2LQRA

Nmr structure of ig3 domain of palladin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
GGSNATAPFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANPQGRVSCTGRLMVQAVNQRGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Palladin
publication title Structure and Function of Palladin's Actin Binding Domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 19
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2lqrA00
3ULUD 4R90H 3LD8B 5KS9E 1G6RB 3QCTH 4JFDD 1TQBC 3S3SA 1JGDA 3MLUH 2BY0A 4UNVA 4MA1C 2VAAB 4RISL 4XGZB 2I25N 5EH1A 2Z35B 1KB5B 1FAIL 4TN9A 1RVFL 1SVCP 1GGYA 5SWZD 5FM8A 1WCBB 4TNVF 3GHBH 3DJ9A 1XF2B 1PDKA 3VWKD 2CH8A 3WJJA 2HVKA 4NFDA 1XGUA 1EHAA 3BGMB 1XIWB 1RUKH 2VIRA 4M1DH 5BVPL 4TSBL 4WW2F 3EJZC 5MHSD 4WHYG 3K3QA 2OQJB 3BMVA 4PJFA 2IAND 3IAQA 1A4JB 3TBWA 2OXHA 4UU9A 5J6GB 3ARFD 5ICZB 4Z5RB 3EYQC 3F7RA 1XR9B 3FQWB 3CDYA 4NN6B 1NGQL 5CZKA 4I1NB 4U6HB 2OR9H 2FWOA 3UTZA 2Y6SC 4QTIL 2R0WL 3WIHA 1YQVH 1A6UH 2F8OA 3PDOA 4XCEB 1FCGA 2VXVL 4OZFA 4TNVK 4DTGH 5TGBB 1TDQA 3ARDD 5GGVY 4Y16A 1RZ8B 1NGZA 5E2VL 3ULUL 2IPUK 3SE3C 4X8JA 4UQ3A 1IGJB 2DS4A 2YN3A 1Z0MA 3BUYA 4DEPB 2LVCA 2P5ED 3HI5L 2IFFL 5E70A 4Z78A 2IQAA 3IB4A 3HR5A 4PJBE 3VGGA 1K8IA 3E8UL 1FFNA 5HYSB 2DQEL 1RPQA 1QLRA 5GISL 3K2MC 1VESA 3TA3C 2IPKB 3GIVB 3NAAL 1ZA3B 3FB7A 1JRHL 4IOIA 4JJ5B 4UV7L 4ZUVA 4LSSH 4OZ4A 3VG9B 2FATH 4LLUB 2G9HB 3TBSB 1FN4A 4LGPB 5LBSL 3SDXB 4IJ3C 3U7AA 2G75B 4I5BA 1CR9L 2DTSA 3BYTA 4OZHF 4FFYL 4OCNC 1H3PH 4QRTB 4HX1B 5D7IF 2YD6A 4G3YH 5H35A 5DA4A 5MI0B 1INQA 1JNLH 1GZQA 5BS0B 4BZ2L 5C8JA 4XAWL 2VXQL 4M43L 3DOSA 2XFXB 2F9BT 4LMQI 5H2BB 3EJJX 1KGCE 1I1AC 3BRDA 4FQXD 1GH7A 1BM3L 2MWCA 1IC1A 3BZFA 3P30H 3QQ9D 3GEWB 4AMKL 5HHQB 1F4XL 4UZGA 4PBVC 4DK3A 1GL4B 2WUBL 5IK3B 1LEKB 1IEHA 3O8XC 4HG4J 1IKFH 3BIBX 3VD5A 3W2DL 3CDCA 2PO6A 4J6RL 2GUOA 3QUYD 4EN3B 2OJZH 4P49A 1G7IA 4JO4H 1NSNH 5AZEH 3QEUB 2DL2A 2GJZA 2ZKHH 1IM3A 2C4FU 4X4MA 5J1AB 4KTEL 1VFBB 3NCJH 2YZ1A 4MWFB 2AJUH 8FABA 3BEWB 4MX7B 4GBXC 4ACPA 2BY3A 4KUCD 3U36A 4K7PY 5IV2A 1NBYA 3WE6A 3CFIC 3KWWA 2UV3A 3A6CL 5DEFA 5B39B 2VLJA 4K94L 2ZNXA 3X11B 1BBJA 4Y1AA 4U2ZA 1MAKA 1W0YT 4QRRD 4NNPL 4POUB 3G6JA 4ALAH 1EFXD 3C5JA 3JWOC 3VGFA 5E8DL 1XGTB 2VR9A 2HLFD 3QDAA 4XGZA 5IQ7L 5DJ2A 2J88H 4OSUH 3QEHB 5BVJA 5F9AC 1BIHA 1DCLA 1KG0B 5HHNA 3B2VH 4J4PA 4JFOB 2AXHA 1V3JA 1XF2A 3VFUA 4NN5C 3C5ZA 3RIAK 2QQKH 3BPNB 1Q0YL 4JRYD 2BXYA 2BVPB 1KTKE 4KVCL 2X7LB 1UWGH 3G5VB 4X6FA 3WFEH 1PYWA 4NKIL 3SJVE 4I18B 4MQXC 2DLIA 3IFPB 4XH2B 2H26B 5CJQL 1ZEAH 4C57C 4OGZA 4KK9C 4Y19E 4U6TA 4PJ9C 2H41A 1A4JA 1ORSB 4LNRB 5J6GA 3VXPA 1TJGL 5ICZA 2R29H 2P45B 4PR5B 4Z5RA 1PLGH 1XR9A 5E9DB 3I6KB 3FQWA 2XQBH 4U6HA 3QI9B 4RGOL 4WI3A 3WFBH 2ZNWA 4XNUH 1YMHB 2DLFL 4XPFL 1S7VB 4CU7A 5B39G 4U33A 4ZAKA 2WBJD 3QR2A 3VG0H 4UB0L 5K9QI 1I8KB 1RZ8A 5DC0A 1ZLWH 1BPVA 5I8CA 3ABZA 4UNUA 1IGJA 2XWBB 4XP5H 3HCVB 3C60B 1CZ8L 1A9EA 4W4NA 1QFWM 4LQFL 4APQC 4HWEL 1VHPA 2XTLA 2F54E 5DJZB 1S9WB 3NA9L 3V0WL 3P3YA 4MNQE 3CMOH 1CFQB 1A1MA 3LY6A 3QULA 4XMLH 1G7JB 1HCFX 3MV8E 3GIVA 1ZA3A 1CXEA 5F6HJ 4PRPB 5HPMA 4R4BB 2C7UB 4JJ5A 3WDIA 3K4DA 4RDQF 4LLUA 3TBSA 2ZOKB 4HIJB 4PJHF 3SDXA 4H8WL 4X6BB 2G75A 2NY2C 3FO1A 1P9MC 4YXHH 2NY3C 5IB2A 4S1SH 4OCRH 1CIDA 4LCUB 4KVNL 2A0LC 3PNWA 4JKMA 3ZSSA 1J0KA 4FZEL 1UYWH 4LOUD 4NKQB 5GQBA 5I1JL 4X7TA 1MRCH 4FFWC 1P5UA 5CSZB 2P49B 2FO4A 5EC2B 2X4UB 2WINA 5IBUB 2ED8A 1CDUA 3QRGL 5BS0A 3ZT6A 4LDLB 2XFXA 4WUUD 3SDDC 5C07B 5DLML 3U0PB 3DVIA 4M6NL 1N8ZB 4OLWH 4O2CB 4JY4A 1YYLH 4QLRA 3QXAA 3SKNB 4PYHA 4MJ2A 1T20B 1YMME 1X9QA 2FEDC 2AQ3A 3QUMH 1RY7B 4OB5L 3HPJB 4QNPF 5LAXB 2VDML 5IVXE 4WY7H 43CAB 1LEKA 2OZ4H 5FYJU 4QOKD 5KSBB 3C6LD 4N9GB 2W9EL 1JGEA 1K8DA 2R15A 1T0PB 4JLRB 5C0AB 3ZTNL 2DQCH 4I2XB 3OKKB 4XNMA 3V95A 4RX4A 3VWKC 2GITA 5DF0A 3A6OA 1VFBA 1TXKA 1WVZA 2X4TB 4MGXA 4MNGA 4DQOL 3CVHH 4MWFA 1ZXQA 2EDTA 2MOVA 1HI6B 35C8L 4M7LH 1BFSA 4Z9KB 1A5FH 1NUFA 4MA3B 1WT5C 1JNHB 1ZANL 1DBML 3I6LE 2FJHA 3FB6B 3MA7A 4QGTA 2VL5B 2APFA 4KK8C 3X11A 1NL0L 4G7VH 4PG2C 1WEJH 4NQDD 1RMFH 3WUZA 5IBUG 4K23L 4DOHE 1AFVL 1IC4H 4BSVB 4JG1H 5DI8B 2IPTH 2YSSB 3W0WE 1XGTA 3Q0HA 4LHJB 2H2SC 3QIBD 1VFMA 3QB7C 4XVJL 4AQOA 5DYOB 2AI0L 4YHKH 5DJ8B 5JIHA 3FB5B 4JFOA 4JFHD 3BPOB 1NC2D 1FE8L 5CILH 1RUQL 5EU6D 4LLWB 3D85D 2DDQH 1REIA 4Y89A 2DL9A 3DO7A 4JFFD 3G5VA 4PJXF 5GJSL 4OIAA 4I18A 5C0IB 2LTQC 3DECA 3P0YH 3IFPA 2H26A 1KENL 3VFSA 1FNLA 4GAJL 1E0OB 1NFIB 2NX5D 4UT7H 2Q3ZA 5KS9F 4Q6IC 2IFGA 1BBDL 1ORSA 1A21A 32C2A 3DGGA 3VXSD 8CGTA 1UQSA 3Q48A 3MLPA 2GIYA 2X42A 4OD3H 5I1KL 2FBJH 3GJFB 5FGBC 5I74C 3QI9A 3V4VH 5F97E 3BKML 1PBYA 5IB3B 3GI9H 1MVUA 4X6EB 3SGDH 5BV7B 3QCUL 3H0TA 1XCQA 3UJJL 4CVXB 1I8KA 4C59B 2XNAA 3I3BA 2YWZA 3BKYH 4LEOB 1EJOL 3T8XB 2D4DA 3H9SA 2IAMD 2X41A 3ES6A 3HCVA 3C60A 5C0EA 1ZHNA 1VADB 3FHAA 3EOTH 1P6FA 3ARQA 5C70A 1U8OB 5GRVK 3LB6C 1NC4D 3MRJB 1BEYL 1S9WA 4GUPB 3NN8B 1KXTB 1CFQA 4FQXC 4HKZA 2E6PA 1G7JA 5F7LB 1RUML 1O7VA 1Q9KA 4PRPA 1MJUL 1BJ8A 1V7ML 2UY7A 5HHPA 3HG1D 2ZUSA 4HJJH 2ZOLA 3QUYC 2ZOKA 4HIJA 3GBNL 1UVQB 