4XIHA 2VO4A 2KP2A 2YZHA 1ERTA 4XHMA 4MK3A 3P7XA 2QSIA 2REMA 3F8UA 4X1UA 2IIYA 4F0BA 3QDNA 1K0AA 2VOCA 1E6BA 2QC7A 1GP1A 4XTSA 2M72A 4I2UA 5GSSA 2H76A 1V58A 2IPAA 3ZREA 2DLXA 3LXZA 2VUPA 2DKHA 1QMVA 1RK4A 1EGRA 5ID2B 1EGOA 4OD7A 4G0LA 4V2MA 2VCTA 3TKSC 2YP6A 1K0MA 2K9FA 1V9WA 4F03A 1QFNA 2X4AA 2J23A 5LNKe 5KEJA 2I1UA 4TR4A 5LD0A 1QK8A 2PWJA 1O73A 3TB2A 4IJ3A 5JCUA 3TOUA 3W8SA 3KXOA 2H19A 1EEJA 2OE0A 5IOXA 1OC3A 2V41A 1A2LA 2VLUA 4GTUA 4IP1A 5HQPA 3H79A 2FLSA 4JU5A 1FOVA 4WR4A 2LKUA 3LJRA 3IHQA 1M2AA 3KIJA 5FHIA 3WT2A 3F6FA 1HD2A 3KP9A 2ALBA 1UVZA 2NVLA 3KTBA 4CY6A 4GSNA 1FHEA 3VI5A 3EMPA 4A5PA 3KMOA 18GSA 3GSTA 3DD3A 4JR6A 1PQNA 3QAGA 5HFGA 2YANA 5KN1A 4J2FA 3QOUA 2MMAA 1K3LA 4TR1B 5G1KA 2LUSA 3TKPA 3DKSA 3IBHA 2PVOC 4GF0A 3LQ7A 4OO5A 1PGTA 3HKRA 4ICYA 5EY6A 2HFDA 3A2VA 2DJ1A 2F51A 2L5OA 2YWMA 2P5RA 1XW5A 4GSTA 1XVWA 3IE3A 4TR3A 2IMIA 3L4NA 4L5OA 2VCZA 1K0NA 2NTOA 2A4VA 3ZMLA 5F8BA 2GSTA 3U6VA 3W6GA 3IAS2 3P90A 4MP4A 5INYA 3KM6A 1GLQA 1WWJA 3WGEA 5IO2A 4EF0A 1Z5YE 4V2LA 3TDGA 16GSA 4IVFA 1A23A 1GL8A 2I3YA 3RDWA 1U3AA 5D9TA 3HJOA 4ZB8A 5JCWA 4HJMA 4E8HA 4NPBA 2H75A 1LBKA 2HYXA 1V2AA 3TJKA 3VURA 6GSSA 3QFAC 1TTZA 4BPYA 3KH9A 5F05A 1KTEA 4NMUA 9GSSA 2B5EA 1WMJA 5HR1A 5F06A 1M0UA 3IK7A 2NPBA 3UOMA 4XS1A 4KCEA 2P31A 4KDUA 5F07A 4K2DA 2EC4A 2WDUA 2R0GA 1TDIA 1SD8A 3R3EA 3HJPA 1MD3A 2CVBA 3FR3A 4K7NA 3KZQA 2N5AA 2GZPA 2C0DA 2JZSA 1NHYA 1V40A 1LJRA 5IQYA 4DVCA 2VM2A 3DYRA 5KOWA 2CX4A 3FZAA 3DVXA 2FD3A 1Z6MA 1GNEA 3FR9A 4MJEA 4TW5A 2C3TA 4PQ1A 1XOBA 5JWOB 4IJIA 1UN2A 2X8CA 1BQ7A 5E59A 1ZYPA 1WJKA 3ERFA 2K6VA 2HLSA 1YKCA 3ERWA 1FB0A 2C80A 2PPTA 3TRPA 4KW6A 5L71A 2VLTA 5KN0A 3EU3A 1ERWA 2E2MA 5ECRB 1ZYQB 2H0HA 2R5GA 2C0GA 2H73A 3H93A 5D9XA 2LV3A 4HI7A 4KNDA 1XWAA 3UBKA 1ERVA 1ILOA 1C72A 3GKMA 1XWKA 4F9ZA 3GKXA 2IMDA 2JSYA 3TRXA 4AJ8A 1THXA 2H71A 4ZL9A 4BVXA 3TOTA 4HEA2 5ECKB 2FNOA 1Q98A 5AIXA 2DJKA 2RUFA 4OFMA 3VFIA 2B6MA 1MTCA 2HRAA 5CO3A 2PGTA 2VL2A 3PH9A 3VWWA 1OE8A 2GQLA 1FVJA 5ECIB 2F3MA 2A2RA 1RQMA 4D73B 1OKTA 2PBJA 2VD0A 2MMNA 1XW9A 1EV9A 3IA1A 4QL7A 3FHKA 3KEBA 3MIXA 5CRGA 4IBPA 2E0QA 3WYWA 2JZTA 1YKAA 2YV7A 10GSA 2YJHA 3LXTA 1B8XA 3KGKA 14GSA 5DVBA 3L9VA 4XS4B 4IELA 2ON7A 1USBA 2JL4A 1NW2A 2KP1A 2V32A 4L0UA 1H4OA 4OMVA 4I5QA 4KB3A 1TP9A 1YF1A 1NSWA 2DJ2A 3QAVA 1TI3A 1XXUA 2RM6A 3QAWA 2AYTA 1Z9HA 1SJIA 3BD2A 2VL3A 2JACA 3UIWA 4EXJA 2J9HA 2DJJA 4XS6A 2XPDA 3CRTA 2F8FA 1G6YA 4CY8A 4K5SA 1B9YC 4HQZA 2IFQB 3L9SA 1DSBA 1H75A 2H6XA 3F4SA 2QA1A 5ECOB 2H1AA 4L8EA 3C1SA 5JWRB 1PSQA 4YQUA 4BL7B 1K0DA 1JFUA 4LA1A 4WEYA 5EL8A 2FGXA 3PINA 2LEGA 3UJ1A 2KUCA 4OCEA 3VWVA 4I2TA 1SD9A 5IM9A 3SWLA 1A8YA 1G0TA 4GSSA 1GH2A 2N5FA 2GLRA 1EOHA 3WD6A 3ME8A 3VLNA 1K0CA 2HZFA 2B1LA 1TRSA 2RIIA 3VWUA 5DJLA 2IJYA 1ON4A 2O7KA 2WJUA 3FW2A 3D4MA 2RM5A 3TJJA 4QL9A 2PVQA 4K5RA 2VLVA 5H5RA 1U6TA 4GCIA 2GSSA 4MH2A 1AIUA 3MYDA 2UZ8A 3HD5A 4Z2RA 2LRCA 1F2EA 3EE2A 2AB6A 5IMAA 4MNNA 2XC2A 4P3YB 2HE3A 3CYNA 4N10A 1AQVA 3IRAA 1Z7RA 2C3NA 2B7JA 5KOXA 3G7JA 4RQXA 1ACVA 1PD21 2GZYA 1B48A 1TRWA 2AHEA 1WIKA 3GL3A 2H1GA 4HQSA 1VF1A 5B8BA 1RW1A 2EIRA 5IIZA 1HYUA 4PNGA 2X8HA 4PQHA 5ECNB 5AN1A 1TK5B 3IDVA 2H74A 4MLYA 1AC1A 1BEDA 2YPMA 3GX8A 3LEFA 2FUG2 4MJBA 3ZVJA 3G7IA 2H1DA 3IC4A 2B1KA 4MJCA 4IP6A 2GVPA 3HZ8A 5H5QA 1X9WB 4OCFA 3LWAA 3U5RE 2OE3A 5ENUA 2WB9A 1GSYA 2OBIA 4WETA 3RHBA 5AIVA 3ZIJA 3E3EA 3CXGA 4LL4B 2CAQA 4HS1A 4HUAA 4G9HA 3HXSA 3ZIVA 2B3SA 3HJMA 1T00A 1GSDA 1KBNA 4WBJA 4MDCA 2JSZA 1JLVA 5A4UA 1YY7A 4EIPA 1TRVA 4NHZA 4YQMA 4OFNA 5GZZB 2O87A 1T1VA 1QUWA 3BOAA 1XWBA 4J56E 4ZL8A 2CT6A 3GIXA 1WE0A 4Z7XA 3KD0A 1SL0B 1PN0A 1XCCA 3F63A 3ZTLA 5DJMA 4KH7A 2VD1A 2H01A 2PMTA 4TXOB 2VCVA 1PA3A 1O6JA 2PN8A 3MSZA 4NAXA 2R0PA 4PNFA 3EPTA 1W4VA 3GH6A 5J3RA 2B5YA 1PKWA 4QQ7A 4IN0A 3IXRA 3PR8A 3GKKA 4K6XA 2HSYA 1TKDB 2IMKA 1GLPA 5B6MA 2F8AA 3TKQA 1HNCA 5IMZA 1URMA 1EP8A 4IS0A 2WCIA 2GQKA 3APQA 2CVKA 1FG4A 2FWHA 1GUMA 4ZBBA 2YJ7A 5ID2A 4RI7A 4V1Ap 1SYRA 4USSA 3AY8A 3ME7A 3GV1A 1JLWA 2OBKA 2FY6A 2AJQB 1OKDA 1M2BA 3KMNA 1R7HA 4GWRA 3WGDA 1DE2A 2VAFA 4KE3A 1XFLA 3ISOA 1B4QA 1UC7A 2DBCA 3NOFA 1O7UA 3IC8A 1PRXA 4L5LA 1SL1B 3ZL5A 4E8EA 2L4QA 3FRCA 5J5NA 3GFKA 1K3YA 3MAKA 3TKSE 1XWGA 3R2QA 3HDCA 19GSA 2LNSA 1R5AA 2IN3A 4DSSA 4KUNA 3CSIA 5HFKA 12GSA 3UVHA 3UL3A 4HOJA 1GTBA 4AGSA 4H86A 4FO5A 4MPFA 5DQYA 1TK0B 1SKRB 1U87A 3QFBC 1SK1A 3UMAA 1OC9B 5CNWA 3EMXA 3KH7A 1UA5A 1F9MA 1SYXA 4HZ2A 4O32A 5IPHA 4FH8A 2H8LA 4X43A 2XHFA 2L6CA 4LMWA 2FA4A 3F3RA 3LYPA 3KJYA 3KTLA 11GSA 2XBIA 4V2NA 2ON5A 3LORA 3QCPA 3LW9A 1T3BA 13GSA 3BCKA 2MBSA 4ZXGA 2FWFA 2OE1A 5CREA 1XVQA 1BJXA 2HRKA 3LFLA 3GTUA 1DE1A 1YQ1A 2R4VA 2P5QA 2DKIA 5DAKA 1PMTA 2D2ZA 3GKNA 3ZYWA 3G9BA 3DMLA 2YZUA 3H8QA 4Q5RA 3GX0A 2CZ3A 1U88A 4NV2A 4CHSA 3HVSA 5DCGA 4EDYA 1HNBA 4JEDA 8GSSA 4AJ7A 3VWXA 1XWCA 2A2PA 2LQOA 1EV4A 2L59A 2DJ3A 1FW1A 2DJ0A 22GSA 3GURA 4LL1B 1JHBA 5C00A 4X4JA 1S3DA 5IMFA 4WBRD 3A2XA 1F37A 3S9FA 1PN9A 2LS5A 3FR6A 4ISDA 1AQWA 2L6DA 2OKAA 1B4PA 1FB6A 5CYYA 2QKEA 3H1NA 3DRNA 2CQ9A 1EP7A 3UBLA 3I9V2 2LJKA 3F9UA 2FHEA 2GS3A 1VGLA 3TKRA 4POLA 3MWHA 4TR0A 1CQHA 2DMLA 2HNLA 1A2MA 1FVKA 1K3OA 1GRXA 2WRTA 3UVTA 4RUVA 5B7CA 3ZZXA 4ULXA 2C0EA 2L5LA 4PXOA 1ZL9A 4FQUA 3PPUA 5H5SA 1V98A 3D0ZA 3MNGA 5JWQB 4POMA 3TUEA 3ZITA 2GGTA 4YH2A 2XPEA 1VF3A 1KEBA 4GRFA 4PTSA 2VIMA 5FWGA 2X8GA 3EVIA 2R6KA 4F0CA 4MZCA 1YEPA 3FKFA 3RPPA 3L9UA 1N2AA 1EZKA 3FMWA 4MF5A 1GNWA 3QD9A 2TRXA 4J57E 5DQSA 3TKSA 4ML1A 5IMDA 1ST9A 2HZEB 4EUYA 1TW9A 1X9MB 4BVYA 2H6ZA 1M7TA 5DALB 4BWSA 4EVMA 1E2YA 1A2JA 4K8MA 1A24A 3TCOA 3GSSA 1SL2B 4FYBA 1TXXA 1MDIA 2GQMA 2A2SA 1AUCA 4XRAA 2K8VA 4MABA 2C1YA 3FYGA 5LCZA 3I6AA 1T8EB 1Y25A 3CMIA 1R26A 1BG5A 2YWOA 4PUAA 5GSTA 4IW9A 2WGRA 2GT5A 3N9JA 1NHOA 4WXTA 3TJGA 3CSHA 2MMZA 5GAND 1FO5A 3MDKA 2GTUA 2RUEA 2C3QA 3ERGA 5A4WA 2R37A 4K0GA 5G5EA 5CRWA 3M0FA 3HVVA 5DCHA 1X5DA 3EC3A 3Q18A 3RPNA 4D73A 1ZOFA 3WGXA 4Z2TA 3CBUA 2O85A 5G31A 4YKGA 4F82A 1A0RP 5HR0A 4TKYA 2O89A 3Q6OA 1T4ZA 4EE0A 1JZOA 5C04A 2HI7A 4IGJA 4G0IA 5IPGA 2C8UA 4POKA 1N8JA 3ED3A 4WR5A 1X0RA 2GSRA 2FCHA 2YWNA 3A5IA 4G2EA 3US3A 2DC5A 1K0BA 1EEMA 1JZRA 2RLIA 4XS4A 2YOIA 2TIRA 2H0IA 4AF2A 3UEMA 3FZ4A 3Q19A 4WKWA 4WF4A 1TJDA 1Z3EA 3ZFBA 4KCAA 1GULA 2LQQA 4HJ2A 3O3TA 4ID0A 5G5FA 4HDEA 2WS2A 2K8SA 3LGCA 3IOSA 1XPVA 1R4WA 1X5CA 4Q5NA 5G2ZA 4ILFA 1J9BA 2X49A 3K8NA 4KAEA 3C73A 3P2AA 1EWXA 3VPQA 2R3XA 2VCWA 2O8VB 1TU7A 3Q74A 2IWTA 2OADA 2X64A 1OE7A 5HR3A 1GTAA 4POBA 4GLTA 1O81A 2BJXA 3BCIA 4RQRA 1OVNA 3EURA 2KLXA 2V6OA 4X0XA 5IMVA 3GA4A 4BL7A 3IPZA 2IMEA 2HSMA 1GSEA 3A2WA 2V6KA 6GSYA 4EDZA 1NM3A 5IO0A 5A5KA 1ZYNA 1BAYA 3W8JA 2HRNA 2DSAA 1T4YA 2H1BA 3F4RA 4G10A 1GSUA 17GSA 4KX4A 