2LQRA

Nmr structure of ig3 domain of palladin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
b'GGSNATAPFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANPQGRVSCTGRLMVQAVNQRGRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Palladin
publication title Structure and Function of Palladin's Actin Binding Domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 19
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2lqrA00
4K23H 2ICWJ 1QO3B 3VGAC 1FSKB 4YQXL 5ITBL 3GJFK 5LKNA 1JTOA 3SKJH 2NY2C 5I74B 3KWWA 4P4KB 4H8WL 4NZUH 4LMQE 4QHUA 3U0WL 2DLEA 5FYKH 1G0XA 2H2SD 4TYUA 3PABB 4U3XA 4H1LA 3VXPA 4HXAH 2NR6D 3STZA 1I7TB 2WUCL 3QI9A 4JDZB 1CFTA 3JTSB 4P2RA 4OAWA 2HG5A 4JO1L 5D7LE 5DD1H 4DJMA 4NHCH 1VPOL 1NGXB 1YJDC 5AEAA 4FS0A 2AJZB 3OJDA 5E6ZA 5FO9A 1UG9A 3EBAA 3FRUA 5F89B 4MGXA 3WIHA 4KVNH 4CN6A 1AQKL 1KIRB 1IM9D 1RK1B 1RAMA 3CDCA 1G9NC 4ZFOL 4LRNL 3EO0A 4ETQA 2XTJB 1MREL 1S8DB 2HAZA 1MHPH 1RZ7H 2EE3A 4FQXA 3LN4B 1G9NH 3ARFD 4XPGH 3RVXD 5CGYD 3FB5B 1Q9WA 4M3JA 2MTPA 3IFLL 4LSSH 2VN4A 4PJ8B 2JCCF 1T4KA 3QXTA 2JJWA 3FOLB 4PJ9C 4UQ2B 1J05B 2BMKB 3MRCA 5MENE 5DZNA 2YWZA 4FQLL 4ZTOH 4PJ8C 5IVXF 4MZ2A 1RIUL 5KVFH 2BY2A 2IEPA 3WHE0 4IIQA 3MRFB 4TUKL 4TRPL 5CEZE 2PYEE 4P9ML 2VOTA 4Z7UE 1X5LA 3WIFA 2FZ3B 4HQQH 3WFZA 2VDLL 5IMLA 1SJHA 1NCAH 2YPKA 3PHQA 4DN4L 3QEQE 1FE8L 3M1BB 5EFIA 2X10A 5DJZB 3GBMH 5TJWK 5I1GL 1N7ML 4LHQB 1KLGB 3P9MB 2BHZA 2DJ4A 3EYUL 2OL3H 3GIVA 4PRHE 4Q9RH 4AEEA 1CQYA 4IMLA 2EDJA 3C5JB 4XVTL 4MMZC 5EU6D 2AJSL 5HBBA 3O2DL 5D2NB 2HFTA 2OJZH 5H94A 4Y5XB 3UAJD 2XOTA 3VXTB 4WHYH 4XBPB 4W70A 1OF2A 4JDVA 1OT1A 2JF1A 4JFXA 4H88L 4L3ED 4PLOB 4QRTB 3HC3H 4WU7A 2QSVA 5D2NC 5L88H 3V6OA 4Z7UA 4WEUD 4K3GA 3A6BH 3GSWA 1ZLSL 1OAXL 2QTEA 1P7QA 1BX2B 1JHKH 2EH8L 3QEQA 1KIQB 1LHZA 1NC4B 3AXLA 4ZO8A 4G8EA 3VFWB 2GSIB 3C6SA 4TVPE 3RX7A 3S3JA 3KPSB 1EEYB 1KJ2B 2MPAL 1BD2D 4Q7DA 1T0PB 3ARXA 4NO5B 4DFHA 5CGMA 3GMLA 4QHNB 4HHAB 5F3HA 1QQDA 4POZC 4Q6IB 