1O5DT 2WBWB 2Z8VC 3QFDB 4C54A 4HW6A 3RGHA 4HIEA 4LCUA 2R39A 3SGDI 4G6ML 3ZKQD 3MNVB 5EC2A 4Z95L 3ZKXB 3SDAD 4PJBF 2MQ3A 3RGVD 3KYOB 1DFBL 3F5WA 1CD9B 5JNYB 3VWJC 5C07A 3U0PA 5HHVH 1N8ZA 1VGKA 4U05A 5A2LH 2X4RA 1ADQL 3CVIL 3F7QA 5D2LB 3F12A 5TE6H 3SKNA 1T20A 2CDEB 3TV3H 1KTRL 4DFHA 5F7MC 2Z8SA 4IHOA 3T0VA 4XXCA 4WFHD 4NZUL 1JK8B 1KV3A 3HPJA 5LAXA 3MLTA 4JHAH 5ISZD 3LN9A 1LE5A 5FYLE 5A3IC 1YEKL 3FB8A 3VU2A 1TIUA 4JLRA 4R3SB 4KJPC 4NZTL 3D3VE 1BD2B 4I0PB 3GMRA 1J1XH 3OKKA 4B7LA 2FH8A 3OWEA 1E4WH 4HGMA 3EYVA 3TPKA 3QWRD 2YBRB 4HMEA 1HILB 2HKFH 1T2QH 4L3CB 4P2OD 3X12A 3S37X 2H6PA 4LRNL 4HBCH 1N3NB 1HI6A 5FYJH 1J0ZA 1JTTA 4X6CE 3GSNB 4PJEB 2BC4A 1N6QL 4X5LA 4MA3A 2AEQL 2HFTA 5GRJH 1DUZA 4OBRA 4QHLB 4A6YL 4S0TD 5JLZA 1CFBA 1DSFL 3FB6A 5IFJB 2LQRA 1T0NB 3IDGA 4E5XB 3K1DA 3WLBB 4M7ZB 1IGYB 5D9SA 3DSFH 2G60H 2AK1H 2UWEB 1AQKH 4XPBH 1KCUH 3IXAB 3N9GL 1EV2E 5DQJB 1LEGA 2AQ2A 3SGJA 4FQPA 4C56B 2EC8A 4BSVA 5DI8A 4EBQL 4KZDL 2E5EA 2YSSA 3WXVH 4PJCB 4JQXC 3RZCA 5IESL 4PB0H 4GMSL 4PRAB 4Z0BL 1I85C 3O2VH 5D71L 2FEDD 4XP4L 2IADB 4ELKA 2LU7A 4LCYB 3ZDZE 3Q6FA 5HGAA 3V4UH 1YY8B 3BZDA 1F4YH 1F4WH 1Z5LB 4P0DA 4RQQB 4JPWH 1IE5A 3GSWB 1K5NA 4OCSL 2DQJH 4LLWA 4X8XA 4GG6E 3SKUD 2OR7A 1F2XK 4PJIB 3JBG7 3OJ2C 5IHLB 2DLTA 3IF1B 1IKNC 4W68A 3WNOA 3ZMRA 1Z9OA 3Q5TA 1SY6L 1JPFB 3C9NA 3P4LA 5IGXH 1CD8A 4X80H 5GZND 5JA8B 2XXCB 2HFEB 1YECL 3VD4A 1QHPA 3O41B 5SWSB 2IBBA 4N0UE 3SCMC 2FL5B 3AY4C 3GJFA 1IFHH 3AB0C 3HZMB 2X1OA 3NZHH 1DTUA 4DVRH 1S7TB 5L7XH 1GGCL 1LO3L 2EYSB 3EJYC 4U7MA 1WZKA 2WQRA 3DV6B 1FC1A 4XB7A 1F4HA 1IEBB 3F7VB 4Q9BA 3SBWA 2DQIL 4Z7UE 3IKCA 3LV3B 2B1AL 1YEEL 4ONHB 1LQSR 3G6JE 4LEOA 3O6FB 4ZFZA 3VXOA 1CQKA 3T8XA 1QACA 3UC0L 3FFDB 1MH5B 1N64L 3K2UH 3TEUA 3O45B 4FQHA 4UV4L 3FN3A 4GUPA 3IRZA 3NN8A 2X4PB 3D9AH 1BAFH 2J8UE 4WI8A 3O4LB 2AJXL 4TUKL 3TPUB 1HNGA 4LCWE 1D5ZA 3T1FB 1A14L 4FABL 2FSEA 4XC1L 5BZWB 4KPHL 1QHOA 1RZKH 3K8LA 5DD1H 3S34L 4L3ED 1IGTB 1MCWM 5GGRA 4LK4A 3IFOA 5F1IB 4FQ2H 5LQBH 1D9KB 2YWYA 2ZPKL 4D9LH 2ESVE 2AGJH 3CDGA 3MNVA 1QP1A 2VXUH 3GRWL 1P4LA 3V79C 1YJDH 1OAXH 1H15A 3KYOA 4PG9B 1QPPA 1IAMA 2R0KH 1QSFE 4XT1C 2CDEA 2E6JA 1QSVA 2EH8H 1MREH 1FPTH 4GT7A 1K85A 3K1KC 2CDFA 4YHIB 2VH5H 5FGRA 5C08B 2DQDL 3G6AB 5GHWH 3QQ4A 4I0PA 2Y9RT 4KFZC 2BSRA 4OCMC 3GK8L 3QIWB 1ZK9A 5CS7A 4HF5L 2ENSA 2XKSA 5A2IH 4FQQB 3CLFH 2VL4A 1HILA 1KNOB 4CRPA 3DHJA 3QSKB 3PP4H 4L3CA 4K2UL 2K9UA 1H0DB 4D3CH 2VQ1A 2VJXA 5JXEC 1FNSH 4LVNB 5DK3A 3GSNA 5CGTA 3E3QC 3MRGB 3RWEB 4O2EB 1DBKL 4JDZA 1OAQH 1WZLA 5E2UL 3WIHH 3ARSA 4QHLA 1C7SA 2YUVA 5IFJA 4H20H 3GBMH 4OZFH 5IVXF 3RVTC 3S36L 1QA9A 2W65B 4X6DE 3BO8B 2OTWB 1IGYA 1J0JA 4OFIA 4OLVL 4AQ1B 3WMSA 2CO6B 4BKLB 3MRNB 25C8H 3FTGB 5JHDE 2ZSVB 3IXAA 2FATL 1AGEB 4I4WA 4PJCA 4F33A 4KDVA 3MV9D 5DJYA 3MXWH 3RY6C 2IADA 1OTTC 4QHKJ 1H3PL 3GNMH 4RWYL 4H0IA 1TETL 4LCYA 2QQLL 3MRFB 3ILQD 4OCXL 1YY8A 3FN0H 2ITCB 3BKJL 1HDMA 1Z5LA 5CKGA 3M1BB 2IAMC 3GSWA 3O2DL 3UYRL 4HAFA 1F8TL 4GRLD 4WUKH 5EA0H 2Y06H 1T22A 3IF1A 3IDJB 2FB4H 4ODUB 1CFSB 2D0HA 5EOCL 3V6FA 5I8EB 5FK9A 2HFEA 3KXFD 3HI1A 3O41A 2J3SA 4I9WE 1AXIB 1F4AA 1UH2A 4Q6YA 3NABL 5SWSA 5A16A 4G8IB 2ATKB 3KG5A 2DWEA 1A7QL 2FL5A 5KVMC 2VDKL 2BRRH 2ICWB 2EYSA 3DV6A 1PAMA 1M05B 4HD9A 5BW7A 3F7VA 3KPRE 5E8EB 3RWFB 1IBGH 3ULVE 1F58L 4P5MA 4JZNB 3FFDA 5JPNA 2XTJC 1MH5A 4KROD 1LGVA 4LHUD 3IDYB 1S9XB 3O45A 2CXGA 5IEHB 2QQQA 2BHZA 1SMOA 3QA3A 4WHYH 3HE7D 1CTNA 1BZ7A 3EIFA 5HHME 4MA7H 4ZFOB 1E4KA 1I9JL 3O4LA 4R0LA 5D1QC 3REWB 5DDHB 3AU1B 3O6LH 1CLYL 2UUDH 3VGBA 2P7TB 3B4NA 5GGQL 1DZBA 1Y18A 2X6MA 4FQJH 4ONOA 4J1UB 5C09D 5I0ZA 2AP2A 1IGTA 4GKNB 1ZHKB 5FKAB 2BVEA 2NMSA 5F1IA 3P0VH 4G42B 5EZJB 4OSUL 2VXSL 1QQDB 1MHHB 4OCWH 1D9KA 4P2OC 4OBSA 5F89B 1LO0H 3EGSB 2F8XC 1N4XH 1ZAGA 4CUCA 3W9EB 2M26A 3CCHB 1JWSB 4OV6F 4XWOC 1RZ7H 1E28A 5F9JA 1ZEAL 4G6KH 4MXWH 3VXUE 1VEOA 3GMQB 1DEEB 3LS4H 5GRVL 4YHIA 2CIKA 3GFUA 4XTRD 5I18H 4RRPG 3G6AA 3TWCH 5GS0L 5CGYC 1X5YA 4O5LH 4Q0XH 1BQHB 3QIWA 2JJWA 1H3WM 3KPMB 2SEBB 1KNOA 4IMKA 1MELA 2X44D 4WI6A 4NGHH 5J13C 1OP3K 5L6YH 5TDPA 5JQ6L 4XP5L 5FA3A 2HP4A 2WK2A 5B21A 1QNZL 4JPVH 5T3ZH 2NLJA 3MRGA 2EYRA 4XVTL 4O2EA 3RWEA 4ERSH 1J0YA 1FO0B 1R5VB 5C0CB 1MCLA 2QTEA 3CPLB 5MENE 3HAEG 2OTWA 5DHYB 1MCCA 5AWNL 1ZGLM 1CT8A 4QXGL 4F7MB 4BKLA 3W39B 3PXJA 3FTGA 5IEKB 1NEZA 3MYZA 2Z31D 3LHPL 1NMCB 1U6AL 1OSPL 2FLBT 2VDNL 1NAKH 4EVNA 5FO9B 3ULVC 4OD2B 1IC5H 3LQZB 4OCRL 1HH9A 4WFGD 4O58H 5D7LB 5EIQA 1IARB 4X6CF 1UYWL 5D1ZD 5IW6A 1I1CA 3MRFA 4JB9L 3VFRB 5C0GA 2ITCA 1B88A 3BGAA 1MCQA 3IDNA 1T1ZA 5LWYL 3M8OH 2DLGA 2DKSA 1U2CA 3RWJA 3OAUL 5F9OH 3CZJA 4JR9H 5JW4R 3EYOB 4NHUB 3IDJA 1BQHG 1CFSA 4PB9H 4LBEB 4OM0L 2PYED 1M7IB 2JJSA 5DJ0A 3DXAB 1MIML 4DKFH 3BDYH 1L6XA 4XNQB 3MXVL 2J5LB 1R24A 3RBSA 3UZQA 1NKRA 3INUH 1I1YB 3D0LA 3WNMA 3GIZL 1ZVSB 3ZDZF 5ILTL 4N68A 1R5IB 2QR0B 2ICWA 1A6VH 4KY1L 1DUYA 4X9BA 2YD4A 4W6WB 4GG6F 3QG6B 1C7TA 4GH7B 1AJ7L 1VENA 3L5XH 5EZOH 5E8EA 2FRGP 5D2NB 4HGKC 3S37L 3QUZC 4LRIA 3PWPA 2BFVH 4JZNA 3UDWC 3P9LB 3MRQB 1HHGB 1S9XA 1XCTA 2BDNH 5IEHA 3L3HA 3QDMD 