1Z7PA 3F4TA 4ML6A 3HA9A 4JBBA 3L78A 3NZNA 4ZILA 3CSJA 3ZFLA 3DEXA 5JCGA 1YF0A 3APOA 2YWIA 1JZWA 2JU5A 2LNTA 4IQAA 4JRRA 5D9WA 5ECPB 3C7MA 2PERA 5B6NA 3HHVA 1T7PB 4ZBDA 2YNXA 4KF9A 4EIQA 5DBQA 6GSWA 3D4TA 2LRNA 4ZBAA 2ES7A 2VM1A 4K0NA 1BYEA 4CW9A 2G2QA 2XBQA 5D9VA 7GSSA 4MZWA 2LRTA 2L57A 2AAWA 3HVXA 1SJZA 4GXZA 2VL2C 2CV4A 5BMUA 3CTGA 3FEUA 5DDLA 1J08A 3DXBA 1ML6A 2WFCA 1IYIA 1FAAA 4NXIA 4I97A 5D93A 4ZB6A 4ECCA 1XIYA 3F0IA 1O8WA 1GWCA 1DBYA 1TU8A 2I81A 3D21A 1AAZA 1SK0A 2DIZA 3GN3A 1I9DA 1Q4JA 1SENA 2C4JA 2PU9C 2IL3A 2X99A 1TK8B 5D8IA 4N11A 5HFIA 4I6XA 4DSSB 1QXHA 3C1RA 3BJ5A 2YV9A 1XZOA 2JZRA 4FIWA 1F6MC 3H4KA 3A5WA 3I43A 5J4UA 2MBTA 2LTKA 1GSFA 2EIOA 3UAPA 1HNAA 1M9BA 3DIEA 4ECBA 1AXDA 3GYKA 4JR4A 2CA8A 4N30A 4XRDA 2LJRA 2QA2A 1TRUA 4YAVA 3P8WA 3IR4A 1ABAA 1PL2A 2HSHA 4F2IA 3FZ5A 1S3AA 4V1Ag 3E9JB 3M9JA 1F3BA 5D73A 4LLRA 4IHUA 3GTUB 3LYKA 1SK2A 5F0GA 3D5JA 1AQXA 1MEKA 4KGIA 1CQGA 2OJLA 4TXOA 3V1WA 5DAKB 3BBYA 4PURA 1OC8A 2WZ9A 1KNGA 4KSOA 4MJAA 4MF7A 3IAM2 1ZMAA 1YZXA 3D6IA 1K0OA 4KDYA 3ZRDA 4JE1A 6GSUA 5B8AA 4FYCA 2HRFA 1ZYEA 1U3IA 2MYGA 3RAZA 4EO3A 4ECIA 3IHGA 4GQCA 1MDJA 3CRUA 1THOA 2R0CA 4BA7A 2NBSA 4TR1A 4G19A 2VL9A 1FOHA 2GDRA 1PKZA 2H66A 3FY7A 3M1GA 1S3CA 4KA0A 1GUHA 3GHAA 2AUVA 3VI7A 1ZZYA 3KCMA 3M9KA 3EINA 1GTIA 2VCXA 4IQ1A 4HZ4A 3IV4A 4MA9A 2CX3A 1YDKA 2I4AA 5J9CA 4CDOA 5BRTA 4GQFA 4K7IA 5IMCA 4ZL7A 4PUFC 2GZZA 4K7OA 4O5RA 1WP0A 1OC9A 4DEJA 1GSQA 4BVXB 1X5EA 4IKHA 2G0FA 4JZQA 5EPFA 1YEXA 3TJFA 1SKSB 3TRQA 4O92A 6GSTA 4OO4A 1SU9A 5CRDA 1M2DA 3F3QA 1VF2A 4TRXA 2VCQA 4EC0A 5CRHA 4EKZA 4ZB9A 4BVYB 4LMVA 2E2GA 3C8EA 1QQ2A 2BTOT 5ABRA 3FK8A 4AJ6A 3FZ9A 20GSA 3RHCA 1G7OA 5GAPD 3LSZA 4KSMA 1SJ6A 1ZGNA 1M9AA 4RI6A 1JZDA 4OFTA 3A3TA 5COHA 3SBCA 3CTFA 4KDXA 4OWYA 4PQIA 5KN3A 1I5GA 5J9BA 3HYPA 4K9ZA 3VK9A 4HU9A 1A8LA 4HU7A 2H30A 1GSSA 1WOUA 2K18A 2KOKA 4XCSA 1TOFA 1O8XA 4N0VA 3ZLPA 2C0FA 2HT9A 3NIVA 1HQOA 2PUKC 3KP8A 3EU4A 4YKFA 5ECLB 1G7EA 2H70A 1A0FA 3UARA 4BWQA 2Z9SA 4N0ZA 3EYTA 1R5PA 3EWLA 4TN8A 3DVWA 1GUKA 3TJBA 4Z2UA 3IK9A 2FA8A 5J41A 4NWYA 5A4VA 3PGTA 4DSRA 2A4HA 2M80A 2ZUPA 1O85A 3QR6A 4YQVA 2L4CA 5FT3A 5HR2A 1G6WA 4MCUA 2ZCTA 2CVDA 1VRSD 3RBTA 2CZ2A 4O7HA 2P0GA 1ERUA 1OAZA 4I8BA 3DGQA 4L0WA 1XW6A 2LJAA 4Q5QA 1MD4A 4TOPA 3VPTA 2M46A 2YCDA 5G1LA 3JCML 3ZVJD 3GNJA 4O5QA 4ACSA 2V2GA 1M99A 5IOWA 2MZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AIS A;  2H0G A;  5AGY A;  1V57 A;  4DSQ A;  1XOA A;  3WT1 A;  2HZE A;  4ZIJ A;  5ELA A;  3TGZ A;  3J7Y k;  3GH9 A;  5DAL A;  5KN2 A;  2V1M A;  2YN1 A;  2ZNM A;  3O76 A;  4YAP A;  3N5O A;  1TI1 A;  4WF5 A;  5G30 A;  6GSV A;  3ZMK A;  2DIY A;  3G7Y A;  2QGV A;  2I9H A;  3HZ4 A;  1AW9 A;  1PX7 A;  4ECJ A;  4NHW A;  2H72 A;  2LST A;  2TRC P;  1BX9 A;  5EVO A;  2N5B A;  4TXV A;  1Z6N A;  1GTU A;  3GUS A;  1LU4 A;  3GL5 A;  3HY2 A;  4MF6 A;  3J7Y b;  2R2J A;  4MZB A;  3M3M A;  3GMF A;  6GSX A;  1OYJ A;  2F9S A;  1XBS A;  1VF4 A;  4MPG A;  1PL1 A;  4FYU A;  2JAD A;  2FWG A;  1QGV A;  3L0H A;  2AV4 A;  5ELG A;  1J0F A;  1DUG A;  5CAX A;  2CAI A;  4MMM A;  4K1F A;  4TVE A;  1SKW B;  2B5X A;  2FWE A;  5ECH B;  2BMX A;  2OA7 A;  2DMM A;  2IFQ A;  3LG6 A;  2NDO A;  2B7K A;  2GT6 A;  4NV5 A;  1PX6 A;  2WUL A;  1Y6E A;  5ECS A;  1EOG A;  1F3A A;  3GRX A;  5E4W A;  3M8N A;  2GSQ A;  4PGT A;  1YJ6 A;  3APS A;  4EL1 A;  4Q5F A;  3HCZ A;  2IMF A;  4PX1 A;  3D22 A;  2OAC A;  3I69 A;  3E0U A;  5D96 A;  1X9S B;  3O6T A;  1B9X C;  3C71 A;  1WPI A;  1WRY A;  2KHP A;  1MDK A;  5ECQ B;  3F6D A;  5CP1 A;  2E7P A;  2H6Y A;  1ZCP A;  4MH3 A;  5ECM B;  2HXK A;  3QMX A;  2MMO A;  1IYH A;  1W89 A;  2EIQ A;  3OR5 A;  3DWV A;  3QPM A;  4XIH A;  2VO4 A;  2KP2 A;  2YZH A;  1ERT A;  4XHM A;  4MK3 A;  3P7X A;  2QSI A;  2REM A;  3F8U A;  4X1U A;  2IIY A;  4F0B A;  3QDN A;  1K0A A;  2VOC A;  1E6B A;  2QC7 A;  1GP1 A;  4XTS A;  2M72 A;  4I2U A;  5GSS A;  2H76 A;  1V58 A;  2IPA A;  3ZRE A;  2DLX A;  3LXZ A;  2VUP A;  1QMV A;  1RK4 A;  1EGR A;  5ID2 B;  1EGO A;  4OD7 A;  4V2M A;  2VCT A;  3TKS C;  2YP6 A;  1K0M A;  2K9F A;  1V9W A;  4F03 A;  1QFN A;  2J23 A;  5LNK e;  5KEJ A;  2I1U A;  4TR4 A;  5LD0 A;  1QK8 A;  2PWJ A;  1O73 A;  3TB2 A;  4IJ3 A;  5JCU A;  3TOU A;  3W8S A;  3KXO A;  2H19 A;  1EEJ A;  2OE0 A;  5IOX A;  1OC3 A;  2V41 A;  1A2L A;  2VLU A;  4GTU A;  4IP1 A;  5HQP A;  3H79 A;  2FLS A;  4JU5 A;  1FOV A;  4WR4 A;  2LKU A;  3LJR A;  3IHQ A;  1M2A A;  3KIJ A;  5FHI A;  3WT2 A;  3F6F A;  1HD2 A;  3KP9 A;  2ALB A;  1UVZ A;  2NVL A;  3KTB A;  4GSN A;  1FHE A;  3VI5 A;  3EMP A;  3KMO A;  18GS A;  3GST A;  3DD3 A;  4JR6 A;  1PQN A;  3QAG A;  5HFG A;  2YAN A;  5KN1 A;  4J2F A;  3QOU A;  2MMA A;  1K3L A;  4TR1 B;  5G1K A;  2LUS A;  3TKP A;  3DKS A;  3IBH A;  2PVO C;  4GF0 A;  3LQ7 A;  4OO5 A;  1PGT A;  3HKR A;  5EY6 A;  2HFD A;  3A2V A;  2DJ1 A;  2F51 A;  2L5O A;  2YWM A;  2P5R A;  1XW5 A;  4GST A;  1XVW A;  3IE3 A;  4TR3 A;  2IMI A;  3L4N A;  4L5O A;  2VCZ A;  1K0N A;  2NTO A;  2A4V A;  3ZML A;  5F8B A;  2GST A;  3U6V A;  3W6G A;  3IAS 2;  3P90 A;  4MP4 A;  5INY A;  3KM6 A;  1GLQ A;  1WWJ A;  3WGE A;  5IO2 A;  4EF0 A;  1Z5Y E;  4V2L A;  3TDG A;  16GS A;  4IVF A;  1A23 A;  1GL8 A;  2I3Y A;  3RDW A;  1U3A A;  5D9T A;  3HJO A;  4ZB8 A;  5JCW A;  4HJM A;  4E8H A;  4NPB A;  2H75 A;  1LBK A;  2HYX A;  1V2A A;  3TJK A;  3VUR A;  6GSS A;  3QFA C;  1TTZ A;  4BPY A;  3KH9 A;  5F05 A;  1KTE A;  4NMU A;  9GSS A;  2B5E A;  1WMJ A;  5HR1 A;  5F06 A;  1M0U A;  3IK7 A;  2NPB A;  3UOM A;  4XS1 A;  4KCE A;  2P31 A;  4KDU A;  5F07 A;  4K2D A;  2EC4 A;  2WDU A;  1TDI A;  1SD8 A;  3HJP A;  1MD3 A;  2CVB A;  3FR3 A;  4K7N A;  3KZQ A;  2N5A A;  2GZP A;  2C0D A;  2JZS A;  1NHY A;  1V40 A;  1LJR A;  5IQY A;  4DVC A;  2VM2 A;  3DYR A;  2CX4 A;  3FZA A;  3DVX A;  2FD3 A;  1Z6M A;  1GNE A;  3FR9 A;  4MJE A;  4TW5 A;  2C3T A;  4PQ1 A;  1XOB A;  5JWO B;  4IJI A;  1UN2 A;  2X8C A;  5E59 A;  1BQ7 A;  1WJK A;  3ERF A;  2K6V A;  2HLS A;  1YKC A;  3ERW A;  1FB0 A;  2C80 A;  2PPT A;  3TRP A;  4KW6 A;  5L71 A;  2VLT A;  5KN0 A;  3EU3 A;  1ERW A;  2E2M A;  5ECR B;  1ZYQ B;  2H0H A;  2R5G A;  2C0G A;  2H73 A;  3H93 A;  5D9X A;  2LV3 A;  4HI7 A;  4KND A;  1XWA A;  3UBK A;  1ERV A;  1ILO A;  1C72 A;  3GKM A;  1XWK A;  4F9Z A;  3GKX A;  2IMD A;  2JSY A;  3TRX A;  4AJ8 A;  1THX A;  2H71 A;  4ZL9 A;  4BVX A;  3TOT A;  4HEA 2;  5ECK B;  2FNO A;  1Q98 A;  5AIX A;  2DJK A;  2RUF A;  4OFM A;  3VFI A;  2B6M A;  1MTC A;  5CO3 A;  2PGT A;  2VL2 A;  3PH9 A;  3VWW A;  1OE8 A;  2GQL A;  1FVJ A;  5ECI B;  2F3M A;  2A2R A;  1RQM A;  4D73 B;  1OKT A;  2PBJ A;  2VD0 A;  2MMN A;  1XW9 A;  1EV9 A;  3IA1 A;  4QL7 A;  3FHK A;  3KEB A;  5CRG A;  4IBP A;  2E0Q A;  3WYW A;  2JZT A;  1YKA A;  2YV7 A;  10GS A;  2YJH A;  3LXT A;  1B8X A;  3KGK A;  14GS A;  5DVB A;  3L9V A;  4XS4 B;  4IEL A;  2ON7 A;  1USB A;  2JL4 A;  1NW2 A;  2KP1 A;  2V32 A;  4L0U A;  1H4O A;  4OMV A;  4I5Q A;  4KB3 A;  1TP9 A;  1YF1 A;  1NSW A;  2DJ2 A;  3QAV A;  1TI3 A;  1XXU A;  2RM6 A;  3QAW A;  2AYT A;  1Z9H A;  1SJI A;  3BD2 A;  2VL3 A;  2JAC A;  3UIW A;  4EXJ A;  2J9H A;  2DJJ A;  4XS6 A;  2XPD A;  3CRT A;  2F8F A;  1G6Y A;  1B9Y C;  4HQZ A;  2IFQ B;  3L9S A;  1DSB A;  1H75 A;  2H6X A;  3F4S A;  5ECO B;  2H1A A;  4L8E A;  3C1S A;  5JWR B;  1PSQ A;  4YQU A;  1K0D A;  1JFU A;  4LA1 A;  4WEY A;  5EL8 A;  2FGX A;  3PIN A;  2LEG A;  3UJ1 A;  2KUC A;  4OCE A;  3VWV A;  4I2T A;  1SD9 A;  5IM9 A;  3SWL A;  1A8Y A;  1G0T A;  4GSS A;  1GH2 A;  2N5F A;  2GLR A;  1EOH A;  3WD6 A;  3ME8 A;  3VLN A;  1K0C A;  2HZF A;  2B1L A;  1TRS A;  2RII A;  3VWU A;  5DJL A;  2IJY A;  1ON4 A;  2O7K A;  2WJU A;  3FW2 A;  3D4M A;  2RM5 A;  3TJJ A;  4QL9 A;  2PVQ A;  2VLV A;  5H5R A;  1U6T A;  4GCI A;  2GSS A;  4MH2 A;  1AIU A;  3HD5 A;  2LRC A;  1F2E A;  3EE2 A;  2AB6 A;  5IMA A;  2XC2 A;  4P3Y B;  2HE3 A;  3CYN A;  4N10 A;  1AQV A;  3IRA A;  1Z7R A;  2C3N A;  2B7J A;  3G7J A;  4RQX A;  1ACV A;  1PD2 1;  2GZY A;  1B48 A;  1TRW A;  2AHE A;  1WIK A;  3GL3 A;  2H1G A;  4HQS A;  1VF1 A;  5B8B A;  1RW1 A;  2EIR A;  5IIZ A;  1HYU A;  4PNG A;  2X8H A;  4PQH A;  5ECN B;  5AN1 A;  1TK5 B;  3IDV A;  2H74 A;  4MLY A;  1AC1 A;  1BED A;  2YPM A;  3GX8 A;  3LEF A;  2FUG 2;  4MJB A;  3ZVJ A;  3G7I A;  2H1D A;  3IC4 A;  2B1K A;  4MJC A;  4IP6 A;  2GVP A;  3HZ8 A;  5H5Q A;  1X9W B;  4OCF A;  3LWA A;  3U5R E;  2OE3 A;  5ENU A;  2WB9 A;  1GSY A;  2OBI A;  4WET A;  3RHB A;  5AIV A;  3ZIJ A;  3E3E A;  3CXG A;  4LL4 B;  2CAQ A;  4HS1 A;  4HUA A;  4G9H A;  3HXS A;  3ZIV A;  2B3S A;  3HJM A;  1T00 A;  1GSD A;  1KBN A;  4WBJ A;  4MDC A;  2JSZ A;  1JLV A;  5A4U A;  1YY7 A;  1TRV A;  4NHZ A;  4YQM A;  4OFN A;  5GZZ B;  2O87 A;  1T1V A;  1QUW A;  3BOA A;  1XWB A;  4J56 E;  4ZL8 A;  2CT6 A;  3GIX A;  1WE0 A;  4Z7X A;  3KD0 A;  1SL0 B;  1XCC A;  3F63 A;  3ZTL A;  5DJM A;  4KH7 A;  2VD1 A;  2H01 A;  2PMT A;  4TXO B;  2VCV A;  1PA3 A;  1O6J A;  2PN8 A;  3MSZ A;  4NAX A;  4PNF A;  1W4V A;  3GH6 A;  5J3R A;  2B5Y A;  1PKW A;  4QQ7 A;  4IN0 A;  3IXR A;  3PR8 A;  3GKK A;  4K6X A;  2HSY A;  1TKD B;  2IMK A;  1GLP A;  5B6M A;  2F8A A;  3TKQ A;  1HNC A;  5IMZ A;  1URM A;  1EP8 A;  4IS0 A;  2WCI A;  2GQK A;  3APQ A;  2CVK A;  1FG4 A;  2FWH A;  1GUM A;  4ZBB A;  2YJ7 A;  5ID2 A;  4RI7 A;  4V1A p;  1SYR A;  3AY8 A;  3ME7 A;  3GV1 A;  1JLW A;  2OBK A;  2FY6 A;  2AJQ B;  1OKD A;  1M2B A;  3KMN A;  1R7H A;  4GWR A;  3WGD A;  1DE2 A;  2VAF A;  4KE3 A;  1XFL A;  3ISO A;  1B4Q A;  1UC7 A;  2DBC A;  3NOF A;  1O7U A;  1PRX A;  4L5L A;  1SL1 B;  3ZL5 A;  4E8E A;  2L4Q A;  3FRC A;  5J5N A;  3GFK A;  1K3Y A;  3MAK A;  3TKS E;  1XWG A;  3R2Q A;  3HDC A;  19GS A;  2LNS A;  1R5A A;  2IN3 A;  4DSS A;  4KUN A;  3CSI A;  5HFK A;  12GS A;  3UVH A;  3UL3 A;  4HOJ A;  1GTB A;  4AGS A;  4H86 A;  4FO5 A;  4MPF A;  5DQY A;  1TK0 B;  1SKR B;  1U87 A;  3QFB C;  1SK1 A;  3UMA A;  1OC9 B;  5CNW A;  3EMX A;  3KH7 A;  1UA5 A;  1F9M A;  1SYX A;  4HZ2 A;  4O32 A;  5IPH A;  4FH8 A;  2H8L A;  4X43 A;  2XHF A;  2L6C A;  4LMW A;  2FA4 A;  3F3R A;  3LYP A;  3KJY A;  3KTL A;  11GS A;  2XBI A;  4V2N A;  2ON5 A;  3LOR A;  3QCP A;  1T3B A;  13GS A;  3BCK A;  2MBS A;  4ZXG A;  2FWF A;  2OE1 A;  5CRE A;  1XVQ A;  1BJX A;  3LFL A;  3GTU A;  1DE1 A;  1YQ1 A;  2R4V A;  2P5Q A;  5DAK A;  1PMT A;  2D2Z A;  3GKN A;  3ZYW A;  3G9B A;  3DML A;  2YZU A;  3H8Q A;  4Q5R A;  3GX0 A;  2CZ3 A;  1U88 A;  4NV2 A;  4CHS A;  3HVS A;  5DCG A;  4EDY A;  1HNB A;  4JED A;  8GSS A;  4AJ7 A;  3VWX A;  1XWC A;  2LQO A;  1EV4 A;  2L59 A;  2DJ3 A;  1FW1 A;  2DJ0 A;  22GS A;  3GUR A;  4LL1 B;  1JHB A;  5C00 A;  1S3D A;  5IMF A;  4WBR D;  3A2X A;  1F37 A;  3S9F A;  1PN9 A;  2LS5 A;  3FR6 A;  4ISD A;  1AQW A;  2L6D A;  2OKA A;  1B4P A;  1FB6 A;  5CYY A;  2QKE A;  3H1N A;  3DRN A;  2CQ9 A;  1EP7 A;  3UBL A;  3I9V 2;  2LJK A;  3F9U A;  2FHE A;  2GS3 A;  1VGL A;  3TKR A;  4POL A;  3MWH A;  4TR0 A;  1CQH A;  2DML A;  2HNL A;  1A2M A;  1FVK A;  1K3O A;  1GRX A;  2WRT A;  3UVT A;  4RUV A;  5B7C A;  3ZZX A;  4ULX A;  2C0E A;  2L5L A;  4PXO A;  1ZL9 A;  5H5S A;  1V98 A;  3D0Z A;  3MNG A;  5JWQ B;  4POM A;  3TUE A;  3ZIT A;  2GGT A;  4YH2 A;  2XPE A;  1VF3 A;  1KEB A;  4GRF A;  2VIM A;  5FWG A;  2X8G A;  3EVI A;  2R6K A;  4F0C A;  4MZC A;  1YEP A;  3FKF A;  3RPP A;  3L9U A;  1N2A A;  1EZK A;  4MF5 A;  1GNW A;  3QD9 A;  2TRX A;  4J57 E;  5DQS A;  3TKS A;  4ML1 A;  5IMD A;  1ST9 A;  2HZE B;  4EUY A;  1TW9 A;  1X9M B;  4BVY A;  2H6Z A;  1M7T A;  5DAL B;  4BWS A;  4EVM A;  1E2Y A;  1A2J A;  4K8M A;  1A24 A;  3TCO A;  3GSS A;  1SL2 B;  4FYB A;  1TXX A;  1MDI A;  2GQM A;  2A2S A;  1AUC A;  4XRA A;  2K8V A;  4MAB A;  2C1Y A;  3FYG A;  5LCZ A;  3I6A A;  1T8E B;  1Y25 A;  3CMI A;  1R26 A;  1BG5 A;  2YWO A;  4PUA A;  5GST A;  4IW9 A;  2WGR A;  2GT5 A;  3N9J A;  1NHO A;  4WXT A;  3TJG A;  3CSH A;  2MMZ A;  5GAN D;  1FO5 A;  3MDK A;  2GTU A;  2RUE A;  2C3Q A;  3ERG A;  5A4W A;  2R37 A;  4K0G A;  5G5E A;  5CRW A;  3M0F A;  3HVV A;  5DCH A;  1X5D A;  3EC3 A;  3Q18 A;  3RPN A;  4D73 A;  1ZOF A;  3WGX A;  3CBU A;  2O85 A;  5G31 A;  4F82 A;  1A0R P;  5HR0 A;  4TKY A;  2O89 A;  3Q6O A;  1T4Z A;  4EE0 A;  1JZO A;  5C04 A;  2HI7 A;  4IGJ A;  5IPG A;  2C8U A;  4POK A;  1N8J A;  3ED3 A;  4WR5 A;  1X0R A;  2GSR A;  2FCH A;  2YWN A;  4G2E A;  3US3 A;  2DC5 A;  1K0B A;  1EEM A;  1JZR A;  2RLI A;  4XS4 A;  2YOI A;  2TIR A;  2H0I A;  4AF2 A;  3UEM A;  3FZ4 A;  3Q19 A;  4WKW A;  4WF4 A;  1TJD A;  1Z3E A;  3ZFB A;  4KCA A;  1GUL A;  2LQQ A;  4HJ2 A;  3O3T A;  4ID0 A;  5G5F A;  4HDE A;  2WS2 A;  2K8S A;  3LGC A;  3IOS A;  1XPV A;  1R4W A;  1X5C A;  4Q5N A;  5G2Z A;  4ILF A;  1J9B A;  3K8N A;  4KAE A;  3C73 A;  3P2A A;  1EWX A;  3VPQ A;  2R3X A;  2VCW A;  2O8V B;  1TU7 A;  3Q74 A;  2IWT A;  2OAD A;  2X64 A;  1OE7 A;  5HR3 A;  1GTA A;  4POB A;  4GLT A;  1O81 A;  2BJX A;  3BCI A;  4RQR A;  1OVN A;  3EUR A;  2KLX A;  2V6O A;  4X0X A;  5IMV A;  3GA4 A;  4BL7 A;  3IPZ A;  2IME A;  1GSE A;  3A2W A;  2V6K A;  6GSY A;  4EDZ A;  1NM3 A;  5IO0 A;  5A5K A;  1BAY A;  3W8J A;  2HRN A;  2DSA A;  1T4Y A;  2H1B A;  3F4R A;  4G10 A;  1GSU A;  17GS A;  4KX4 A;  1Z7P A;  3F4T A;  4ML6 A;  3HA9 A;  4JBB A;  