4OGAC 4HUWB 1D7FA 2DD8H 3ZDXF 2HVJB 2CLVA 4ODWA 4XZUB 4ZFOA 4LKXA 3ZKSD 3N1QC 1T6VN 2AJYL 3NGBC 4PGEB 3MLZH 3AU1A 3LS5L 2P7TA 1J8HE 3AREB 1P2CB 3QFJB 4QYOA 3SDCD 1WBXA 2E7LC 2BK8A 3S4SB 4J1UA 5JR1L 2AK4E 5E7FA 3MSPA 3FRPG 4GKNA 4R2GB 1MY7A 5FKAA 4Z7UF 4ODVL 1NGPL 2P5WE 3MRRB 3RDTD 3DV4A 4Y5VB 4G42A 4JJHA 4HK3N 3VMNA 1R5WA 1JFQL 1QQDA 3HMWH 4FQIL 3ARWA 3SJVD 3WHE1 1YEFL 3HAEA 5BJTB 3MODH 1P1ZA 5T3XE 1OGAB 1KN4L 1DQDL 3W9EA 4ZNEA 1X5ZA 1AQDA 4OD1H 5DRZB 2V7NB 3CCHA 4K3DH 2J8UF 1JWSA 3VFGH 1P7QD 1NBVH 4U6VL 4NC2B 4M9PA 1BHGA 3P0YL 1MCDA 5C0FB 2XZAL 5I1CH 4Y2DB 5I1LA 3DGCR 1FAKT 3WIIL 5DUMH 4RGNE 2KUTA 3JUYA 5CEZH 4M7KH 4NQUA 1IAIL 2MCG1 2VRAA 5HGDA 3U4BH 1VEPA 2F53D 4QHMA 1MHEB 3GSOB 4WI9A 5DJAB 1MLBB 3GMQA 1DEEA 1FGVH 3DARA 3ARGC 4H0HB 4FNLL 1FFQA 3DYPA 1F6LL 3HA0A 4Y4FB 4V1DD 2HTLD 4P2RA 2YUZA 1BJ1H 4UBDD 1MHCB 2YHGA 4WNQB 1BQHA 4Y5XB 3ILQC 3KPMA 2OXGA 1T5WB 2CDGB 2NW3A 2SEBA 4DAGH 2F54D 2AJVH 2EDXA 4MNQD 3VXTB 1FYTB 5LG1A 1HKFA 4MAUH 5EPMB 3S4SG 3MV8D 3GHEH 3HE6B 4IRZH 5HHXH 4UTAH 1EEZB 1CICB 5F96H 3VXQB 4X9FA 2NY3B 1FO0A 1R5VA 3EOAA 2Y36L 3H8NA 5DRXB 3CPLA 1NBZB 3O0RH 4HKXA 2E6QA 1KPRB 4RNRB 1MQ8A 4FTVB 1WZ1L 4PJGB 3P11L 3TVMD 2VSCA 1EX0A 2FHFA 2HT2D 3NOIA 1BFOB 1PW3A 2W59A 2E9IA 3MOAH 4K3EL 4KHTH 1E6JH 2ADGB 1HOCA 3SOBL 1FFOB 1GGBL 1ZWIB 5FO9A 4Z7QE 4GQ9H 5DSCB 4OD2A 5K9OB 3LPWA 3LQZA 3UZVB 3OX8B 3O4OB 3LEYL 3RKPA 3KPSE 2VUYA 1YDPB 4XC3H 3KS0J 1WITA 3F7PC 4X0KB 1YMMD 1BX2A 4LF3A 4P48A 4KROC 1MUJB 4P3WA 4KJWD 3LKOB 4JFQB 1FFPB 4X6DF 5CZVH 3FRPA 4JN2B 4W70A 5SWZB 1TJHH 4RFEA 5HHVL 4G6FD 3IVKB 1FNAA 3EYOA 4RFNB 3OAZH 3VI4E 1DVFC 3V4PL 3VWKB 5C0NC 5ITBH 5K9KB 3VXME 4OFDA 2NY0D 2YMXH 3TV3L 4M5ZH 2CPCA 4LBEA 5GGSB 1ZLSH 2VR4A 1ZGLB 2OP4L 5L8LB 2EXWC 3DXAA 5H94A 5J8OA 4JHAL 4XCYB 4XNQA 1FV1B 5D7SH 4DKEL 1NJ9A 2MQ0A 3D2UD 3H3PH 4XPGH 3UPRA 1ZVSA 2IANB 1R5IA 5E6IB 4GW5A 4MQ7B 1G9NH 1NQBA 3ARFB 1CS6A 2ZG1A 4U1NA 2GEEA 1MCPH 3I6LD 4FZ8L 1I7UB 3LPGA 3ZHDA 4H26B 1X5GA 1PVHA 4HKBB 4L8SC 5D2NA 4TVPE 4XPHH 1EHXA 4HBCL 4DKDC 3MRQA 1Z9LA 5CUSH 3ARDB 2QSTA 1WBZB 2GKIA 2J4WL 4JCMA 1CDBA 3TP4A 1NGXA 1OGTB 4P5TB 2EXYC 4XP6H 5HGBB 3B9KA 5CWSA 3S4SA 1GXEA 4M7LT 1F45A 3KHOA 3DYMA 3RI5F 3GMNB 4DW2L 5BOPA 1A3QA 4ZYKB 4M8QA 3ULVF 4IDJL 1KACB 2DIJA 1UH3A 3RWDB 4XPTH 3VFOB 3DX7B 2WWMD 4G43B 5FGCB 1U93B 2C4FT 5A40E 5BJTA 3JWDL 1UA6L 1MCIA 3MRKB 5D6DA 3GMMB 1OGAA 5J9PB 4HWBA 3PWVB 2AQ1A 5IOPA 5F70A 2W07A 1DBJH 2V7NA 3KPOB 4GAFB 3RNQB 3J8F7 1A9BB 4QTHB 2FIRT 2X09A 4ODSL 4Y2DA 3S96B 1CF8H 4MJIE 3UBXG 4HS8L 5DMYA 2YD8A 2Z31C 3P77B 4MS8C 1MHEA 3L5JA 5HVGB 2CJUH 2YK1H 5F1NA 4AEEA 4M1CD 2Q7NA 3RI5K 4IMLA 2BY2A 2H3NA 4ONGH 4Y88A 2VKWA 3NZHL 1JTOA 5J57B 4Y4FA 1SYVA 5EO9A 1INEL 1MHCA 5D1ZC 4RIRA 4JFYB 4Y5XA 1T5WA 4KI1A 4YXLL 4PJ8A 3O2WL 5T3XH 1XGPA 5EPMA 5HYJE 4S1QL 2Y4SA 2ZZUT 1JPSL 2I5YH 3HE6A 2GY7B 5IT2L 4OF3A 1EEZA 1CICA 3GJFH 2BNUB 3T2PA 3QO1A 3SGKC 5TFSL 1HH6B 4PRNA 5DRXA 2QSCL 1NBZA 3D9AL 5SX4H 3BMWA 4JHWL 5C6WH 1BAFL 4LFHG 4HDIA 3U9PL 2A9ML 5M95B 4RNRA 4FTVA 1MFCL 5F7WC 1KLGB 2VABB 4RMRA 3T1WA 3KYNB 5C0DA 4ELMB 3ISWA 1RZKL 3NZ8B 5DD1L 2AJSL 1IQWH 1LD9B 5EZLB 4HAGA 3GJEB 2YKLH 4BH8B 5DMIH 2DQFB 4U0RC 1V7NL 3C8DA 4MJ6B 4G5ZL 4RFOH 5M7QA 4GRMB 1BFVL 3OX8A 1LE9B 4QRRB 3W9DB 5J11C 5LQBL 4NFCA 2IJ0C 2J8HA 3EYUH 1YDPA 2WWKT 3L5WB 1EFXB 2HRLA 5E99H 4Y16D 5ACLA 4X0KA 3DRTB 2KQMA 1NAML 1D5IL 2YS4A 1L9NA 4LEXL 1LO2H 1PG7X 1FFPA 5I16B 3TYFA 4GKOA 4JN2A 5SWZA 1JI1A 3IVKA 1M6OB 1Q1JH 1WAAA 1Q9WB 4TVSa 4OIBA 1BQLL 2W60A 2R0KL 5K9KA 1KEML 5SX4I 4JRYB 1NLDL 1ZVHA 4P99A 3SDCC 4YPGA 3MPCA 1MREL 4P23C 5J56B 3BIKB 5IB4B 1UXSB 5JW4Q 1MFBH 5HI5D 3QJHB 1OF2B 2VWEE 4G9FA 5E8NB 1X6LA 4LAJH 3P4OB 5E6IA 1EMTL 2ZJSH 2R0LH 3DX6A 3ARFA 5TDNB 4FFZL 1KXQE 3UBXA 1I7UA 4GW1B 2VB5A 4AEFA 4DGVL 4H26A 2WUCL 3N85L 3B9DA 4HKBA 4ZODA 1PKOA 4KK6C 4N9OB 2H8PB 4NO2B 5EUOA 3IS1X 4UOW0 1I7RA 12E8H 2WBJB 4TPRL 4UIKH 3DUSB 1F42A 3MRPB 2O5XL 2N56A 3QCVL 1I8MB 1OGTA 1MFDH 1C16B 4K71C 1KTLA 25C8L 5IFAL 4P5TA 1J87A 4MLIA 4HFUH 1ZOXA 1KPVB 2AAVA 3RAJL 1U41A 5LGHL 3GSNH 3W5MA 5FYLL 1BIIA 1EAJA 2DF3A 3L3IB 1BOGB 3MBEA 2HTLC 1RFDH 1EXUB 4ZYKA 3CFDB 4UBDC 4EIGB 2PW2A 4H5SB 1FGNH 43C9A 4UTBH 4ZSOB 1CGUA 1L7TH 3AAZA 3VFOA 1JF1B 5FB8A 1U93A 3HZVB 3TBYB 3FN0L 5AYUH 1RU9H 3FT4A 3P73A 3RUGA 4IDLA 5KOVC 5HVHC 2EC9U 2IBZY 3RVUD 3KPOA 5EA0L 5TH2B 5TQ0H 3RNQA 5BRZA 2QBWA 4PV8B 5GGSY 2DQGH 4CNIB 4J3WA 4OLUH 5AG8A 3S96A 3BZEB 2NXZD 4ZXBC 2OMNA 5BQ7B 2VLJD 4EDXB 2HT2C 3HKFA 5D8JL 3VD9A 1PZ5A 3P77A 4QHUB 4Y1AD 4NQSB 3ULSB 3RTQC 2IQ9L 4NN7C 5B8CA 4GRWB 4JO2L 2F19H 2BRRL 4UDUB 3ZZ1A 4XWGL 2XZCH 5DHVB 3C08L 5F8QC 5D72L 2BP3A 3TN0C 2WZPD 4LSQH 3C6LB 4KJWC 4M3KB 5MP6L 1DN0B 2BNQE 3C5ZD 1U36A 4LCWD 5GRUH 3JVGC 5IJKA 4HLZG 4Y5YA 3DLQR 5EO0A 2HWZH 2RR3A 1ITCA 3SKOB 4OFKA 1HH6A 2Q76B 4TUJB 2R9HD 2W9LA 2R8SH 3SE8H 5BOZG 4WI5A 1KLGA 2VABA 5D96C 1EZVY 5L0QB 2A6KB 3KYNA 2BHYA 2WLZA 3QG7H 4J7RA 1LD9A 2YUWA 4Y4KC 2BVQB 5C0BA 4BH8A 1YZZA 1EO8L 2DQFA 3TIEB 1UB5B 5D5MA 4LPCA 4GRMA 4NQDB 1XR8A 1D6VL 1Z9SA 3W9DA 4QRRA 4JQVA 1LO0L 