3L78 A;  3NZN A;  4ZIL A;  3CSJ A;  3ZFL A;  3DEX A;  5JCG A;  1YF0 A;  3APO A;  2YWI A;  1JZW A;  2JU5 A;  2LNT A;  4IQA A;  4JRR A;  5D9W A;  5ECP B;  3C7M A;  2PER A;  5B6N A;  3HHV A;  1T7P B;  4ZBD A;  2YNX A;  5DBQ A;  6GSW A;  3D4T A;  2LRN A;  4ZBA A;  2ES7 A;  2VM1 A;  4K0N A;  1BYE A;  4CW9 A;  2G2Q A;  2XBQ A;  5D9V A;  7GSS A;  4MZW A;  2LRT A;  2L57 A;  2AAW A;  3HVX A;  1SJZ A;  4GXZ A;  2VL2 C;  2CV4 A;  3CTG A;  3FEU A;  5DDL A;  1J08 A;  3DXB A;  1ML6 A;  2WFC A;  1IYI A;  1FAA A;  4NXI A;  4I97 A;  5D93 A;  4ZB6 A;  4ECC A;  1XIY A;  3F0I A;  1O8W A;  1GWC A;  1DBY A;  1TU8 A;  2I81 A;  3D21 A;  1AAZ A;  1SK0 A;  2DIZ A;  3GN3 A;  1I9D A;  1Q4J A;  1SEN A;  2C4J A;  2PU9 C;  2IL3 A;  2X99 A;  1TK8 B;  5D8I A;  4N11 A;  5HFI A;  4I6X A;  4DSS B;  1QXH A;  3C1R A;  3BJ5 A;  2YV9 A;  1XZO A;  2JZR A;  4FIW A;  1F6M C;  3H4K A;  3A5W A;  3I43 A;  5J4U A;  2MBT A;  2LTK A;  1GSF A;  2EIO A;  3UAP A;  1HNA A;  1M9B A;  3DIE A;  4ECB A;  1AXD A;  3GYK A;  4JR4 A;  2CA8 A;  4N30 A;  4XRD A;  2LJR A;  1TRU A;  4YAV A;  3P8W A;  3IR4 A;  1ABA A;  1PL2 A;  2HSH A;  4F2I A;  3FZ5 A;  1S3A A;  4V1A g;  3E9J B;  3M9J A;  1F3B A;  5D73 A;  4LLR A;  4IHU A;  3GTU B;  3LYK A;  1SK2 A;  5F0G A;  3D5J A;  1AQX A;  1MEK A;  4KGI A;  1CQG A;  2OJL A;  4TXO A;  3V1W A;  5DAK B;  3BBY A;  4PUR A;  1OC8 A;  2WZ9 A;  1KNG A;  4KSO A;  4MJA A;  4MF7 A;  3IAM 2;  1ZMA A;  1YZX A;  3D6I A;  1K0O A;  4KDY A;  3ZRD A;  4JE1 A;  6GSU A;  5B8A A;  4FYC A;  2HRF A;  1ZYE A;  1U3I A;  2MYG A;  3RAZ A;  4EO3 A;  4ECI A;  4GQC A;  1MDJ A;  3CRU A;  1THO A;  4BA7 A;  2NBS A;  4TR1 A;  4G19 A;  2VL9 A;  2GDR A;  1PKZ A;  2H66 A;  3FY7 A;  3M1G A;  1S3C A;  4KA0 A;  1GUH A;  3GHA A;  2AUV A;  3VI7 A;  1ZZY A;  3KCM A;  3M9K A;  3EIN A;  1GTI A;  2VCX A;  4IQ1 A;  4HZ4 A;  3IV4 A;  4MA9 A;  2CX3 A;  1YDK A;  2I4A A;  5J9C A;  4CDO A;  4GQF A;  4K7I A;  5IMC A;  4ZL7 A;  4PUF C;  2GZZ A;  4K7O A;  4O5R A;  1WP0 A;  1OC9 A;  4DEJ A;  1GSQ A;  1X5E A;  4IKH A;  2G0F A;  4JZQ A;  5EPF A;  1YEX A;  3TJF A;  1SKS B;  3TRQ A;  4O92 A;  6GST A;  4OO4 A;  1SU9 A;  5CRD A;  1M2D A;  3F3Q A;  1VF2 A;  4TRX A;  2VCQ A;  4EC0 A;  5CRH A;  4EKZ A;  4ZB9 A;  4LMV A;  2E2G A;  3C8E A;  1QQ2 A;  2BTO T;  5ABR A;  3FK8 A;  4AJ6 A;  3FZ9 A;  20GS A;  3RHC A;  1G7O A;  5GAP D;  3LSZ A;  4KSM A;  1SJ6 A;  1ZGN A;  1M9A A;  4RI6 A;  1JZD A;  4OFT A;  3A3T A;  5COH A;  3SBC A;  3CTF A;  4KDX A;  4OWY A;  4PQI A;  5KN3 A;  1I5G A;  5J9B A;  3HYP A;  4K9Z A;  3VK9 A;  4HU9 A;  1A8L A;  4HU7 A;  2H30 A;  1GSS A;  1WOU A;  2K18 A;  2KOK A;  4XCS A;  1TOF A;  1O8X A;  4N0V A;  3ZLP A;  2C0F A;  2HT9 A;  3NIV A;  1HQO A;  2PUK C;  3KP8 A;  3EU4 A;  5ECL B;  1G7E A;  2H70 A;  1A0F A;  3UAR A;  4BWQ A;  2Z9S A;  4N0Z A;  3EYT A;  1R5P A;  3EWL A;  4TN8 A;  3DVW A;  1GUK A;  3TJB A;  3IK9 A;  2FA8 A;  5J41 A;  4NWY A;  5A4V A;  3PGT A;  4DSR A;  2M80 A;  2ZUP A;  1O85 A;  3QR6 A;  4YQV A;  2L4C A;  5FT3 A;  5HR2 A;  1G6W A;  4MCU A;  2ZCT A;  2CVD A;  1VRS D;  3RBT A;  2CZ2 A;  4O7H A;  2P0G A;  1ERU A;  1OAZ A;  4I8B A;  3DGQ A;  4L0W A;  1XW6 A;  2LJA A;  4Q5Q A;  1MD4 A;  4TOP A;  3VPT A;  2M46 A;  2YCD A;  5G1L A;  3JCM L;  3ZVJ D;  3GNJ A;  4ACS A;  2V2G A;  1M99 A;  5IOW A;  2MZC A; 
#chains in the Genus database with same CATH topology
 5AIS A;  2H0G A;  5AGY A;  1V57 A;  4DSQ A;  1XOA A;  3WT1 A;  2HZE A;  4ZIJ A;  5ELA A;  3TGZ A;  3J7Y k;  3GH9 A;  5DAL A;  5KN2 A;  2V1M A;  2YN1 A;  2ZNM A;  3O76 A;  4YAP A;  3N5O A;  1TI1 A;  4WF5 A;  5G30 A;  6GSV A;  3ZMK A;  2DIY A;  3G7Y A;  2QGV A;  2I9H A;  3HZ4 A;  1AW9 A;  1PX7 A;  4ECJ A;  4NHW A;  2H72 A;  2LST A;  4G0K A;  2TRC P;  1BX9 A;  5EVO A;  2N5B A;  4TXV A;  1Z6N A;  1GTU A;  3GUS A;  1LU4 A;  3GL5 A;  3HY2 A;  4MF6 A;  3J7Y b;  2R2J A;  4K2X A;  4MZB A;  3M3M A;  3GMF A;  6GSX A;  1OYJ A;  2F9S A;  1XBS A;  1VF4 A;  4MPG A;  1PL1 A;  4FYU A;  2JAD A;  2FWG A;  1QGV A;  3L0H A;  2AV4 A;  5ELG A;  1J0F A;  1DUG A;  5CAX A;  2CAI A;  4MMM A;  4K1F A;  4TVE A;  1SKW B;  2B5X A;  2FWE A;  5ECH B;  2BMX A;  2OA7 A;  2DMM A;  2IFQ A;  3LG6 A;  2NDO A;  2B7K A;  2GT6 A;  4NV5 A;  1PX6 A;  2WUL A;  1Y6E A;  5ECS A;  1EOG A;  1F3A A;  3GRX A;  5E4W A;  4O5U A;  3M8N A;  2GSQ A;  4PGT A;  1YJ6 A;  3APS A;  4EL1 A;  4Q5F A;  3HCZ A;  2IMF A;  4PX1 A;  3D22 A;  2OAC A;  3I69 A;  3E0U A;  5D96 A;  1X9S B;  3O6T A;  1B9X C;  3C71 A;  1WPI A;  1WRY A;  2KHP A;  1MDK A;  5ECQ B;  3F6D A;  5CP1 A;  2E7P A;  2H6Y A;  1ZCP A;  4MH3 A;  5ECM B;  2HXK A;  3QMX A;  2MMO A;  1IYH A;  1W89 A;  2EIQ A;  3OR5 A;  3DWV A;  3QPM A;  4XIH A;  2VO4 A;  2KP2 A;  2YZH A;  1ERT A;  4XHM A;  4MK3 A;  3P7X A;  2QSI A;  2REM A;  3F8U A;  4X1U A;  2IIY A;  4F0B A;  3QDN A;  1K0A A;  2VOC A;  1E6B A;  2QC7 A;  1GP1 A;  4XTS A;  2M72 A;  4I2U A;  5GSS A;  2H76 A;  1V58 A;  2IPA A;  3ZRE A;  2DLX A;  3LXZ A;  2VUP A;  2DKH A;  1QMV A;  1RK4 A;  1EGR A;  5ID2 B;  1EGO A;  4OD7 A;  4G0L A;  4V2M A;  2VCT A;  3TKS C;  2YP6 A;  1K0M A;  2K9F A;  1V9W A;  4F03 A;  1QFN A;  2X4A A;  2J23 A;  5LNK e;  5KEJ A;  2I1U A;  4TR4 A;  5LD0 A;  1QK8 A;  2PWJ A;  1O73 A;  3TB2 A;  4IJ3 A;  5JCU A;  3TOU A;  3W8S A;  3KXO A;  2H19 A;  1EEJ A;  2OE0 A;  5IOX A;  1OC3 A;  2V41 A;  1A2L A;  2VLU A;  4GTU A;  4IP1 A;  5HQP A;  3H79 A;  2FLS A;  4JU5 A;  1FOV A;  4WR4 A;  2LKU A;  3LJR A;  3IHQ A;  1M2A A;  3KIJ A;  5FHI A;  3WT2 A;  3F6F A;  1HD2 A;  3KP9 A;  2ALB A;  1UVZ A;  2NVL A;  3KTB A;  4CY6 A;  4GSN A;  1FHE A;  3VI5 A;  3EMP A;  4A5P A;  3KMO A;  18GS A;  3GST A;  3DD3 A;  4JR6 A;  1PQN A;  3QAG A;  5HFG A;  2YAN A;  5KN1 A;  4J2F A;  3QOU A;  2MMA A;  1K3L A;  4TR1 B;  5G1K A;  2LUS A;  3TKP A;  3DKS A;  3IBH A;  2PVO C;  4GF0 A;  3LQ7 A;  4OO5 A;  1PGT A;  3HKR A;  4ICY A;  1S3R A;  5EY6 A;  2HFD A;  3A2V A;  2DJ1 A;  2F51 A;  2L5O A;  2YWM A;  2P5R A;  1XW5 A;  4GST A;  1XVW A;  3IE3 A;  4TR3 A;  2IMI A;  3L4N A;  1M3J A;  4L5O A;  1XG8 A;  2VCZ A;  1K0N A;  2NTO A;  2A4V A;  3ZML A;  5F8B A;  2GST A;  3U6V A;  3W6G A;  3IAS 2;  3P90 A;  4MP4 A;  5INY A;  3KM6 A;  1GLQ A;  1WWJ A;  3WGE A;  5IO2 A;  4EF0 A;  1Z5Y E;  4V2L A;  3TDG A;  16GS A;  4IVF A;  1A23 A;  1GL8 A;  2I3Y A;  3RDW A;  1U3A A;  5D9T A;  3HJO A;  4ZB8 A;  5JCW A;  4HJM A;  4E8H A;  4NPB A;  2H75 A;  1LBK A;  2HYX A;  1V2A A;  3TJK A;  3VUR A;  6GSS A;  3QFA C;  1TTZ A;  4BPY A;  3KH9 A;  5F05 A;  1KTE A;  4NMU A;  9GSS A;  2B5E A;  1WMJ A;  5HR1 A;  5F06 A;  1M0U A;  3IK7 A;  2NPB A;  3UOM A;  4XS1 A;  4KCE A;  2P31 A;  4KDU A;  5F07 A;  4K2D A;  2EC4 A;  2WDU A;  2R0G A;  1TDI A;  1SD8 A;  3R3E A;  3HJP A;  1MD3 A;  2CVB A;  3FR3 A;  4K7N A;  3CQF A;  3KZQ A;  2N5A A;  2GZP A;  2C0D A;  2JZS A;  1NHY A;  1V40 A;  1LJR A;  5IQY A;  4DVC A;  2VM2 A;  3DYR A;  5KOW A;  2CX4 A;  3FZA A;  3DVX A;  2FD3 A;  1Z6M A;  1GNE A;  3FR9 A;  4MJE A;  4TW5 A;  2C3T A;  4PQ1 A;  1XOB A;  5JWO B;  4IJI A;  1UN2 A;  2X8C A;  1BQ7 A;  5E59 A;  1ZYP A;  1WJK A;  3ERF A;  2K6V A;  2HLS A;  1YKC A;  3ERW A;  1FB0 A;  2C80 A;  2PPT A;  3TRP A;  4KW6 A;  5L71 A;  2VLT A;  5KN0 A;  3EU3 A;  1ERW A;  2E2M A;  5ECR B;  1ZYQ B;  2H0H A;  2R5G A;  2C0G A;  2H73 A;  3H93 A;  5D9X A;  2LV3 A;  4HI7 A;  4KND A;  1XWA A;  3UBK A;  1ERV A;  1ILO A;  1C72 A;  3GKM A;  1XWK A;  4F9Z A;  3GKX A;  2IMD A;  2JSY A;  3TRX A;  4AJ8 A;  1THX A;  2H71 A;  4ZL9 A;  4BVX A;  3TOT A;  4HEA 2;  5ECK B;  2FNO A;  1Q98 A;  5AIX A;  2DJK A;  2RUF A;  4OFM A;  3VFI A;  2B6M A;  1MTC A;  2HRA A;  5CO3 A;  2PGT A;  2VL2 A;  3PH9 A;  3VWW A;  1OE8 A;  2GQL A;  1FVJ A;  5ECI B;  2F3M A;  2A2R A;  1RQM A;  4D73 B;  1OKT A;  2PBJ A;  2VD0 A;  2MMN A;  1XW9 A;  1EV9 A;  3IA1 A;  4QL7 A;  3FHK A;  3KEB A;  3MIX A;  5CRG A;  4IBP A;  2E0Q A;  3WYW A;  2JZT A;  1YKA A;  2YV7 A;  10GS A;  2YJH A;  3LXT A;  1B8X A;  3KGK A;  14GS A;  5DVB A;  3L9V A;  4XS4 B;  4IEL A;  2ON7 A;  1USB A;  2JL4 A;  1NW2 A;  2KP1 A;  2V32 A;  4L0U A;  1H4O A;  4OMV A;  4I5Q A;  4KB3 A;  1TP9 A;  1YF1 A;  1NSW A;  2DJ2 A;  3QAV A;  1TI3 A;  1XXU A;  2RM6 A;  3QAW A;  2AYT A;  1Z9H A;  1SJI A;  3BD2 A;  2VL3 A;  2JAC A;  3UIW A;  4EXJ A;  2J9H A;  2DJJ A;  4XS6 A;  2XPD A;  3CRT A;  2F8F A;  1G6Y A;  4CY8 A;  4K5S A;  1B9Y C;  4HQZ A;  2IFQ B;  3L9S A;  1DSB A;  1H75 A;  2H6X A;  3F4S A;  2QA1 A;  5ECO B;  2H1A A;  4L8E A;  3C1S A;  5JWR B;  1PSQ A;  4YQU A;  4BL7 B;  1K0D A;  1JFU A;  4LA1 A;  4WEY A;  5EL8 A;  2FGX A;  3PIN A;  2LEG A;  3UJ1 A;  2KUC A;  4OCE A;  3VWV A;  4I2T A;  1SD9 A;  5IM9 A;  3SWL A;  1A8Y A;  1G0T A;  4GSS A;  1GH2 A;  2N5F A;  2GLR A;  1EOH A;  3WD6 A;  3ME8 A;  3VLN A;  1K0C A;  2HZF A;  2B1L A;  1TRS A;  2RII A;  3VWU A;  5DJL A;  2IJY A;  1ON4 A;  2O7K A;  2WJU A;  3FW2 A;  3D4M A;  2RM5 A;  3TJJ A;  4QL9 A;  2PVQ A;  4K5R A;  2VLV A;  5H5R A;  1U6T A;  4GCI A;  2GSS A;  4MH2 A;  1AIU A;  3MYD A;  2UZ8 A;  3HD5 A;  4Z2R A;  2LRC A;  1F2E A;  3EE2 A;  2AB6 A;  5IMA A;  4MNN A;  2XC2 A;  4P3Y B;  2HE3 A;  3CYN A;  4N10 A;  1AQV A;  3IRA A;  1Z7R A;  2C3N A;  2B7J A;  5KOX A;  3G7J A;  4RQX A;  1ACV A;  1PD2 1;  2GZY A;  1B48 A;  1TRW A;  2AHE A;  1WIK A;  3GL3 A;  2H1G A;  4HQS A;  1VF1 A;  5B8B A;  1RW1 A;  2EIR A;  5IIZ A;  1HYU A;  4PNG A;  2X8H A;  4PQH A;  5ECN B;  5AN1 A;  1TK5 B;  3IDV A;  2H74 A;  4MLY A;  1AC1 A;  1BED A;  2YPM A;  3GX8 A;  3LEF A;  2FUG 2;  4MJB A;  3ZVJ A;  3G7I A;  2H1D A;  3IC4 A;  2B1K A;  4MJC A;  4IP6 A;  2GVP A;  3HZ8 A;  5H5Q A;  1X9W B;  4OCF A;  3LWA A;  3U5R E;  2OE3 A;  5ENU A;  2WB9 A;  1GSY A;  2OBI A;  4WET A;  3RHB A;  5AIV A;  3ZIJ A;  3E3E A;  3CXG A;  4LL4 B;  2CAQ A;  4HS1 A;  4HUA A;  4G9H A;  3HXS A;  3ZIV A;  2B3S A;  3HJM A;  1T00 A;  1GSD A;  1KBN A;  4WBJ A;  4MDC A;  2JSZ A;  1JLV A;  5A4U A;  1YY7 A;  4EIP A;  1TRV A;  4NHZ A;  4YQM A;  4OFN A;  5GZZ B;  2O87 A;  1T1V A;  1QUW A;  3BOA A;  1XWB A;  4J56 E;  4ZL8 A;  2CT6 A;  3GIX A;  1WE0 A;  4Z7X A;  3KD0 A;  1SL0 B;  1PN0 A;  1XCC A;  3F63 A;  3ZTL A;  5DJM A;  4KH7 A;  2VD1 A;  2H01 A;  2PMT A;  4TXO B;  2VCV A;  1PA3 A;  1O6J A;  2PN8 A;  3MSZ A;  4NAX A;  2R0P A;  4PNF A;  3EPT A;  1W4V A;  3GH6 A;  5J3R A;  2B5Y A;  1PKW A;  4QQ7 A;  4IN0 A;  3IXR A;  3PR8 A;  3GKK A;  4K6X A;  2HSY A;  1TKD B;  2IMK A;  1GLP A;  5B6M A;  2F8A A;  3TKQ A;  1HNC A;  5IMZ A;  1URM A;  1EP8 A;  4IS0 A;  2WCI A;  2GQK A;  3APQ A;  2CVK A;  1FG4 A;  2FWH A;  1GUM A;  4ZBB A;  2YJ7 A;  5ID2 A;  4RI7 A;  4V1A p;  1SYR A;  4USS A;  3AY8 A;  3ME7 A;  3GV1 A;  1JLW A;  2OBK A;  2FY6 A;  2AJQ B;  1OKD A;  1M2B A;  3KMN A;  1R7H A;  4GWR A;  3WGD A;  1DE2 A;  2VAF A;  4KE3 A;  1XFL A;  3ISO A;  1B4Q A;  1UC7 A;  2DBC A;  3NOF A;  1O7U A;  3IC8 A;  1PRX A;  4L5L A;  1SL1 B;  3ZL5 A;  4E8E A;  2L4Q A;  3FRC A;  5J5N A;  3GFK A;  1K3Y A;  3MAK A;  3TKS E;  1XWG A;  3R2Q A;  3HDC A;  19GS A;  2LNS A;  1R5A A;  2IN3 A;  4DSS A;  4KUN A;  3CSI A;  5HFK A;  12GS A;  3UVH A;  3UL3 A;  4HOJ A;  1GTB A;  4AGS A;  4H86 A;  4FO5 A;  4MPF A;  5DQY A;  1TK0 B;  1SKR B;  1U87 A;  3QFB C;  1SK1 A;  3UMA A;  1OC9 B;  5CNW A;  3EMX A;  3KH7 A;  1UA5 A;  1F9M A;  1SYX A;  4HZ2 A;  4O32 A;  5IPH A;  4FH8 A;  2H8L A;  4X43 A;  2XHF A;  2L6C A;  4LMW A;  2FA4 A;  3F3R A;  3LYP A;  3KJY A;  3KTL A;  11GS A;  2XBI A;  4V2N A;  2ON5 A;  3LOR A;  3QCP A;  3LW9 A;  1T3B A;  13GS A;  3BCK A;  2MBS A;  4ZXG A;  2FWF A;  2OE1 A;  5CRE A;  1XVQ A;  1BJX A;  2HRK A;  3LFL A;  3GTU A;  1DE1 A;  1YQ1 A;  2R4V A;  2P5Q A;  2DKI A;  5DAK A;  1PMT A;  2D2Z A;  3GKN A;  3ZYW A;  3G9B A;  3DML A;  2YZU A;  3H8Q A;  4Q5R A;  3GX0 A;  2CZ3 A;  1U88 A;  4NV2 A;  4CHS A;  3HVS A;  5DCG A;  4EDY A;  1HNB A;  4JED A;  8GSS A;  4AJ7 A;  3VWX A;  1XWC A;  2A2P A;  2LQO A;  1EV4 A;  2L59 A;  2DJ3 A;  1FW1 A;  2DJ0 A;  22GS A;  3GUR A;  4LL1 B;  1JHB A;  5C00 A;  4X4J A;  1S3D A;  5IMF A;  4WBR D;  3A2X A;  1F37 A;  3S9F A;  1PN9 A;  2LS5 A;  3FR6 A;  4ISD A;  1AQW A;  2L6D A;  2OKA A;  1B4P A;  1FB6 A;  5CYY A;  2QKE A;  3H1N A;  3DRN A;  2CQ9 A;  1EP7 A;  3UBL A;  3I9V 2;  2LJK A;  3F9U A;  2FHE A;  2GS3 A;  1VGL A;  3TKR A;  4POL A;  3MWH A;  4TR0 A;  1CQH A;  2DML A;  2HNL A;  1A2M A;  1FVK A;  1K3O A;  1GRX A;  2WRT A;  3UVT A;  3HVN A;  4RUV A;  5B7C A;  3ZZX A;  4ULX A;  2C0E A;  2L5L A;  4PXO A;  1ZL9 A;  4FQU A;  3PPU A;  5H5S A;  1V98 A;  3D0Z A;  3MNG A;  5JWQ B;  4POM A;  3TUE A;  3ZIT A;  2GGT A;  4YH2 A;  2XPE A;  1VF3 A;  1KEB A;  4GRF A;  4PTS A;  2VIM A;  5FWG A;  2X8G A;  3EVI A;  2R6K A;  4F0C A;  4MZC A;  1YEP A;  3FKF A;  3RPP A;  3L9U A;  1N2A A;  1EZK A;  3FMW A;  4MF5 A;  1GNW A;  3QD9 A;  2TRX A;  4J57 E;  5DQS A;  3TKS A;  4ML1 A;  5IMD A;  1ST9 A;  2HZE B;  4EUY A;  1TW9 A;  1X9M B;  4BVY A;  2H6Z A;  1M7T A;  5DAL B;  4BWS A;  4EVM A;  1E2Y A;  1A2J A;  4K8M A;  1A24 A;  3TCO A;  3GSS A;  1SL2 B;  4FYB A;  1TXX A;  1MDI A;  2GQM A;  2A2S A;  1AUC A;  4XRA A;  2K8V A;  4MAB A;  2C1Y A;  3FYG A;  5LCZ A;  3I6A A;  1T8E B;  1Y25 A;  3CMI A;  1R26 A;  1BG5 A;  2YWO A;  4PUA A;  5GST A;  4IW9 A;  