4TRPL 5C6PB 3NCYS 4ZAKD 3L5WA 1EFXA 4CVWA 1N4XL 3BXNB 1B4JL 3QIBB 5JW3H 3M17B 3TJEH 2NY7H 3S5LA 4YDJB 4LPTA 2W0LA 9CGTA 5E56A 4P2RE 5ERWB 4OT1L 5TE4H 2CGRH 1M6OA 1Q9WA 1EERB 3O11A 4YIQA 3GDBA 4O00A 4OLZH 3FQXB 5BO1H 3HUJE 3F8UB 4G6KL 5EU6B 1AHWC 2HFFA 5AG9A 3N50A 4JRYA 3BN9D 4MXWL 2R1YB 4Z8FL 4JFFB 4O02L 4Z7QF 4I3SH 4PUBH 3I02B 3K46A 3BIKA 3LQMA 5IB4A 1UXSA 4PRIB 3C5SA 4MA8L 1OD9A 2NX5B 3LQAH 1KJ3L 1J10A 4QRQA 1F90H 4F2MB 2B0SL 2E8YA 3QJHA 4JM2A 4IOFC 4ISVB 5C3TA 1KCSL 2DQHL 3MROA 2GK0B 4R4FH 3VXSB 4Q0XL 2WWMC 5TDNA 4LIQH 4YR6B 1L0XA 3T0EE 3EOBB 2ICES 4HQQH 1H5BC 4GW1A 1RZFH 4XAKE 4EDWH 5J6HB 1WJ3A 3LKPB 1X5LA 2H8PA 3OAYH 4NO2A 3EKCA 2F5BH 2D7NA 4K55A 4ERSL 3WXWL 2DM4A 5MEOB 3DUSA 2VLRE 1DQQA 5I1GH 1TQCC 3TLRA 3PGCB 4PYGA 2VZUA 3UXFA 4B7IA 4N8PA 1C16A 4G9DB 4NO0A 4N8VB 3KPLB 1NC4B 5JORB 4M3JA 3DTXB 5GRYA 4M8VA 4OIIL 5ID0A 3L3IA 1N6VA 3N1PC 4KMTH 1JI2A 3CFDA 3BKCL 4FQLH 1XZ0A 1SQ2N 3EDDA 3MRMB 4O58L 1JF1A 3MRHB 3HC0A 3HG1B 3TBYA 2XIDA 5I1HL 3RJDA 3WJJC 1CGVA 7FABH 5I71B 1SBSH 5DD0L 3PIQB 4WGVB 3N0PB 3Q3GB 5TH2A 4CJ1A 1IZJA 4A6YB 4JR9L 2Q8AH 1DL7L 4NQCB 4KQ4L 4JZJA 1U95B 5C6TH 1ZT7B 2R2BB 3BZEA 1V3MA 3K4AA 1RURH 3SDAB 2B2XH 5IBTL 1OB1B 4OZGB 4PTTA 3IS0X 1CFTA 3RGVB 3LN5B 2VSDA 4TSAL 4QHUA 5AD0A 1AGCA 3ULSA 1NCBH 3FO0H 3O3AB 4D9QE 5HD8D 2NNAB 4P46C 3STLA 1S9YB 2IPUG 4UDUA 5DZLA 1I1FB 5HGHA 2IMMA 1LILA 4AM0B 5DHVA 4JREB 5ISZB 1IAOB 5FIEA 3KPNB 2VLKB 2KH2B 1KC5H 5E2JA 4N8VG 4OZHB 4JN1L 4WW1B 4TULL 5DMKB 1SJVA 4NM8H 1KJVA 2XRAH 5JXAL 5DJ6A 4AG4H 5F7DB 2A6DB 2Q76A 3BFOA 2JF1A 4P2OB 2AEWA 4IIQC 3GSRB 2B4CL 4ZUWB 3MLZL 4ZTPL 3E1F1 3DIFB 3H42H 3JV5A 2A6KA 2GAZB 4LVOB 1ZSDB 3F6IA 4FQCL 1FDLL 4OLXL 1CXLA 1A6ZB 1KBGH 2NY5C 3QI9D 2VN7A 5IQ9B 2FJFA 1YEDB 4NQDA 2Q8BL 3ZL4L 3FN9A 1L9MA 1UZ6E 1OQOA 1BWMA 4NSKB 4NRZB 3S35L 3BXNA 5T1DH 3ULVL 1TMCB 5FF6A 1T7ZA 1YPZB 3M17A 1A64A 4YDJA 3H9SD 4O2FA 3C60D 1CE1L 1NGWB 1NFDB 5EULV 1KCVH 5I1CL 5JQHC 2EDNA 1AY1L 2FH6A 5DUML 5F8RC 5J12C 1A7RL 1GOGA 5EU6A 3HAEH 4BSJA 5KVEL 2R2EA 5EORL 1Q9LB 1XF5B 4A2MA 4G7YL 3IDMB 1UWEL 4PRPD 4GW4B 5TQ2H 4PRIA 1X4YA 5TE7H 1FH5L 5FFLA 4QRUB 2PO6C 4F2MA 3OL2A 4NJ9L 4ISVA 1CDHA 1QYGL 4J3SA 2GK0A 3VXSA 5E8PB 3PWJA 3R0NA 4YR6A 3EOBA 4I3GA 4X7SH 3AS3A 2C5DC 3V7AG 3VRIA 4Q9QL 4O51B 5HHXL 3HNSH 5F96L 1I7ZA 3K0WA 1WFUA 2BVYA 4X4YB 3TZVA 5I1AB 1ADQA 1I75A 2IALA 5JIPA 4JM4L 5E08L 4ESKA 2VE6B 3PGCA 1RIHH 3KR3H 2WANA 3NBNA 3ZKND 3PV6B 3BDBA 4NC0B 2PR4H 4WW2A 1OW0A 4G9DA 1K4DB 3QJFB 2NZ9D 3LD8C 4N8VA 1JV5B 3KPLA 5JORA 3DTXA 3H7BB 1E6JL 1ORQB 1FO0H 1FSKB 1NGYA 1JNNH 4L8CB 5LCVL 4CMMB 3LMJH 3N1MC 4L3EB 4J4PC 1WWAX 3MRHA 3UZEA 4KKNA 3W11D 3E6FA 3O9WD 1PSKL 5ESQA 2ICCA 4LSUL 4QXTB 2G2RB 2Q20A 4PJDE 5F1OB 1UEYA 3HZKB 5FKPB 1XIWC 4R4ND 5CZVL 4FN0A 2YEZB 1K2DB 1PG7L 3UX9B 2FJGA 5DJCA 2UZIL 4NQCA 3VJ6A 3QDGB 2R9HC 4Q97A 1U95A 1ZT7A 1IGML 4U1MA 3QXVA 2R2BA 3BP6A 4ZOAA 2FECL 1KJ2A 4NNYB 4YAQB 3Q6GL 4TOYL 5DFTA 1H8SA 3LN5A 3STBA 2LAGB 4UQ2B 4WCYH 4XHJD 2X70A 3UO1H 1OARH 3O3AA 4NDMA 5D7SL 5DRWA 3TT3H 1U8LB 2ATPB 4NN6C 5ID1A 3WSQH 1WFOA 3U0WL 1S9YA 1JUFB 1I1FA 1JZ4A 3RZCD 5DMJB 3OHXB 1DLFH 3AS0A 4Q2ZB 4D0BB 5DRNB 1JYVA 1MCPL 4AM0A 4GMTL 4PJHB 1IAOA 1K6QL 4EI5A 3KPNA 2VLKA 6FABH 4NKOB 3U2SA 2MNUA 1FIGH 2X1XR 4OZHA 3QUXD 4TQEH 1BFTA 1A7NH 2UVEA 5L8KB 4ODHH 2VISA 5D7IA 1QFUH 5DMKA 3AM8C 4DEPC 5E5MB 2Y5EA 2BCKB 4JRWA 1SY6A 4LDOB 3WS6A 3H2WA 4GXVH 2NQCA 5H37H 1IVLA 1FZOA 3CUPA 3GGWB 4TUOB 1A6AB 3PWNB 3TYGH 3GSRA 4H1LB 5ADOH 4WO4A 2GJ6E 1UKSA 4J3UA 5DJDA 1NMBH 1UG9A 3JV6B 1ZSDA 3VG9C 2XKNA 5T3XD 3PF2A 3PDGA 1ZS8B 2ZG2A 4N0YL 2I24N 4WU7B 5DHXB 4RMVA 2BSTB 2NW2B 1S7RA 1HEZA 2VC2H 2ZUYA 5IQ9A 4XPTL 4YHZL 5E9DE 1U8MB 1R3JB 1FVDB 3RL1B 1EEUA 1A7PH 2R69H 4MJ5A 3SQOL 4RA3A 1RJZB 3E0GA 4U49A 1FBIH 4NRZA 1MAJA 3MV9B 1RIUH 3PQYB 3ZKMC 2DTML 2HFGL 3KYAA 1CIUA 1B90A 3VXRA 1HSBB 1RZGB 1HINL 3PHQB 1NGWA 5MEPB 3OF6D 4MMZC 4MNHB 4RDQG 2JELH 4UDTB 3FFCB 1T21B 1C5BL 3D87B 1CGSH 5IW1B 1A3RL 4NUGH 4GRLB 1MCBA 4Y7MA 4HWBH 4IBLT 1JZ6A 1AE6H 2VDRH 1J5OL 1XF5A 3IDMA 4L4JA 4PJ7B 2EDKA 4GW4A 1QRKA 5E00B 2CUIA 1EDQA 4EN3C 1ACYL 3CIQA 1HHIB 1L0QA 1W8OA 1RIVL 4AH2A 3KXFB 1AH1A 3BQUA 4N1HB 4H1LG 2W0FB 2AV1A 2D0FA 1KPUA 2VDLL 1HQRB 3HZYB 3CMGA 3GRWA 5T3XL 1R3HB 4MSWB 5HHOA 1FVEB 5EWIL 1WSST 3HUJF 4I0KA 5EN2A 1KIPB 4Z0XB 4RISH 1TENA 1FAIH 3WL9B 2E7MA 1RVFH 4NQEE 4X4YA 5JZ7C 1KYOJ 1JF6A 2JJTA 4PJXB 3CC5B 3B9EA 2Z8RA 3PV6A 4MB3A 1MCOL 4KROB 1K4DA 4LHUB 4NKDB 3MLWL 3BWAB 5KS9B 3HPLA 3LEXB 5BVPH 3HE7B 1LEIB 3H7BA 4W6XB 4JO3L 3MLXL 3O3UN 1ORQA 5DEZA 2EE9A 2V7HB 1ZLVH 1YY9D 1F2QA 2YD1A 3BP7B 5KSBE 2LABA 5AAWA 5C0AE 4L3EA 5E99L 3DSNA 4I2XE 1OLLA 4JPIB 4KKBC 1A6PA 1G7HA 4JFPB 3BPNC 3QNZB 4QXTA 1NGQH 2D9CA 4TSCL 3HZKA 1KSRA 2IG2H 4QTIH 3K8MA 5FKPA 4LP4A 4JVWA 1K2DA 2NPLX 4I18C 1UM5L 4QCIB 2VXVH 1MFAL 1VFOA 3QDGA 5K9QG 5IBLD 3V6OE 4A2LA 4L9LB 4OZIB 3ULUH 2MHAB 4BH7A 1RK1B 4YAQA 2X4OA 5ECJE 1TTGA 3T0DA 2EKJA 2HTKC 4Q74A 1U8LA 2ATPA 3HI5H 2IFFH 2V9QA 2Y07H 3MLSL 3QI9C 3WFHB 1JUFA 2A38A 5E24E 4GG8B 5GISH 4WWKD 4D0BA 3NAAH 4P9HL 1DDHB 4PJHA 5IIEB 4NNXB 1JRHH 4RGMB 4WHCA 3O2DA 4NKOA 3TNMB 4LHUG 4RMWA 1KFAL 1NMAH 2EEAA 5LBSH 4PLNC 3HS0A 3C60C 3OKOB 2QADD 4QF1A 2ID5A 1S5HA 4MCYB 5E5MA 2BCKA 4ONFL 3HC3L 4PJBB 4TUOA 3MRDB 3QUMB 2JKXA 1RZIA 3PWNA 4H1LA 1HN1A 1MFDL 1IM9A 1UCBH 1OTUD 1NCNA 4PRHE 5E2TL 4XAWH 2VXQH 4M43H 4U1SB 1CN4A 2VR5A 4NOFA 1AR1D 5SWSD 1T7WA 3BPCB 5L2KE 5EG6C 1MNUL 5KAQF 5IG7A 3FZUD 4K8RL 4JCLA 3X3GL 4MB4A 1F5WA 5IHZB 1U8MA 1BM3H 1R3JA 2HKHL 3RL1A 4AMKH 5AUMB 1F4XH 1RJZA 1M7DB 2WUBH 4KV5E 3AUVA 3S97C 4X9GA 3NCFB 4QEGA 3WYRA 3MV9A 4L4TA 2FX8L 4TVPL 3W2DH 3PQYA 4ZD3L 5TQ0L 1D6EA 4J6RH 4R7DB 2WSKA 3ETBF 4X7EC 5JO5A 3SE3A 2N7BA 1RZGA 4NWUL 5FM5O 5I19H 1CLZL 5ENWB 3RHWF 1NCCL 3MYJA 3FFCA 4YLQT 1W2KT 3WIFB 4KTEH 1Q0XL 5IW1A 4KK5C 4MVBD 1B4RA 4XXCC 1FL3B 3UBXI 4M48H 1HQ4B 4P3DB 3RX8A 2NXYD 4K3JL 2VQTA 3TA3A 5E00A 3HMXL 2WP3T 3GKZA 4LQ1A 1UZ6F 4D0DB 5IFHH 1GC1L 1UM6L 1SJHB 2H2PD 2OTUB 2Y1VA 3PWUB 3MR9A 3DX9B 2W0FA 1AXTL 1MVFA 2X4QA 2IH1A 4NNPH 4LSQL 1D9KD 3BAEL 3QISA 4PIRF 1R3LB 3HZYA 4R4NC 4MSWA 1HCVA 4NO5B 1FVEA 4U0RB 2ZUVA 2VXTL 1KIPA 4Z0XA 2DRUA 4L8DB 3RHWK 5IQ7H 4BQCA 3WL9A 2AKRB 1IEAB 3FMGL 4RAVA 4HZLB 4PJXA 3CC5A 4JFXB 4YK4B 3S9DB 2CRMA 3QUKB 4QRPE 4RMQA 1Q0YH 1KB9K 4GQPH 1GOHA 3T77B 4LHUA 1YEGL 4KVCH 3QDMB 2ZSWB 3SGJC 5CEXA 5KS9A 3LKQB 4NKIH 3VW3L 1MEXL 2D7QA 3ROOA 3L3GB 2Z0BA 1A6TB 1EFQA 4KI5E 4HCRA 1P84K 3RKDC 3QIWD 1TJGH 3QNXB 1T1XB 4FXLA 4QGYA 3BPOC 3WS3A 1BD2E 3MLRL 1EBAA 1XF3B 4JPIA 5GRXG 1JZ2A 2QHRH 4JFPA 4PD4J 3QNZA 5E0QA 3U0TB 5HI4D 3TJEL 3U4EB 2NY7L 4RGOH 1EHLH 3RDTB 3F62A 3ESVF 1KCRL 3SJVB 2DLFH 1GZPB 4XPFH 4QCIA 1JHTB 4Z77B 4I48B 2XN9A 1QRNE 2GSGB 1KT2A 4UB0H 3O3DA 4L9LA 1ZHLA 4PJEE 4PRDB 2HJFB 4Y19B 5I6XB 1RK1A 2CUHA 3DYOA 2P24A 3T09A 3I85A 2VDQH 4I3SL 3VGDA 4PUBL 1P7QB 1BLNA 2UWEE 1I1RA 3V0WH 2ZCLL 3NA9H 1NANI 5DS8A 3DUHA 4ODBD 3WFHA 1FZJB 4GG8A 4HUVB 2JIXD 2F53B 5BV7C 4ZUSA 4PJDF 3SBWC 4HQQL 2J12B 4NNXA 4UUJB 2O61B 1J18A 4EDWL 3TNMA 1RAMA 3S7GA 2P8MB 5EO1B 5F7KC 4V1DB 1J0IA 4H8WH 2PNDA 3FOLA 4MCYA 3TH4T 2DI9A 4PTUB 1QVOB 1QFHA 4U3CA 1PX4A 2F54B 1JN6A 4KVNH 2OL3L 1KEGL 2V2XB 1W72L 4MNQB 5INCB 4PJBA 2HT4D 1AR2A 4YBQC 4EI6B 4BZ1L 4PJIE 1LVEA 1H3VA 3MV8B 2XPGA 1C08B 2I9TB 5I0DA 4DZBB 4LL9A 3QRGH 4HJ0D 4GAYA 4U1SA 1X7QB 4Z7WE 4PJ5E 4KRPD 5DLMH 3BPCA 4M6NH 2H32B 5CJXA 4FQLL 3OGCA 4JQIL 4QO1A 1G9MC 3TVMB 1CLCA 5IHZA 2CMRL 4OB5H 1UKQA 3V8OA 2FGZA 3GMLA 2VDMH 4GKZA 3EO9L 3HB3D 3ZKXC 2FR4A 4BJLA 5IMLA 2W9EH 3EDJA 1SYSA 4YGAB 1OTSC 3ZTNH 2HYMA 3PWPD 5IM7A 4HLZH 4NJAL 1OAUL 4OKVB 3BRFA 4R7NB 5ENWA 4X5XB 3RL2A 1YMMB 3WIFA 3IJSB 2GFBA 1D3CA 3DETD 2B5IB 4DQOH 1FL3A 1OAKH 2NYYD 1HQ4A 1DE4B 35C8H 4P3DA 4RWHA 2EKSB 5IVXB 2CRIA 3IAGC 3ZSTA 4G6FB 4KI5C 1VCAA 5I2IB 4R9HA 1MRFL 1ZANH 4ZS7L 5EU7C 2BNQD 1G1YA 2NY0B 4I0PC 1I4FA 5EFIB 4PGDB 1SJHA 2OTUA 1NL0H 5DR5L 3PWUA 3T0XA 2DQUL 4M6ML 4NRYB 3DX9A 1C8PA 5DQ9B 5L9DL 1HYRC 4OUUB 3D2UB 4K23H 1AFVH 1P9MA 5CSGA 5CBEB 1XGRB 4LLVB 3WFDL 3MO1B 5CJBA 1V3KA 4CN6A 2FDBP 4GRWH 1A47A 3D0VA 5IBLC 5F7UA 1CFVL 5HI3D 2BNRE 2F74B 4QT5A 4GO6B 2AI0H 4KKAC 2Q6WB 3SO3B 1P4IL 1IEAA 2VDOL 5DHVH 3DROB 4M7ZC 3L3DB 4QY8B 5GGVL 1FE8H 1HIML 3QUKA 3SDDA 1S78C 3CLEH 4YBLB 1U3YA 1U92B 3T77A 5ESVB 5E94A 2WWKO 2IGFL 3LKQA 5GJSH 2H9GB 4DGYL 1S5IL 4EXPX 1KENH 3DUUB 4GAJH 5EBMA 3L3GA 1A6TA 1MRDH 2K1MA 4CKVX 1BBDH 1VERA 1U3HB 3FO2B 4P2RD 2V2TB 1VKXB 5C08E 3RVXD 1J11A 1T1XA 3TBVA 3MMEB 3D6GA 5DD6A 2CK0H 3K8KA 1XF3A 3MX0A 5I1KH 3EW3B 3P9MB 3U0TA 3IJYB 3RDTA 1ED3A 2NTFB 3BKMH 2Z93A 3SJVA 4AK1A 3P9WB 4EXKA 4Z76B 5DK2B 1GZPA 1KCVL 1RULH 1JHTA 1JE6A 1K4CA 2EIEA 3P4NA 5CFHA 3QCUH 4HUNB 4DN4H 5FHBH 1H5BB 4PRDA 3L95B 1OTUC 1TJIL 4Y19A 3D18B 1EJOH 3UTSE 2R2CA 1PKQB 3QXDB 1P7QA 3T0ED 3MBXL 1QLFB 4N0FB 1WISA 1B0GA 4P9ML 4XNYL 5TQ2L 5KSBF 1WQVT 4XAKD 3GSQB 5DMGC 5FXCH 4PG2A 5EC1B 3TIDB 3FHQA 2ED9A 1ULVA 4UINL 3FAXA 1YC8A 4BSWB 1N59B 2YPLE 5BW7C 3MZGB 1RUMH 4U1LB 4UUJA 1U8JA 1MJUH 1V7MH 3O6FC 3IFNL 4KC3B 3Q2CA 1JGDB 4ZO6A 1Q72L 2P8MA 3GBNH 5EO1A 1CGYA 3TNNB 4PTUA 1QVOA 5T1LA 2AXGB 2F54A 2I60L 4R0LC 5C1MB 5J1TC 4G6MH 4XI5D 5JUEL 2HVKB 1C08A 4Z95H 2I9TA 1JGUL 1Z3GL 3U83A 1QFWI 1L0YA 1DFBH 3IJHA 2VIRB 5EOQL 5C0RL 2DQTL 1FORL 2H32A 4J2XA 4K7PL 2H2PC 3CVIH 1ADQH 3MNWB 1LK3L 4PJFB 4F7CB 2GSIA 3UJTH 3HRZB 1P5VA 3T4YA 3TBWB 3LMJL 5KVGL 1D9KC 4FG6C 2OSLA 1MCKA 1IT9L 5FV1L 2A74B 5DD5L 5FAAA 4L8BB 3SO5A 3MTRA 2D0GA 1YEKH 1TITA 5D7JB 5EB9A 5IHBA 4NZTH 1RUAH 5AZ2H 3OKDA 3DX8A 4P2QE 4OZFB 4R7NA 3RX5A 1Q8MA 3QH3A 4Y16B 1NGZB 2APTA 4X8JB 1YMMA 1QBLL 4UQ3B 3IJSA 1ES0B 2DMCA 2R4RH 5KTEL 4UAOB 4LRNH 4U6XA 4MAYD 1IL1B 5IVXA 4WCYL 2EKSA 2Y72A 3R1GL 5GIRB 4H0GA 1N6QH 4POZC 3B9KD 4KKCC 4PV9A 5DVLA 4Z78B 1DSFH 2IQAB 5EU4A 3HR5B 1UJTA 2W0KA 3D3VB 4KV5F 1QLRB 1OQXA 2ADJA 4U1GB 3QIWC 1KJ2H 3FB7B 2K7QA 1DBBL 4NRYA 2J6EL 5I1IL 4N1EA 4IOIB 4NBXB 4ZUVB 4OZ4B 3N9GH 5FO7B 4OUUA 2Y5TB 2GHWB 4UIMB 5CBEA 5KVFL 3VA2C 4LLVA 4EBQH 2EC9T 4LVNC 4KZDH 3QQ3A 1YYMH 5IESH 1LDPL 4Z0BH 1LNUB 3HI6L 4C83B 1JIBA 4XP4H 1GIGL 5T1MB 4NUJB 4D2NA 5CIPA 2Q6WA 3TYGL 5H35B 3DROA 2PXYD 4LVHB 5F3HB 4JKKA 