2WGR A;  2GT5 A;  3N9J A;  1NHO A;  4WXT A;  3TJG A;  3CSH A;  2MMZ A;  5GAN D;  1FO5 A;  3MDK A;  2GTU A;  2RUE A;  2C3Q A;  3ERG A;  5A4W A;  2R37 A;  4K0G A;  5G5E A;  5CRW A;  3M0F A;  3HVV A;  5DCH A;  1X5D A;  3EC3 A;  3Q18 A;  3RPN A;  4D73 A;  1ZOF A;  3WGX A;  4Z2T A;  3CBU A;  2O85 A;  5G31 A;  4YKG A;  4F82 A;  1A0R P;  5HR0 A;  4TKY A;  2O89 A;  3Q6O A;  1T4Z A;  4EE0 A;  1JZO A;  5C04 A;  2HI7 A;  4IGJ A;  4G0I A;  5IPG A;  2C8U A;  4POK A;  1N8J A;  3ED3 A;  4WR5 A;  1X0R A;  2GSR A;  2FCH A;  2YWN A;  3A5I A;  4G2E A;  3US3 A;  2DC5 A;  1K0B A;  1EEM A;  1JZR A;  2RLI A;  4XS4 A;  2YOI A;  2TIR A;  2H0I A;  4AF2 A;  3UEM A;  3FZ4 A;  3Q19 A;  4WKW A;  4WF4 A;  1TJD A;  1Z3E A;  3ZFB A;  4KCA A;  1GUL A;  2LQQ A;  4HJ2 A;  3O3T A;  4ID0 A;  5G5F A;  4HDE A;  2WS2 A;  2K8S A;  3LGC A;  3IOS A;  1XPV A;  1R4W A;  1X5C A;  4Q5N A;  5G2Z A;  4ILF A;  1J9B A;  2X49 A;  3K8N A;  4KAE A;  3C73 A;  3P2A A;  1EWX A;  3VPQ A;  2R3X A;  1PFO A;  2VCW A;  2O8V B;  1TU7 A;  3Q74 A;  2IWT A;  2OAD A;  2X64 A;  1OE7 A;  5HR3 A;  1GTA A;  4POB A;  4GLT A;  1O81 A;  2BJX A;  3BCI A;  4RQR A;  1OVN A;  3EUR A;  2KLX A;  2V6O A;  4X0X A;  5IMV A;  3GA4 A;  4BL7 A;  3IPZ A;  2IME A;  2HSM A;  1GSE A;  3A2W A;  2V6K A;  6GSY A;  4EDZ A;  1NM3 A;  5IO0 A;  5A5K A;  1ZYN A;  1BAY A;  3W8J A;  2HRN A;  2DSA A;  1T4Y A;  2H1B A;  3F4R A;  4G10 A;  1GSU A;  17GS A;  4KX4 A;  1Z7P A;  3F4T A;  4ML6 A;  3HA9 A;  4JBB A;  3L78 A;  3NZN A;  4ZIL A;  3CSJ A;  3ZFL A;  3DEX A;  5JCG A;  1YF0 A;  3APO A;  2YWI A;  1JZW A;  2JU5 A;  2LNT A;  4IQA A;  4JRR A;  5D9W A;  5ECP B;  3C7M A;  2PER A;  5B6N A;  3HHV A;  1T7P B;  4ZBD A;  2YNX A;  4KF9 A;  4EIQ A;  5DBQ A;  6GSW A;  3D4T A;  2LRN A;  4ZBA A;  2ES7 A;  2VM1 A;  4K0N A;  1BYE A;  4CW9 A;  2G2Q A;  2XBQ A;  5D9V A;  7GSS A;  4MZW A;  2LRT A;  2L57 A;  2AAW A;  3HVX A;  1SJZ A;  4GXZ A;  2VL2 C;  2CV4 A;  5BMU A;  3CTG A;  3FEU A;  5DDL A;  1J08 A;  3DXB A;  1ML6 A;  2WFC A;  1IYI A;  1FAA A;  4NXI A;  4I97 A;  5D93 A;  4ZB6 A;  4ECC A;  1XIY A;  3F0I A;  1O8W A;  1GWC A;  1DBY A;  1TU8 A;  2I81 A;  3D21 A;  1AAZ A;  1SK0 A;  2DIZ A;  3GN3 A;  1I9D A;  4HSC X;  1Q4J A;  1SEN A;  2C4J A;  2PU9 C;  2IL3 A;  2X99 A;  1TK8 B;  5D8I A;  4N11 A;  5HFI A;  4I6X A;  4DSS B;  1QXH A;  3C1R A;  3BJ5 A;  2YV9 A;  1XZO A;  2JZR A;  4FIW A;  1F6M C;  3H4K A;  3A5W A;  3I43 A;  5J4U A;  2MBT A;  2LTK A;  1GSF A;  2EIO A;  3UAP A;  1HNA A;  1M9B A;  3DIE A;  4ECB A;  1AXD A;  3GYK A;  4JR4 A;  2CA8 A;  4N30 A;  4XRD A;  2LJR A;  2QA2 A;  1TRU A;  4YAV A;  3P8W A;  3IR4 A;  1ABA A;  1PL2 A;  2HSH A;  4F2I A;  3FZ5 A;  1S3A A;  4V1A g;  3E9J B;  3M9J A;  1F3B A;  5D73 A;  4LLR A;  4IHU A;  3GTU B;  3LYK A;  1SK2 A;  5F0G A;  3D5J A;  1AQX A;  1MEK A;  4KGI A;  1CQG A;  2OJL A;  4TXO A;  3V1W A;  5DAK B;  3BBY A;  4PUR A;  1OC8 A;  2WZ9 A;  1KNG A;  4KSO A;  4MJA A;  4MF7 A;  3IAM 2;  1ZMA A;  1YZX A;  3D6I A;  1K0O A;  4KDY A;  3ZRD A;  4JE1 A;  6GSU A;  5B8A A;  4FYC A;  2HRF A;  1ZYE A;  1U3I A;  2MYG A;  3RAZ A;  4EO3 A;  4ECI A;  3IHG A;  4GQC A;  1MDJ A;  3CRU A;  1THO A;  2R0C A;  4BA7 A;  2NBS A;  4TR1 A;  4G19 A;  2VL9 A;  1FOH A;  2GDR A;  1PKZ A;  2H66 A;  3FY7 A;  3M1G A;  1S3C A;  4KA0 A;  1GUH A;  3GHA A;  2AUV A;  3VI7 A;  1ZZY A;  3KCM A;  3M9K A;  3EIN A;  1GTI A;  2VCX A;  4IQ1 A;  4HZ4 A;  3IV4 A;  4MA9 A;  2CX3 A;  1YDK A;  2I4A A;  5J9C A;  4CDO A;  5BRT A;  4GQF A;  4K7I A;  5IMC A;  4ZL7 A;  4PUF C;  2GZZ A;  4K7O A;  4O5R A;  1WP0 A;  1OC9 A;  4DEJ A;  1GSQ A;  4BVX B;  1X5E A;  4IKH A;  2G0F A;  4JZQ A;  5EPF A;  1YEX A;  3TJF A;  1SKS B;  3TRQ A;  4O92 A;  6GST A;  4OO4 A;  1SU9 A;  5CRD A;  1M2D A;  3F3Q A;  1VF2 A;  4TRX A;  2VCQ A;  4EC0 A;  5CRH A;  4EKZ A;  4ZB9 A;  4BVY B;  4LMV A;  2E2G A;  3C8E A;  1QQ2 A;  2BTO T;  5ABR A;  3FK8 A;  4AJ6 A;  3FZ9 A;  20GS A;  3RHC A;  1G7O A;  5GAP D;  3LSZ A;  4KSM A;  1SJ6 A;  1ZGN A;  1M9A A;  4RI6 A;  1JZD A;  4OFT A;  3A3T A;  5COH A;  3SBC A;  3CTF A;  4KDX A;  4OWY A;  4PQI A;  5KN3 A;  1I5G A;  5J9B A;  4BIK A;  3HYP A;  4K9Z A;  3VK9 A;  4HU9 A;  1A8L A;  1M3I A;  4HU7 A;  2H30 A;  1GSS A;  1WOU A;  2K18 A;  2KOK A;  4XCS A;  1TOF A;  1O8X A;  4N0V A;  3ZLP A;  2C0F A;  2HT9 A;  3NIV A;  1HQO A;  2PUK C;  3KP8 A;  3EU4 A;  4YKF A;  5ECL B;  1G7E A;  2H70 A;  1A0F A;  3UAR A;  4BWQ A;  2Z9S A;  4N0Z A;  3EYT A;  1R5P A;  3EWL A;  4TN8 A;  3DVW A;  1GUK A;  3TJB A;  4Z2U A;  3IK9 A;  2FA8 A;  5J41 A;  4NWY A;  5A4V A;  3PGT A;  4DSR A;  2A4H A;  2M80 A;  2ZUP A;  1O85 A;  3QR6 A;  4YQV A;  2L4C A;  5FT3 A;  5HR2 A;  1G6W A;  4MCU A;  2ZCT A;  2CVD A;  1VRS D;  3RBT A;  2CZ2 A;  4O7H A;  2P0G A;  1ERU A;  1OAZ A;  4I8B A;  3DGQ A;  4L0W A;  1XW6 A;  2LJA A;  4Q5Q A;  1MD4 A;  4TOP A;  3VPT A;  2M46 A;  2YCD A;  5G1L A;  3JCM L;  3ZVJ D;  3GNJ A;  4O5Q A;  4ACS A;  2V2G A;  1M99 A;  5IOW A;  2MZC A; 
#chains in the Genus database with same CATH homology
 5AIS A;  2H0G A;  5AGY A;  1V57 A;  4DSQ A;  1XOA A;  3WT1 A;  2HZE A;  4ZIJ A;  5ELA A;  3TGZ A;  3J7Y k;  3GH9 A;  5DAL A;  5KN2 A;  2V1M A;  2YN1 A;  2ZNM A;  3O76 A;  4YAP A;  3N5O A;  1TI1 A;  4WF5 A;  5G30 A;  6GSV A;  3ZMK A;  2DIY A;  3G7Y A;  2QGV A;  2I9H A;  3HZ4 A;  1AW9 A;  1PX7 A;  4ECJ A;  4NHW A;  2H72 A;  2LST A;  4G0K A;  2TRC P;  1BX9 A;  5EVO A;  2N5B A;  4TXV A;  1Z6N A;  1GTU A;  3GUS A;  1LU4 A;  3GL5 A;  3HY2 A;  4MF6 A;  3J7Y b;  2R2J A;  4K2X A;  4MZB A;  3M3M A;  3GMF A;  6GSX A;  1OYJ A;  2F9S A;  1XBS A;  1VF4 A;  4MPG A;  1PL1 A;  4FYU A;  2JAD A;  2FWG A;  1QGV A;  3L0H A;  2AV4 A;  5ELG A;  1J0F A;  1DUG A;  5CAX A;  2CAI A;  4MMM A;  4K1F A;  4TVE A;  1SKW B;  2B5X A;  2FWE A;  5ECH B;  2BMX A;  2OA7 A;  2DMM A;  2IFQ A;  3LG6 A;  2NDO A;  2B7K A;  2GT6 A;  4NV5 A;  1PX6 A;  2WUL A;  1Y6E A;  5ECS A;  1EOG A;  1F3A A;  3GRX A;  5E4W A;  4O5U A;  3M8N A;  2GSQ A;  4PGT A;  1YJ6 A;  3APS A;  4EL1 A;  4Q5F A;  3HCZ A;  2IMF A;  4PX1 A;  3D22 A;  2OAC A;  3I69 A;  3E0U A;  5D96 A;  1X9S B;  3O6T A;  1B9X C;  3C71 A;  1WPI A;  1WRY A;  2KHP A;  1MDK A;  5ECQ B;  3F6D A;  5CP1 A;  2E7P A;  2H6Y A;  1ZCP A;  4MH3 A;  5ECM B;  2HXK A;  3QMX A;  2MMO A;  1IYH A;  1W89 A;  2EIQ A;  3OR5 A;  3DWV A;  3QPM A;  4XIH A;  2VO4 A;  2KP2 A;  2YZH A;  1ERT A;  4XHM A;  4MK3 A;  3P7X A;  2QSI A;  2REM A;  3F8U A;  4X1U A;  2IIY A;  4F0B A;  3QDN A;  1K0A A;  2VOC A;  1E6B A;  2QC7 A;  1GP1 A;  4XTS A;  2M72 A;  4I2U A;  5GSS A;  2H76 A;  1V58 A;  2IPA A;  3ZRE