4QY8A 4LGSB 4N90E 1WBYB 1BMGA 1JTPA 3VWJA 1KLUB 4OCSH 4L4TE 5ALBL 1IC7H 5ESVA 1BJ1J 4CVZB 2VLME 2H9GA 1GVIA 3VD3A 4H88L 5FGSA 3W0WA 4HG4K 1SY6H 2MSPA 4O9HL 4UNTA 5KSAB 4NO3A 4RAUB 3H9ZA 4RMUA 4Y4FD 2YD7A 2HRPL 3I75A 1B6DA 3FO2A 5FCSH 1U3HA 1VKXA 1YECH 1OWWA 3MMEA 3ZHKA 2QL1A 1FJ1A 1FBIL 3CH8A 4YDVA 2BOBB 3LZFL 4XCFL 3L9RB 4GG6B 1RI8A 4PJ8D 2KZ1B 1KB5L 3WN5B 3PGDA 3HE6D 1LO3H 4XRCA 1GCFA 4PP1D 1BZQK 3RPIB 2DI7A 2C4XA 4ENED 4KMLB 2IMNA 2XWJB 4ZFGL 5K33A 4POYA 3SE4A 5D2LF 2DQIH 3TC9A 2B1AH 1YEEH 3L95A 4NUGL 3D18A 4P5KA 8FABB 4XPAH 1SEQL 1DQLL 2JJSC 5C0CE 3KPTA 4HJ0C 1AE6L 3TH2T 1UT9A 3UC0H 3QXDA 1N64H 1QLFA 4N0UB 3U36B 2XICA 4KI5F 1G9EA 5JHLL 1NBYB 5D6CB 2NXZB 3OB8A 3IFLL 5EC1A 4ORZC 4UV4H 5DEFB 3TIDA 4WJ5B 5ETUA 2C3GA 2AJXH 4TUKH 5J3HD 3K74B 1T7YA 1N59A 1A14H 4Y1AB 4XC1H 2OK0L 1B6UA 4KPHH 4U1LA 2X89A 3Q1SL 3S34H 1I85A 3G6JB 5ANME 1NAMA 1JZ3A 2V2WA 3BUTA 3C5JB 3UPCA 3QZWB 5D7LE 4PJEF 1EEQA 3IDYC 3TNNA 4HIXL 5DJ2B 5BVJB 5KSVB 2AXGA 5HHNB 2R0ZH 2ZPKH 4ZMAT 3DETC 3KYKL 3VFUB 3C5ZB 4AIXA 4LCWB 2V5RA 1JZ5A 1Y6MR 5KBNC 2UWEF 1V8HA 3GRWH 2J1KA 4X6FB 1VPOL 4N0CC 1PYWB 1TFHA 3VE0A 2M2DA 2VZTA 3GSVA 1QZ1A 4S2SB 2XN9E 4JDTL 3HNVL 3LSOA 1ACZA 4YGVB 3KNBB 2E7BA 3HR6A 1PQZA 1G7LB 3MNWA 4F7CA 3ME0A 4OFYA 4G9FD 3HRZA 4JY6A 5E6ID 2R1XA 1TNNA 4FXKA 2E9BA 2RFXA 3VXPB 3MUZ1 4JKPL 3SCMA 3OJVC 3X17A 1QBMH 2A74A 4HC1L 4MYWB 4L8BA 1EO5A 2XQYK 1CDJA 2IG2L 2DQDH 5D7JA 3NCMA 4U1HB 4PJIF 5A1AA 3BD3A 3LKRB 4OI8A 3GK8H 2NZIA 1HE7A 4ZAKB 1PJ9A 1H9VA 4HF5H 1L4IA 1QSFB 5I8CB 3IDXL 5HGGS 4K2UH 3RIFF 3FT3A 4Z7WF 1ES0A 5DC4B 3VFPB 1IL1A 1A9EB 5GIRA 4P5TD 1U8PA 3QZWG 2MQCA 4JZOA 1DBKH 1GGIL 2Y07L 1QLEL 5CCKL 1EVTC 5E2UH 3ILPA 2YR3A 3S36H 3MBED 1A1MB 3D3VA 3QFJE 3QULB 3EZJB 1AXSA 3EUUA 2JCCE 4OLVH 3RVXC 3QEGL 3LDBB 4DVBA 2EH7H 5HPMB 4LFHD 2GQHA 4M62L 3DRQB 2JB5L 2N1KA 5FO7A 3O3BB 2Y5TA 4UIMA 1NMAL 3IU3B 1CXKA 2GJ6D 4X6CA 1J86A 3RU8H 3FO1B 3CH1A 2BSED 1LNUA 5IB2B 1W0VA 4C83A 1P4BL 5BRZD 1NCDL 5T1MA 3PNWB 4DFIA 2BOCB 4NUJA 1UM4L 5T5NF 4RWYH 2FLRT 1TETH 2QQLH 4X6DB 4X7TB 4OCXH 5F3HA 3BKJH 4OQ1A 1L7IL 1UCBL 2FO4B 3PGFL 2WINB 1WBYA 3O2DH 1KLUA 3UYRH 2GTWA 1F8TH 4N8CL 4HXBL 1JP5A 1NMCC 4CVZA 4HV8B 4G6AC 3RX7A 4JY4B 3QXAB 5DFWH 3V5HA 5EOCH 5KSAA 1CTOA 2XKUA 4RAUA 1TZHB 3G6DL 2DJUA 2W91A 4H1LH 2QSQA 1RZJL 3NABH 2BOBA 4P59L 2IBGA 3L9RA 1PY9A 1JGEB 1K8DB 3BJ91 4GG6A 4HMDA 3U82B 1A7QH 4K3HA 4KKLC 4LLYA 3WN5A 4AJ0A 2VDKH 4JGJA 2COQA 5IVZA 5I19L 1UB6B 4XNMB 1FYTE 3RPIA 2XWJA 2GITB 2BJML 5JXEA 4XXDB 4EEEA 4LP5A 1ZTXL 2C26A 4CN4A 4MNGB 1F58H 1C5CL 4M48L 3NMEA 2J5LC 3NACL 1CWVA 2D7PA 4L1HA 4N0UA 3VFTB 2FJHB 5D6CA 3V7MA 4HUXB 4PJGE 3MA7B 4YDKH 2HJKB 5C0BD 3QAZB 5IFHL 2CUMA 3C2SA 4WJ5A 3EYSH 3ZYIA 1WWCA 1I9JH 4HPYH 1M71A 5KJRL 1CLYH 3KPRB 4HJGB 4Z7UA 3I9GL 5GGQH 5DO2D 5I8OL 5D2NC 3MRIA 3ARBB 3QZWA 4ZOCA 5I66B 5E4IA 5IVNA 5E8OA 4JFDE 4LPXA 2VXSH 3O81A 1MCSA 5KSVA 5F7NC 3UAJD 5FDWB 4ZOBA 2XWTB 2J8UA 1J7VR 2FZ3B 4LCWA 1MY5A 4KRMB 1J05A 2OM5A 5CMAB 1GGUA 3AREC 3DO7B 4WV1B 4JGMA 1QSZA 4R2GC 1S7UB 3BESR 4S2SA 4YX2L 3VFSB 4MZ3A 3LEVL 4YGVA 3KNBA 1OL0A 4Y5VC 5I8KL 1G7LA 5FYKE 4JM2D 1IQDA 4ZDHA 1CG9B 3M45A 32C2B 3DGGB 4IRSB 1UQSB 3GZKA 3VGEA 1VB9A 5D6DC 1M4KA 4WGWB 2CIIA 1P69B 4OCYH 2ESVA 3LRSA 2QHRL 4F9PC 3VMPA 5ALCL 1EHLL 1L6ZA 1AIFA 3MCKB 3VCLB 1BJMA 4U1HA 1MVUB 3TO4A 2IC2A 2EIBA 3LKRA 5GS0H 1N2RA 5IVOA 3SY0B 4Y2DC 3RVWC 3H0TB 2H1PL 1XCQB 5T33L 2AXFB 1FNGA 4AEIH 1QSFA 4HCRH 2XNAB 5FYKU 4MJ4A 4YE4L 1G7PB 1BZ9A 2VDQL 2L7UA 3H9SB 5JQ6H 3ES6B 1I9RL 3VFPA 5C0EB 2C9AA 1QNZH 4NO0D 4YDIL 2EZ0C 1ZHNB 4XVTH 5D1QA 5C0JB 1TCRA 5ACMA 3S36X 1JHLL 4HKZB 4Y4FC 2P5EE 1BVZA 4LCIL 1AKJA 4Y5XC 5AWNH 1KCKA 4HH8A 4QXGH 1Q9KB 3CFCL 3DRQA 4UILL 5HHPB 3O3BA 4LLDB 2ZOLB 4S1DC 1MWAA 3LHPH 3IU3A 1U6AH 1IRAY 3HE6C 1OSPH 2VDNH 2QHLA 1CICC 3IETB 4OTXL 4QXUL 4PRHD 4ENEC 2APXA 4HIEB 3HLAB 2BOCA 3FQNA 3VA6A 3QYCA 4X6DA 4JB9H 2UVFA 5E7BA 5BZDB 4IRJD 1VGEL 5LWYH 5JHDA 4LU5H 2D4FA 5F9WB 5SX5K 3F5WB 1A1OA 3OAUH 2ENYA 2FEEI 4HV8A 1VGKB 1IGFL 2X4RB 3F12B 2VKXA 4OM0H 3O4OC 4IHOB 4KJQD 3ULUC 1TZHA 1E4XL 3EYFA 1MIMH 3B5TA 1OSZB 3MLTB 4E41E 1HZHL 4OV5B 3MXVH 2RBLA 2XG5A 4HS6B 3RJQB 1LE5B 2FO1A 3ARZA 4G80B 3BVNB 3OR6A 3FB8B 3GIZH 3OQ3B 1UADC 5ILTH 2YD9A 3GMRB 2PKDA 1UB6A 4KY1H 4RFNC 3C87A 5ESAA 3EYVB 3O9WB 4XXDA 1CU4L 1ETZA 1AJ7H 5GGUB 3X12B 1OAKL 2H6PB 2A9NL 1S8DB 3NPZB 3S37H 4YQXH 3BN3B 4IEFB 2BC4B 3QIUD 4YNYB 2EDLA 5IROC 1ZLUK 3VFTA 1DUZB 2MKWA 4J3TA 5C86A 5JLZB 4HUXA 4PLKD 5E03A 1BF2A 3PP3K 2HJKA 3IDGB 1PX3A 4ELME 5E6IC 3GO1L 3ARFC 2B1HL 5D9SB 3NFSL 1P7HL 5CAYB 2AJYH 3KPRA 3LS5H 1ZA6B 5LGJB 4HJGA 1ZV5A 4EZMA 4BYHA 3GM8A 4XBEH 1LEGB 5FUCC 1JYWA 2XG4A 3TF7C 5JR1H 3KLDA 3ARBA 1SM3L 3A67L 1D5MA 3OZ9L 3RZCB 4ODVH 3JTSA 5BV7L 5I66A 1NGPH 1OM3L 5GGTL 3ARDC 4ELKB 1JFQH 5AEAA 4FQIH 4FXGA 4CAGA 1YEFH 3Q6FB 5HGAB 5FDWA 1R0AL 4QHKI 2XWTA 5LVEA 3QUXB 2XT1B 1K5NB 1KN4H 2FZ3A 1DQDH 3CLEL 4P5TC 4K07A 1EH9A 5CMAA 4WV1A 1T04A 4PBXA 4U6VH 5EBLA 2GCYB 1S7UA 2XZAH 4PRID 3C9NB 3WIIH 1MRDL 4PP2B 1CG9A 4F7PA 1IAIH 2W38A 3MOBH 4IRSA 1QRND 