A;  2DLX A;  3LXZ A;  2VUP A;  2DKH A;  1QMV A;  1RK4 A;  1EGR A;  5ID2 B;  1EGO A;  4OD7 A;  4G0L A;  4V2M A;  2VCT A;  3TKS C;  2YP6 A;  1K0M A;  2K9F A;  1V9W A;  4F03 A;  1QFN A;  2X4A A;  2J23 A;  5LNK e;  5KEJ A;  2I1U A;  4TR4 A;  5LD0 A;  1QK8 A;  2PWJ A;  1O73 A;  3TB2 A;  4IJ3 A;  5JCU A;  3TOU A;  3W8S A;  3KXO A;  2H19 A;  1EEJ A;  2OE0 A;  5IOX A;  1OC3 A;  2V41 A;  1A2L A;  2VLU A;  4GTU A;  4IP1 A;  5HQP A;  3H79 A;  2FLS A;  4JU5 A;  1FOV A;  4WR4 A;  2LKU A;  3LJR A;  3IHQ A;  1M2A A;  3KIJ A;  5FHI A;  3WT2 A;  3F6F A;  1HD2 A;  3KP9 A;  2ALB A;  1UVZ A;  2NVL A;  3KTB A;  4CY6 A;  4GSN A;  1FHE A;  3VI5 A;  3EMP A;  4A5P A;  3KMO A;  18GS A;  3GST A;  3DD3 A;  4JR6 A;  1PQN A;  3QAG A;  5HFG A;  2YAN A;  5KN1 A;  4J2F A;  3QOU A;  2MMA A;  1K3L A;  4TR1 B;  5G1K A;  2LUS A;  3TKP A;  3DKS A;  3IBH A;  2PVO C;  4GF0 A;  3LQ7 A;  4OO5 A;  1PGT A;  3HKR A;  4ICY A;  5EY6 A;  2HFD A;  3A2V A;  2DJ1 A;  2F51 A;  2L5O A;  2YWM A;  2P5R A;  1XW5 A;  4GST A;  1XVW A;  3IE3 A;  4TR3 A;  2IMI A;  3L4N A;  4L5O A;  2VCZ A;  1K0N A;  2NTO A;  2A4V A;  3ZML A;  5F8B A;  2GST A;  3U6V A;  3W6G A;  3IAS 2;  3P90 A;  4MP4 A;  5INY A;  3KM6 A;  1GLQ A;  1WWJ A;  3WGE A;  5IO2 A;  4EF0 A;  1Z5Y E;  4V2L A;  3TDG A;  16GS A;  4IVF A;  1A23 A;  1GL8 A;  2I3Y A;  3RDW A;  1U3A A;  5D9T A;  3HJO A;  4ZB8 A;  5JCW A;  4HJM A;  4E8H A;  4NPB A;  2H75 A;  1LBK A;  2HYX A;  1V2A A;  3TJK A;  3VUR A;  6GSS A;  3QFA C;  1TTZ A;  4BPY A;  3KH9 A;  5F05 A;  1KTE A;  4NMU A;  9GSS A;  2B5E A;  1WMJ A;  5HR1 A;  5F06 A;  1M0U A;  3IK7 A;  2NPB A;  3UOM A;  4XS1 A;  4KCE A;  2P31 A;  4KDU A;  5F07 A;  4K2D A;  2EC4 A;  2WDU A;  2R0G A;  1TDI A;  1SD8 A;  3R3E A;  3HJP A;  1MD3 A;  2CVB A;  3FR3 A;  4K7N A;  3KZQ A;  2N5A A;  2GZP A;  2C0D A;  2JZS A;  1NHY A;  1V40 A;  1LJR A;  5IQY A;  4DVC A;  2VM2 A;  3DYR A;  5KOW A;  2CX4 A;  3FZA A;  3DVX A;  2FD3 A;  1Z6M A;  1GNE A;  3FR9 A;  4MJE A;  4TW5 A;  2C3T A;  4PQ1 A;  1XOB A;  5JWO B;  4IJI A;  1UN2 A;  2X8C A;  1BQ7 A;  5E59 A;  1ZYP A;  1WJK A;  3ERF A;  2K6V A;  2HLS A;  1YKC A;  3ERW A;  1FB0 A;  2C80 A;  2PPT A;  3TRP A;  4KW6 A;  5L71 A;  2VLT A;  5KN0 A;  3EU3 A;  1ERW A;  2E2M A;  5ECR B;  1ZYQ B;  2H0H A;  2R5G A;  2C0G A;  2H73 A;  3H93 A;  5D9X A;  2LV3 A;  4HI7 A;  4KND A;  1XWA A;  3UBK A;  1ERV A;  1ILO A;  1C72 A;  3GKM A;  1XWK A;  4F9Z A;  3GKX A;  2IMD A;  2JSY A;  3TRX A;  4AJ8 A;  1THX A;  2H71 A;  4ZL9 A;  4BVX A;  3TOT A;  4HEA 2;  5ECK B;  2FNO A;  1Q98 A;  5AIX A;  2DJK A;  2RUF A;  4OFM A;  3VFI A;  2B6M A;  1MTC A;  2HRA A;  5CO3 A;  2PGT A;  2VL2 A;  3PH9 A;  3VWW A;  1OE8 A;  2GQL A;  1FVJ A;  5ECI B;  2F3M A;  2A2R A;  1RQM A;  4D73 B;  1OKT A;  2PBJ A;  2VD0 A;  2MMN A;  1XW9 A;  1EV9 A;  3IA1 A;  4QL7 A;  3FHK A;  3KEB A;  3MIX A;  5CRG A;  4IBP A;  2E0Q A;  3WYW A;  2JZT A;  1YKA A;  2YV7 A;  10GS A;  2YJH A;  3LXT A;  1B8X A;  3KGK A;  14GS A;  5DVB A;  3L9V A;  4XS4 B;  4IEL A;  2ON7 A;  1USB A;  2JL4 A;  1NW2 A;  2KP1 A;  2V32 A;  4L0U A;  1H4O A;  4OMV A;  4I5Q A;  4KB3 A;  1TP9 A;  1YF1 A;  1NSW A;  2DJ2 A;  3QAV A;  1TI3 A;  1XXU A;  2RM6 A;  3QAW A;  2AYT A;  1Z9H A;  1SJI A;  3BD2 A;  2VL3 A;  2JAC A;  3UIW A;  4EXJ A;  2J9H A;  2DJJ A;  4XS6 A;  2XPD A;  3CRT A;  2F8F A;  1G6Y A;  4CY8 A;  4K5S A;  1B9Y C;  4HQZ A;  2IFQ B;  3L9S A;  1DSB A;  1H75 A;  2H6X A;  3F4S A;  2QA1 A;  5ECO B;  2H1A A;  4L8E A;  3C1S A;  5JWR B;  1PSQ A;  4YQU A;  4BL7 B;  1K0D A;  1JFU A;  4LA1 A;  4WEY A;  5EL8 A;  2FGX A;  3PIN A;  2LEG A;  3UJ1 A;  2KUC A;  4OCE A;  3VWV A;  4I2T A;  1SD9 A;  5IM9 A;  3SWL A;  1A8Y A;  1G0T A;  4GSS A;  1GH2 A;  2N5F A;  2GLR A;  1EOH A;  3WD6 A;  3ME8 A;  3VLN A;  1K0C A;  2HZF A;  2B1L A;  1TRS A;  2RII A;  3VWU A;  5DJL A;  2IJY A;  1ON4 A;  2O7K A;  2WJU A;  3FW2 A;  3D4M A;  2RM5 A;  3TJJ A;  4QL9 A;  2PVQ A;  4K5R A;  2VLV A;  5H5R A;  1U6T A;  4GCI A;  2GSS A;  4MH2 A;  1AIU A;  3MYD A;  2UZ8 A;  3HD5 A;  4Z2R A;  2LRC A;  1F2E A;  3EE2 A;  2AB6 A;  5IMA A;  4MNN A;  2XC2 A;  4P3Y B;  2HE3 A;  3CYN A;  4N10 A;  1AQV A;  3IRA A;  1Z7R A;  2C3N A;  2B7J A;  5KOX A;  3G7J A;  4RQX A;  1ACV A;  1PD2 1;  2GZY A;  1B48 A;  1TRW A;  2AHE A;  1WIK A;  3GL3 A;  2H1G A;  4HQS A;  1VF1 A;  5B8B A;  1RW1 A;  2EIR A;  5IIZ A;  1HYU A;  4PNG A;  2X8H A;  4PQH A;  5ECN B;  5AN1 A;  1TK5 B;  3IDV A;  2H74 A;  4MLY A;  1AC1 A;  1BED A;  2YPM A;  3GX8 A;  3LEF A;  2FUG 2;  4MJB A;  3ZVJ A;  3G7I A;  2H1D A;  3IC4 A;  2B1K A;  4MJC A;  4IP6 A;  2GVP A;  3HZ8 A;  5H5Q A;  1X9W B;  4OCF A;  3LWA A;  3U5R E;  2OE3 A;  5ENU A;  2WB9 A;  1GSY A;  2OBI A;  4WET A;  3RHB A;  5AIV A;  3ZIJ A;  3E3E A;  3CXG A;  4LL4 B;  2CAQ A;  4HS1 A;  4HUA A;  4G9H A;  3HXS A;  3ZIV A;  2B3S A;  3HJM A;  1T00 A;  1GSD A;  1KBN A;  4WBJ A;  4MDC A;  2JSZ A;  1JLV A;  5A4U A;  1YY7 A;  4EIP A;  1TRV A;  4NHZ A;  4YQM A;  4OFN A;  5GZZ B;  2O87 A;  1T1V A;  1QUW A;  3BOA A;  1XWB A;  4J56 E;  4ZL8 A;  2CT6 A;  3GIX A;  1WE0 A;  4Z7X A;  3KD0 A;  1SL0 B;  1PN0 A;  1XCC A;  3F63 A;  3ZTL A;  5DJM A;  4KH7 A;  2VD1 A;  2H01 A;  2PMT A;  4TXO B;  2VCV A;  1PA3 A;  1O6J A;  2PN8 A;  3MSZ A;  4NAX A;  2R0P A;  4PNF A;  3EPT A;  1W4V A;  3GH6 A;  5J3R A;  2B5Y A;  1PKW A;  4QQ7 A;  4IN0 A;  3IXR A;  3PR8 A;  3GKK A;  4K6X A;  2HSY A;  1TKD B;  2IMK A;  1GLP A;  5B6M A;  2F8A A;  3TKQ A;  1HNC A;  5IMZ A;  1URM A;  1EP8 A;  4IS0 A;  2WCI A;  2GQK A;  3APQ A;  2CVK A;  1FG4 A;  2FWH A;  1GUM A;  4ZBB A;  2YJ7 A;  5ID2 A;  4RI7 A;  4V1A p;  1SYR A;  4USS A;  3AY8 A;  3ME7 A;  3GV1 A;  1JLW A;  2OBK A;  2FY6 A;  2AJQ B;  1OKD A;  1M2B A;  3KMN A;  1R7H A;  4GWR A;  3WGD A;  1DE2 A;  2VAF A;  4KE3 A;  1XFL A;  3ISO A;  1B4Q A;  1UC7 A;  2DBC A;  3NOF A;  1O7U A;  3IC8 A;  1PRX A;  4L5L A;  1SL1 B;  3ZL5 A;  4E8E A;  2L4Q A;  3FRC A;  5J5N A;  3GFK A;  1K3Y A;  3MAK A;  3TKS E;  1XWG A;  3R2Q A;  3HDC A;  19GS A;  2LNS A;  1R5A A;  2IN3 A;  4DSS A;  4KUN A;  3CSI A;  5HFK A;  12GS A;  3UVH A;  3UL3 A;  4HOJ A;  1GTB A;  4AGS A;  4H86 A;  4FO5 A;  4MPF A;  5DQY A;  1TK0 B;  1SKR B;  1U87 A;  3QFB C;  1SK1 A;  3UMA A;  1OC9 B;  5CNW A;  3EMX A;  3KH7 A;  1UA5 A;  1F9M A;  1SYX A;  4HZ2 A;  4O32 A;  5IPH A;  4FH8 A;  2H8L A;  4X43 A;  2XHF A;  2L6C A;  4LMW A;  2FA4 A;  3F3R A;  3LYP A;  3KJY A;  3KTL A;  11GS A;  2XBI A;  4V2N A;  2ON5 A;  3LOR A;  3QCP A;  3LW9 A;  1T3B A;  13GS A;  3BCK A;  2MBS A;  4ZXG A;  2FWF A;  2OE1 A;  5CRE A;  1XVQ A;  1BJX A;  2HRK A;  3LFL A;  3GTU