4JVUA 2CK0L 1C5DA 2YXMA 3CX5J 3MCKA 4FNLH 2UYLB 3VCLA 3LPFA 3STZB 1RULL 4JANB 1UZ8B 4LSVL 3SY0A 4K94C 4DN4L 5FHBL 3TZVD 3WO4B 2AXFA 3IKCB 3WHXB 1JCKA 3X13A 1QFWL 1G7PA 1N7ML 2Z92B 3FL7A 4ZFZB 3VXOB 3VXUA 2VZSA 3B6SA 5C9JB 1UJ3B 2MFNA 4S11A 4FQHB 1HWGB 4LNVA 5C0JA 2Y36H 2BHUA 2DKMA 2KPNA 4ODXA 5DK0B 1CXHA 1UKTA 5EUKA 3QQ9C 4NZDA 4MHHI 5E4EB 1D5ZB 1WZ1H 4XVUD 1U9KA 5FYKH 2FSEB 3DVNB 3P11H 3U6RA 2FIKA 1IAII 1KTDB 1BQUA 4OCLC 3BE1L 1C1EL 2NTSP 4LLDA 2WIIB 5DC9B 4ZSOE 5GGRB 4K3EH 3B8SA 5IJKC 3IFOB 1SVZA 2I26N 3IETA 3SOBH 1GGBH 3G5XB 2E8ZA 3P40A 3CFEB 2CLRA 5D7KD 2PTVA 4GS7B 3HLAA 3LEYH 4NQCD 4PJ5D 5DEGA 4BQBA 3PWLB 4CADA 5MENA 3CDGB 5CP7B 3UPAA 2VUOA 2DIAA 5BZDA 1F6AA 3NFPB 1P4LB 5E1HB 1T6WA 1H15B 3KJ4B 3VXNA 2JCCF 4PLJD 5CD3A 5HYEA 1LHZA 3V4PH 3UJTL 3ECBA 4WUUE 4XP9L 1FL5A 3GI8L 2C1OA 2B7DT 4CN1A 2VDPL 3KVQA 3KPSB 2OP4H 1CD0A 4JQVC 1OSZA 5FV2A 4ZTOL 3WKMH 4OV5A 2BVOB 4HS6A 4KU1A 4EI5D 4EUPB 2CDFB 4EIZC 2VLKD 4G80A 5KW9H 4DKEH 3BVNA 2ICWJ 3WJLA 4Z7OE 2HLFC 3RA7L 1RUAL 5AZ2L 3L3OA 4UOJA 3QQ4B 2H32H 3IKKA 1NUDA 2BSRB 4QOKE 2WLYA 3LAFA 2HG5B 1T0MB 4ZQKA 5DZNA 3FRUA 4FZ8H 3B83A 2WP3O 3O9WA 1QSEE 1SMAA 5GGUA 2R4RL 2VQ1B 2YA0A 1S8DA 4WO4D 1CXIA 2RHEA 3OKLA 1F3JA 1XT5A 4RA0C 4YNYA 1KCLA 4H8WC 3MV7E 4JDZB 4JM2C 5DT1L 1U91B 1QA9B 2J4WH 4FOMA 4GOSA 4P4RA 4U1KA 3U1SH 5I9QB 4YFLF 1KJ2L 2JE8A 1ZA6A 5LGJA 4PS4H 1J1OH 1N26A 3I3DA 3CNKA 2P46B 4NZRL 4I4WB 1BQSA 1D5XB 1J1PL 1YYML 3CK0H 4F33B 1A3LH 1FNHA 4DW2H 5DJYB 3G04B 4WWKB 4XB8A 2YZ8A 4IDJH 2WBJC 1MCHA 3VXRD 3H9HB 3L7FB 1Y6KR 4K9EC 4WHTA 2Y25A 1Q94B 3JWDH 5FDYA 1UA6H 3BDXA 1HDMB 3QUXA 5IJVA 1CL7I 3MREA 2AVGA 4PJGF 2QADB 1CBVL 1CLOL 4GLRH 1J8HA 1P7KB 3L7EA 1IC7L 1QOKA 4JFHE 4EUPG 2P47B 3PHOA 2Q86A 2AXJA 1HYSD 1T22B 4NIKB 4XMPL 2AK4A 1II4E 4ETYA 1NEUA 2GCYA 4JFFE 4ODSH 3U7WL 4OAWB 2E7CA 1AO7A 2P8PA 2P5WA 3UEZA 3V6FB 5CIPH 1KOAA 4PP2A 3E3QE 5FK9B 4KUZL 4L5FL 1WF5A 4HS8H 2NX5E 3HI1B 3ZDXE 5B38B 3BQUD 3RP1A 1MI5E 5KN5B 5A16B 2DWEB 4HWUA 3VGAB 4ZO8A 4X83A 5JIKA 1MF2L 2UYLA 5HHOD 5CKAA 1DBAL 5DGRA 3UTSD 3STZA 4F57L 3UYOD 4JANA 1UZ8A 4L8SA 4LOUC 1INEH 4Y4HB 5F21B 4DCQB 5SV3A 2L4OA 5F88A 4MZ2A 3CFKA 3WHXA 1F6FB 4YXLH 4XPAL 2YD5A 1MSPA 4NRXB 3O2WH 2Z92A 3WNLA 4P5MB 4S1QH 4KDTA 1JPSH 4HUUA 2A2QT 5JPNB 5C9JA 4HFWA 1S7XA 1UJ3A 5IT2H 5J7CC 4GLRI 4UT6L 3OF6A 5JOFA 1HHKB 3OJDA 5DK0A 5DTFB 3QA3B 3BH8B 5TFSH 1BZ7B 2V5YA 1FZMB 2QSCH 1G1CA 4JHWH 3V9FA 1I3GL 4U6YB 4R0LB 1OCWH 3U9PH 2A9MH 2D2OA 1D5BA 1TVBB 1MFCH 4YUEL 3DURA 3DVNA 2NXYB 3SDYL 1AGFA 1Y18B 1KTDA 3C6LC 3R06B 4WWID 2AJSH 4KWUA 4XVSL 5HYJB 2WIIA 4LSTL 1LP9E 2GT9A 1V7NH 4G5ZH 1UWXK 1X4ZA 3HG1E 3SGEH 3G5XA 4NPYB 3CFEA 1DQJB 3TBTB 1BFVH 1CDIA 4GFTB 5HYQB 2R0ZL 3QDGD 4NM4H 2K7PA 3PWLA 3WBDA 2EO9A 4OF8A 5CP7A 5B38G 5DJXA 3NFPA 5L0QC 1NAMH 1D5IH 3JV0A 3C09B 4LEXH 4PLKC 3EFDL 1EA9C 4OZGE 4X5WB 5K9JL 4MD4B 1E28B 5F9JB 4HLJA 1BQLH 3B43A 1KEMH 2XTJE 1OP3H 4XBGA 2VMFA 4JY5H 1NLDH 4P2QD 5I1DA 1MJJB 3KPSA 5GS2H 1QBML 5C71A 4CMHB 1QEWA 2BVOA 2I9LA 4KAQH 4WFHE 4EUPA 2CIKB 3QIBC 5ISZE 4XNXL 3S98A 2HJLA 4MD5B 1J88A 1EMTH 3G5YB 2OL3B 4MMXC 2FX9L 3SGEI 1W72B 2HG5A 4L9DA 4FFZH 1T0MA 4ZO7A 1N0XL 5I15H 3THML 1VFUA 4AIOA 1R3IL 1UEMA 1UACL 3VXMA 4F3FA 3P2TA 4DGVH 2WQ8A 2WUCH 3KS0H 3N85H 3PABB 1W8NA 5TDPB 3SPVA 5FA3B 1YEJL 1IM9D 3T65B 4YXKL 2NLJB 2EYRB 2EDYA 2VOTA 4TPRH 3RFZC 4U1JA 3WNKA 2X1QA 2O5XH 1U91A 3FAWA 2DLHA 3MJ8B 3QCVH 4FQ1L 3BW9B 3EYQD 1CT8B 5GGRY 2EH7L 5IFAH 3U30B 2YXFA 4F58L 4X99A 1NEZB 3QT2A 2Y6SD 2LFGA 3RAJH 5IUSA 2P42B 4J8RA 5LGHH 5HDQL 1D5XA 4F8QA 4N90D 4UT9H 5FYLH 5ICXA 1OOAA 2AEIT 3RU8L 4EVNB 4L4TD 2JIXB 3G04A 3UYPA 3PQYD 4WWKA 1QBBA 2YPVL 1ITBB 1HH9B 4Z7VE 3H9HA 3L7FA 3UJIL 2VLMD 5IMKA 1Q94A 5IW6B 4KJYB 5C0GB 2R2HB 3IDNB 3FFCD 4QRSB 1HXMA 1TTUA 1T1ZB 1NFDE 5IB1A 4ELMF 3HTLX 1P7KA 3CFBA 3RWJB 2OI9B 4YDLB 3HMXA 4KTYA 3KLAA 2X9YA 1JPTL 3TA3D 3QDJA 4OAWA 4P23A 1PEWA 3OKNB 4LPYA 4BFGA 1CD1A 5DJ0B 5D8JH 4PY7B 4BQ9A 5B38A 1R24B 4KRPB 4JDVB 5I71C 5KN5A 2IQ9H 3D0LB 3CXHK 4JO2H 1CFNB 3T2NL 2EDJA 4OKDA 1DUYB 4XWGH 5JW4N 4Y4HA 4DZ8B 4DCQA 3C08H 4ZO9A 5D72H 4MJIA 3SDAC 5DUPL 5MP6H 1MQKH 2YPKB 4NRXA 1NEZG 4Y2OA 3RGVC 3PWPB 4PLJC 2DN7A 3AS2A 3GSXB 5TF1L 1XCTB 3IGAA 3L3HB 1I1AD 4NCC2 5KVDH 4YDKL 1HHKA 5DTFA 2GTZA 3BP5A 3BH8A 4S1RH 3GKWL 4L4VE 1FZMA 2CLVB 3EYSL 4ODWB 5GS0D 4LCCA 4LKXB 4U6YA 4HPYL 2P1YA 5SV4A 1TVBA 4JREC 3S6CA 2N7AA 4QYOB 3O8XD 1WBXB 3R06A 3UMTA 3TESA 4PGJA 3KJ6L 2BNQB 5HYJA 4IS6B 2IWGA 1EO8H 3WFZA 1HWHB 2DOCA 3FT2A 4KHXL 3DPBA 3DV4B 4NPYA 3SQBA 1DQJA 3K81A 3TBTA 1R5WB 3WS6C 2FGWL 1AI1H 1D6VH 5HYQA 1BVKB 1JGVL 3HAEB 2XN9D 1P1ZB 1ZMYA 4TRPH 3D39A 4G6JL 5LJYH 1AQDB 1B4JH 4O4YL 4LVOC 1XH3B 3ARXA 3L3KB 3UTQB 2MKLC 4OT1H 5FECA 5I1LB 4X5WA 4MD4A 3NIGE 1MAMH 1FLRL 3G08A 4AT6A 4MD0B 3RTQA 5HGDB 1MJJA 3SN6N 4Z8FH 2DICA 5IHUH 4O02H 4QHMB 4J12A 4KGLA 1JL8A 3EFFA 4OCYL 1V3LA 1EK3A 4IM8A 4MA8H 1KJ3H 4LPVA 4YZFE 2B0SH 3I84A 4PGCB 4MD5A 3U79A 1KCSH 4P2RB 2DQHH 2E27L 3G5YA 2OL3A 1DQML 1W72A 3ZHLA 2NW3B 4AEIL 3HUJB 4HCRL 1EVUA 2QQNH 4E42A 3G5ZA 3PABA 2D7OA 2P4AB 1X5JA 3LIZH 1E6OL 2VZVA 3I6GA 4MQXD 1G6VK 3T65A 2Y23A 2FEEL 4HIIB 3OPZL 5KSUA 1RJLA 3WXWH 5D1XA 3EOAB 3W5NA 5HDLA 4KK9D 5GZNC 4HKXB 1GRWA 1T4KB 4PJ9D 3NFNA 3MJ8A 5IP4A 2D7TL 2X4NB 3BW9A 3BQUC 2VN4A 4Z7OF 3T0EB 4RBPK 4G8FA 1DQTA 5DUBA 1CDGA 2K3TA 4OIIH 1HXYB 1HOCB 1JZ7A 2ZUUA 1HNFA 2JIXA 3AC0A 3NCCB 3BKCH 5CJOL 5EBWB 3BPLB 4QKXB 5E95B 5IKCA 5EIVA 2VLRB 1S7WA 3QDHA 2EEBA 3OKEB 1KGCD 4KJYA 3JWOL 3QEQE 5HY9B 5I1HH 2R2HA 4QRSA 1BX2B 4LF3B 5DD0H 4AYFA 1T7XA 4LU5L 1MWAH 5F44A 4OGXH 4RFEB 1DL7H 1TPXB 4KQ4H 3ALWA 1JNJA 1FSKC 1YEIL 5M94B 3OKNA 5C7XL 2A73B 4PJ7E 5IBTH 3GUTA 2V5MA 5H94B 3AS1A 4PY7A 4TSAH 4XX1E 4JDVA 1NJ9B 2NY2D 3UPRB 1IGCL 1U58A 2EO1A 4M03A 2ADIB 1CFNA 2A0LD 4GW5B 1U8KA 3FQUB 1EGJL 5GS1A 4U1NB 4JRXE 3PDDA 4LASH 4DZ8A 4FFWD 3W82A 1TVDA 4NP4L 4M93B 3TCLB 4OI9A 2YPKA 4JN1H 4M5YL 4YQXL 3DVFA 2Y7QA 1CXFA 1A6WL 3SDDD 3GSXA 4TULH 4U0QB 4G8GE 3L6FA 3KGRA 1Y0LB 4MDJA 4CU8A 4CVUA 5JXAH 4U3HA 2EDFA 4HHAA 1MFEL 1NGXB 1G84A 2B4CH 1BGXH 4MAYB 4JVPA 1I3VA 1B0WA 4KTDH 4ZTPH 4C55A 2ERJB 5IR1B 1O7SA 3OV6A 4XBEL 4GAGL 3B9KB 5CWSB 4FQCH 1FDLH 4OLXH 1I3UA 2BNQA 1OPGL 4IS6A 5ITFB 1FVCA 2VLLB 4M8QB 2O93L 1AO7E 2Q87A 5C09E 1CE6B 2Z9TA 4YHMH 2Q8BH 3ZL4H 1VDGA 5K93A 1BVKA 5F1KC 1F00I 4LLQA 1BF8A 4YC2B 1JPGA 3S35H 5FYKD 5CINL 4Y19D 5IOPB 1ZGLP 3ULVH 1XH3A 3L3KA 3UTQA 4OZIE 1CE1H 3SE9L 5H37G 4KK8D 2PXYB 4MDIB 1AY1H 2NY1B 1A7RH 5A2JH 4MD0A 5KVEH 3VFWA 3MOBL 1HHJB 1LP9F 1QPXA 1JHKL 1EAPA 5EORH 2PTTB 4P46A 4G7YH 1X44A 5F1NB 3QNYA 1UWEH 3B9AA 4IMLB 2H2SD 2H3NB 2ZCHH 1FH5H 4JPKL 4PJAE 4PGCA 4NJ9H 2BSSA 1SYVB 1EUUA 2ORBL 2YRZA 1QYGH 5EO9B 1U8IB 4RIRB 5T1LD 4OF6A 1VA9A 3EDEA 3HUJA 1FG9C 3MZTA 4M61A 5KAQG 4PJ8B 4NQTA 4ZPVA 1XGPB 4GRLC 4OZGF 1JBJA 2D3VA 1DR9A 5FUOL 4Q9QH 4OLYL 3F58L 4HIIA 3QO1B 4IIQA 4M6OH 5GSRA 4OQTL 4XHQA 4PRNB 2AS5M 1T4KA 4JM4H 5E08H 2KBGA 4HDIB 2X4NA 3CXDL 5FYKL 2MCPL 1UENA 3T0EA 5C0DB 3PL6B 1P53A 3V0VA 1WIUA 2FX7L 1KJMA 2YC1A 5F7EL 1HXYA 3D69B 3QHFL 3MLYL 1UC6A 3R8BB 5EBWA 1N6UA 2XA8H 5LCVH 4HT1L 2ADFL 2VLRA 3L3JB 2VNCA 3OKEA 4JFEA 1CK0L 3O6KH 5HY9A 4WFGE 1NFKA 1PSKH 4LSUH 3SKJL 2AEPL 2HMID 3C2AL 3MGTB 2Z8WC 3TYFB 3LB6D 4E41D 1JJUA 1PG7H 5JW5B 4HWZA 1UGNA 3HE7C 1OAZL 2UZIH 3PG2A 5CSBA 1MCJA 2E9WA 5GS0C 1GAFL 2W60B 5AAMA 1IGMH 2Z91A 2A73A 2J6EA 5SWQB 3Q6GH 4TOYH 5C3LD 4YPGB 1U8QA 4N0RA 3CX2A 3WKML 4KQ3L 2PYEE 3MJ7B 1JYXA 5KW9L 1A1NA 4Z7VF 2AABH 2DBLL 5HYSG 4PJDB 3EO0A 4JE4B 1YPZF 3U0WH 4G9FB 4WTWA 2ADIA 2N4IA 3C8HA 1LO4L 1B2WH 3FQUA 2R23A 3DX6B 5B4MD 2DKUA 1NFDF 2EDRA 4GMTH 1YQ2A 3UBXB 1YEHL 3RIAF 1QR1A 4L9LC 1PEZA 3MRLB 1CL7L 5EU3A 1K6QH 1TVHB 2W92A 4OJFL 4AL8L 3TCLA 5EUOB 1G0DA 3VWJD 2CO7B 4NQXB 1GHFL 1I7RB 1Y0LA 2DWDB 1XGYL 2RB8A 3H6JA 4M6AA 3U1SL 3W0WD 3QDME 2NCMA 1G6RA 4MAYA 2FECI 2HH0L 1KTLB 4PS4L 1J1OL 1U3HD 5IR1A 5A3ID 1S3KH 4LLMB 4RGMC 2ZG3A 2KZWA 2KQNA 2VAAA 4XTRC 2Z35A 1KB5A 4KJPD 3B3IB 1BIIB 3CK0L 3MBEB 4FP8H 4N0YH 5ITFA 3QDJE 1A3LL 2VLLA 1WCBA 2PW2B 1V05A 43C9B 1CE6A 4YEEA 4YHZH 3HNTL 2YA2A 3AAZB 1WIPA 3GSUB 5FB8B 1KN2L 3BGMA 3S35X 1XIWA 3SQOH 3FT4B 3P73B 4G8EB 3RUGB 2GJ6B 5F6IB 3QP3A 3VGHA 2O5ZL 2DTMH 2HFGH 2OQJA 3HN3A 3NH7H 5BRZB 3TH3T 2VZOA 3X14B 1YA5A 1HINH 1T5XB 2PXYA 3EDFA 4MDIA 5CJXC 3LCYA 3MGAA 5JA9A 1C5BH 4K7FB 2O5YL 4WFFE 1A3RH 1HHJA 1PZ5B 1F97A 2PTTA 4Z18A 3H7LA 1J5OH 3MUJA 4XBPB 5MERB 4XCEA 2X89D 2F53E 4I0CC 5B8CB 5TGBA 4XP1L 1SHMA 1ACYH 2WBKA 1RIVH 3K7UA 2X05A 2R4SL 1U8IA 3P4MB 4OGYL 2EIDA 1W0WB 2W1NA 4V1DE 2VDLH 3AM8A 5C9KA 1MIEL 1RQ5A 5GS2D 3NIGF 5EWIH 5HYSA 1NCAL 4Y5YB 5EO0B 4L3AA 3T0WA 2IPKA 4P3CL 4I3RL 2W9DL 4OF5A 2XZQL 4I77H 3IU4L 4YHLL 1OCWL 3D39E 2G9HA 4OFYD 1MCOH 3EZ8A 4YZFF 4ZPTB 2I27N 4GSDH 4HC1A 3PL6A 3T3ME 3MLWH 3SCMD 5IW3A 5C0BB 4JHZA 4DUVA 1YNLL 3EJYD 4JO3H 4QRTA 3MLXH 5DVNA 3D69A 4HX1A 1NCUA 5D5MB 5D7JD 5I73B 1XR8B 5FYJE 4NQEB 1NCWL 2FCBA 4AENB 2F5AL 1MPAL 3L3JA 4NM4L 1TZGH 3U9UB 2QSVA 4R97B 3WO3B 4YK4C 3ALPA 5H2BA 4WEBL 4XNZB 4LSPL 3S5LB 3MGTA 4TSCH 1SBBA 4BELD 1CCZA 2R56L 2VZ1A 4K9EL 5JW5A 1UM5H 4LAQL 5FYLD 5JTWA 1MFAH 2FHBA 3O11B 4YIQB 5HHQA 5HYFA 4BFIB 2HFFB 5IK3A 4JY5L 1N5AB 3D3VD 3DNKA 1LWRA 5SWQA 3W81A 3ZE2E 2E7HA 4M4RA 5DURB 4EN3A 4KAQL 1MOEA 1QSED 3MJ7A 3QEUA 3C5SB 4PY8J 4QRQB 4PJDA 2EDWA 3MLSH 3RDTC 4LARH 3MRBB 4JM2B 4BUGA 3UTTE 5J1AA 3MROB 1T2JA 4U31A 5I15L 3MV7D 4P9HH 4OM1L 3BEWA 5JOEA 4MX7A 4HXAL 3MRLA 1TVHA 4M7JL 5I6XC 2APBA 5ABDE 1KFAH 3OKYA 4EUPH 5T5FL 1RJCA 4NQXA 4YHOL 3V52L 5B39A 4PJ7F 5TJWK 1P6AB 2DWDA 2ZUQB 4JG0H 2Z4QB 3QPXL 4ONFH 1DQQB 3MUHL 3HC3H 2CXKA 1CGXA 1QFPA 2WIMA 2MPAH 5KSAD 1YNKH 4NO0B 4DGIL 2R1WB 4IOSD 5I1EL 5E2TH 3VDBA 4LLMA 3NCYP 3S5LG 4HWNA 4TNWF 3ARPA 3QEHA 4UT9L 3B3IA 5ID0B 3MACL 1KG0A 1MNUH 2ED7A 4W6YB 4K8RH 3X3GH 5FCUL 1XZ0B 3PE9A 5E2WL 3GSUA 2BVPA 2HKHH 3HC0B 1T89A 2X7LA 1IGIH 5JXED 4ODTL 2EDQA 4CBPA 4G8EA 4HPOL 1S9VB 2GJ6A 4HEPG 4XH2A 2FX8H 4PRHB 4TVPH 4X7CC 4ZD3H 3T0AA 5BCAA 3X14A 1MI5D 4NWUH 3RVTD 1CLZH 1T5XA 4JZJB 5L2KB 4LNRA 1PY4A 1NCCH 1GJIA 1PKQE 3O6ML 2ZCKH 4PR5A 4IRJB 4K7FA 3TVMC 3V5DB 1Q0XH 1A7OL 1T66D 5E9DA 3I6KA 4PTTB 1CFTB 1LK2B 1J1