A;  1DE1 A;  1YQ1 A;  2R4V A;  2P5Q A;  2DKI A;  5DAK A;  1PMT A;  2D2Z A;  3GKN A;  3ZYW A;  3G9B A;  3DML A;  2YZU A;  3H8Q A;  4Q5R A;  3GX0 A;  2CZ3 A;  1U88 A;  4NV2 A;  4CHS A;  3HVS A;  5DCG A;  4EDY A;  1HNB A;  4JED A;  8GSS A;  4AJ7 A;  3VWX A;  1XWC A;  2A2P A;  2LQO A;  1EV4 A;  2L59 A;  2DJ3 A;  1FW1 A;  2DJ0 A;  22GS A;  3GUR A;  4LL1 B;  1JHB A;  5C00 A;  4X4J A;  1S3D A;  5IMF A;  4WBR D;  3A2X A;  1F37 A;  3S9F A;  1PN9 A;  2LS5 A;  3FR6 A;  4ISD A;  1AQW A;  2L6D A;  2OKA A;  1B4P A;  1FB6 A;  5CYY A;  2QKE A;  3H1N A;  3DRN A;  2CQ9 A;  1EP7 A;  3UBL A;  3I9V 2;  2LJK A;  3F9U A;  2FHE A;  2GS3 A;  1VGL A;  3TKR A;  4POL A;  3MWH A;  4TR0 A;  1CQH A;  2DML A;  2HNL A;  1A2M A;  1FVK A;  1K3O A;  1GRX A;  2WRT A;  3UVT A;  4RUV A;  5B7C A;  3ZZX A;  4ULX A;  2C0E A;  2L5L A;  4PXO A;  1ZL9 A;  4FQU A;  3PPU A;  5H5S A;  1V98 A;  3D0Z A;  3MNG A;  5JWQ B;  4POM A;  3TUE A;  3ZIT A;  2GGT A;  4YH2 A;  2XPE A;  1VF3 A;  1KEB A;  4GRF A;  4PTS A;  2VIM A;  5FWG A;  2X8G A;  3EVI A;  2R6K A;  4F0C A;  4MZC A;  1YEP A;  3FKF A;  3RPP A;  3L9U A;  1N2A A;  1EZK A;  3FMW A;  4MF5 A;  1GNW A;  3QD9 A;  2TRX A;  4J57 E;  5DQS A;  3TKS A;  4ML1 A;  5IMD A;  1ST9 A;  2HZE B;  4EUY A;  1TW9 A;  1X9M B;  4BVY A;  2H6Z A;  1M7T A;  5DAL B;  4BWS A;  4EVM A;  1E2Y A;  1A2J A;  4K8M A;  1A24 A;  3TCO A;  3GSS A;  1SL2 B;  4FYB A;  1TXX A;  1MDI A;  2GQM A;  2A2S A;  1AUC A;  4XRA A;  2K8V A;  4MAB A;  2C1Y A;  3FYG A;  5LCZ A;  3I6A A;  1T8E B;  1Y25 A;  3CMI A;  1R26 A;  1BG5 A;  2YWO A;  4PUA A;  5GST A;  4IW9 A;  2WGR A;  2GT5 A;  3N9J A;  1NHO A;  4WXT A;  3TJG A;  3CSH A;  2MMZ A;  5GAN D;  1FO5 A;  3MDK A;  2GTU A;  2RUE A;  2C3Q A;  3ERG A;  5A4W A;  2R37 A;  4K0G A;  5G5E A;  5CRW A;  3M0F A;  3HVV A;  5DCH A;  1X5D A;  3EC3 A;  3Q18 A;  3RPN A;  4D73 A;  1ZOF A;  3WGX A;  4Z2T A;  3CBU A;  2O85 A;  5G31 A;  4YKG A;  4F82 A;  1A0R P;  5HR0 A;  4TKY A;  2O89 A;  3Q6O A;  1T4Z A;  4EE0 A;  1JZO A;  5C04 A;  2HI7 A;  4IGJ A;  4G0I A;  5IPG A;  2C8U A;  4POK A;  1N8J A;  3ED3 A;  4WR5 A;  1X0R A;  2GSR A;  2FCH A;  2YWN A;  3A5I A;  4G2E A;  3US3 A;  2DC5 A;  1K0B A;  1EEM A;  1JZR A;  2RLI A;  4XS4 A;  2YOI A;  2TIR A;  2H0I A;  4AF2 A;  3UEM A;  3FZ4 A;  3Q19 A;  4WKW A;  4WF4 A;  1TJD A;  1Z3E A;  3ZFB A;  4KCA A;  1GUL A;  2LQQ A;  4HJ2 A;  3O3T A;  4ID0 A;  5G5F A;  4HDE A;  2WS2 A;  2K8S A;  3LGC A;  3IOS A;  1XPV A;  1R4W A;  1X5C A;  4Q5N A;  5G2Z A;  4ILF A;  1J9B A;  2X49 A;  3K8N A;  4KAE A;  3C73 A;  3P2A A;  1EWX A;  3VPQ A;  2R3X A;  2VCW A;  2O8V B;  1TU7 A;  3Q74 A;  2IWT A;  2OAD A;  2X64 A;  1OE7 A;  5HR3 A;  1GTA A;  4POB A;  4GLT A;  1O81 A;  2BJX A;  3BCI A;  4RQR A;  1OVN A;  3EUR A;  2KLX A;  2V6O A;  4X0X A;  5IMV A;  3GA4 A;  4BL7 A;  3IPZ A;  2IME A;  2HSM A;  1GSE A;  3A2W A;  2V6K A;  6GSY A;  4EDZ A;  1NM3 A;  5IO0 A;  5A5K A;  1ZYN A;  1BAY A;  3W8J A;  2HRN A;  2DSA A;  1T4Y A;  2H1B A;  3F4R A;  4G10 A;  1GSU A;  17GS A;  4KX4 A;  1Z7P A;  3F4T A;  4ML6 A;  3HA9 A;  4JBB A;  3L78 A;  3NZN A;  4ZIL A;  3CSJ A;  3ZFL A;  3DEX A;  5JCG A;  1YF0 A;  3APO A;  2YWI A;  1JZW A;  2JU5 A;  2LNT A;  4IQA A;  4JRR A;  5D9W A;  5ECP B;  3C7M A;  2PER A;  5B6N A;  3HHV A;  1T7P B;  4ZBD A;  2YNX A;  4KF9 A;  4EIQ A;  5DBQ A;  6GSW A;  3D4T A;  2LRN A;  4ZBA A;  2ES7 A;  2VM1 A;  4K0N A;  1BYE A;  4CW9 A;  2G2Q A;  2XBQ A;  5D9V A;  7GSS A;  4MZW A;  2LRT A;  2L57 A;  2AAW A;  3HVX A;  1SJZ A;  4GXZ A;  2VL2 C;  2CV4 A;  5BMU A;  3CTG A;  3FEU A;  5DDL A;  1J08 A;  3DXB A;  1ML6 A;  2WFC A;  1IYI A;  1FAA A;  4NXI A;  4I97 A;  5D93 A;  4ZB6 A;  4ECC A;  1XIY A;  3F0I A;  1O8W A;  1GWC A;  1DBY A;  1TU8 A;  2I81 A;  3D21 A;  1AAZ A;  1SK0 A;  2DIZ A;  3GN3 A;  1I9D A;  1Q4J A;  1SEN A;  2C4J A;  2PU9 C;  2IL3 A;  2X99 A;  1TK8 B;  5D8I A;  4N11 A;  5HFI A;  4I6X A;  4DSS B;  1QXH A;  3C1R A;  3BJ5 A;  2YV9 A;  1XZO A;  2JZR A;  4FIW A;  1F6M C;  3H4K A;  3A5W A;  3I43 A;  5J4U A;  2MBT A;  2LTK A;  1GSF A;  2EIO A;  3UAP A;  1HNA A;  1M9B A;  3DIE A;  4ECB A;  1AXD A;  3GYK A;  4JR4 A;  2CA8 A;  4N30 A;  4XRD A;  2LJR A;  2QA2 A;  1TRU A;  4YAV A;  3P8W A;  3IR4 A;  1ABA A;  1PL2 A;  2HSH A;  4F2I A;  3FZ5 A;  1S3A A;  4V1A g;  3E9J B;  3M9J A;  1F3B A;  5D73 A;  4LLR A;  4IHU A;  3GTU B;  3LYK A;  1SK2 A;  5F0G A;  3D5J A;  1AQX A;  1MEK A;  4KGI A;  1CQG A;  2OJL A;  4TXO A;  3V1W A;  5DAK B;  3BBY A;  4PUR A;  1OC8 A;  2WZ9 A;  1KNG A;  4KSO A;  4MJA A;  4MF7 A;  3IAM 2;  1ZMA A;  1YZX A;  3D6I A;  1K0O A;  4KDY A;  3ZRD A;  4JE1 A;  6GSU A;  5B8A A;  4FYC A;  2HRF A;  1ZYE A;  1U3I A;  2MYG A;  3RAZ A;  4EO3 A;  4ECI A;  3IHG A;  4GQC A;  1MDJ A;  3CRU A;  1THO A;  2R0C A;  4BA7 A;  2NBS A;  4TR1 A;  4G19 A;  2VL9 A;  1FOH A;  2GDR A;  1PKZ A;  2H66 A;  3FY7 A;  3M1G A;  1S3C A;  4KA0 A;  1GUH A;  3GHA A;  2AUV A;  3VI7 A;  1ZZY A;  3KCM A;  3M9K A;  3EIN A;  1GTI A;  2VCX A;  4IQ1 A;  4HZ4 A;  3IV4 A;  4MA9 A;  2CX3 A;  1YDK A;  2I4A A;  5J9C A;  4CDO A;  5BRT A;  4GQF A;  4K7I A;  5IMC A;  4ZL7 A;  4PUF C;  2GZZ A;  4K7O A;  4O5R A;  1WP0 A;  1OC9 A;  4DEJ A;  1GSQ A;  4BVX B;  1X5E A;  4IKH A;  2G0F A;  4JZQ A;  5EPF A;  1YEX A;  3TJF A;  1SKS B;  3TRQ A;  4O92 A;  6GST A;  4OO4 A;  1SU9 A;  5CRD A;  1M2D A;  3F3Q A;  1VF2 A;  4TRX A;  2VCQ A;  4EC0 A;  5CRH A;  4EKZ A;  4ZB9 A;  4BVY B;  4LMV A;  2E2G A;  3C8E A;  1QQ2 A;  2BTO T;  5ABR A;  3FK8 A;  4AJ6 A;  3FZ9 A;  20GS A;  3RHC A;  1G7O A;  5GAP D;  3LSZ A;  4KSM A;  1SJ6 A;  1ZGN A;  1M9A A;  4RI6 A;  1JZD A;  4OFT A;  3A3T A;  5COH A;  3SBC A;  3CTF A;  4KDX A;  4OWY A;  4PQI A;  5KN3 A;  1I5G A;  5J9B A;  3HYP A;  4K9Z A;  3VK9 A;  4HU9 A;  1A8L A;  4HU7 A;  2H30 A;  1GSS A;  1WOU A;  2K18 A;  2KOK A;  4XCS A;  1TOF A;  1O8X A;  4N0V A;  3ZLP A;  2C0F A;  2HT9 A;  3NIV A;  1HQO A;  2PUK C;  3KP8 A;  3EU4 A;  4YKF A;  5ECL B;  1G7E A;  2H70 A;  1A0F A;  3UAR A;  4BWQ A;  2Z9S A;  4N0Z A;  3EYT A;  1R5P A;  3EWL A;  4TN8 A;  3DVW A;  1GUK A;  3TJB A;  4Z2U A;  3IK9 A;  2FA8 A;  5J41 A;  4NWY A;  5A4V A;  3PGT A;  4DSR A;  2A4H A;  2M80 A;  2ZUP A;  1O85 A;  3QR6 A;  4YQV A;  2L4C A;  5FT3 A;  5HR2 A;  1G6W A;  4MCU A;  2ZCT A;  2CVD A;  1VRS D;  3RBT A;  2CZ2 A;  4O7H A;  2P0G A;  1ERU A;  1OAZ A;  4I8B A;  3DGQ A;  4L0W A;  1XW6 A;  2LJA A;  4Q5Q A;  1MD4 A;  4TOP A;  3VPT A;  2M46 A;  2YCD A;  5G1L A;  3JCM L;  3ZVJ D;  3GNJ A;  4O5Q A;  4ACS A;  2V2G A;  1M99 A;  5IOW A;  2MZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...