4YHOH 1S7WA 5I1LA 5IEHA 4M6AA 5IIEB 3KPMA 1JGLH 4GOSA 4BKLA 2F19H 3VA6A 1E6JL 5DVLA 5HY9B 4MDJB 4LPWA 1OP5K 1KG0B 3RNKA 1UYWH 4QXTB 3PWNB 2FBJH 1A3LL 1MFAL 3NABL 4I1NB 1EJ6A 5K9JL 1CG9A 4XCEB 5C0ND 3KG5A 3ARYA 3C09B 3S8WA 3D25B 4PJ5E 3SGDI 1MOEA 1IQWH 3MBEB 5JR1L 2L7JA 4JJ5B 3K2UH 5FGCB 1R3HA 1AO7E 4RISL 1NLDH 4M6OL 3REWB 5T3XH 4KVCL 5I1CH 1MRCL 1A9BB 3GFUA 1DBMH 4HLZH 3FB6B 1YEHH 2VZ3A 3WKML 1KCSH 4P23D 3BEWA 3G6AA 3FO9B 1YEDA 3MV9B 3EFFB 5IW6B 5F88A 4FQQA 3FO1A 3QQNA 3UMTA 1Q72L 3LKRB 1EBAA 1NC2D 3MLSH 5IMKA 4YHML 4PGJA 5IFAH 3MRDA 3F6IA 4NP4H 4XMLH 3QXDB 1IVLA 4PV8B 3H3KA 4L4TD 5ACLA 3VXRD 3RWHA 4PJGE 5SX5H 3T4AB 5D7IB 2EDQA 4QHKI 4ELKB 3DHJA 5ISZB 2VLKE 1F3RB 3PGFL 2LAAA 4X80H 1ND0A 5GGRB 4X7EC 1RUPH 1TJGH 3QEUA 2WBJD 3T8XB 1VDGA 3KJ4C 4IJ3C 4W4OC 4CW1A 1QA9B 4OTXL 1MCPL 1QLEH 2D7TH 4XXDB 4YWGL 3X3GH 4BQ8A 2NY6B 5E8OB 4MJ6A 3H6JA 5A2IH 1Y0LA 3MQIA 5F8QC 2QJDA 4PB9L 4FQPA 4KHTH 3D0LB 5AZ2L 1PEWA 5SWZD 2AXHA 3BGMA 3KXFD 1FNFA 2HMIC 5IQ7H 4I0CC 3TBWA 5C6PB 3UTQA 1HCVA 4QWWD 3IKKA 4UT9L 1TCRA 1UM4H 3WFHA 4BSWA 2IWGA 5FYKE 4LEXH 3EOBB 1KUMA 1YNLL 5EPMA 4KJPD 2I5YH 3VFPA 1OD7A 5HD8C 1KPRA 2A0LC 1OW0C 3B6SA 4PTTA 3X14B 3BFOA 1ZMYA 5E1AA 1MVUB 5ENWA 3TCLA 2J8UF 3VRLF 2HFGL 4X0KA 3WD5L 1JP5A 2X4PA 4K3DH 5TE4H 5GSVB 1BF2A 4NFBA 4G3YL 2BOBA 1E6OH 1KEGL 3FN9A 1SYVA 1IGIL 5FECA 1T83C 4DGVL 3R1GL 1RURL 1FVCB 3QUMB 5DRWA 5DSCB 4ONGH 4C83B 4NUJA 5L2KD 1B3JA 3VXUE 1HK6A 2EDEA 1EA9C 5IMMA 4JZJB 4Q74A 3HR5B 1UB6A 3H42H 4PRID 3RHWK 2V2XB 3D85B 5EBWA 1YDPB 4F7EB 1YY8B 2V2TB 4MD0A 1MFNA 3CAFA 5EC1B 1UWEL 2QQQA 3T0VA 2BNRB 3F12B 1GH7A 2FECI 5LBSL 5J12B 2PXYA 2JIXA 3PL6A 1ADQL 3LV3B 5T3ZL 4G5ZH 4R4BB 3QO0A 2KQMA 4JHWH 3N1GC 4GBXA 4YHZL 3I3EA 2V5YA 1J9CT 5J12C 3EYOB 5EUOB 4KV5E 3V6ZA 2WP3T 4ZOCA 3UTSE 3V0VB 4CVZB 3DYOA 3FO2A 4N0CC 2J4WH 3IDGA 4CN4A 5T5NG 1V7MH 2YR3A 4Y4HA 4ZUVB 5L2JB 4PLKC 2IAMD 1K6QL 4NFDA 1HHHA 1LO2L 1S7TB 4L3CA 1UM5H 3VXUA 4N0UB 2ADGA 3CDGB 4XNUH 3EYFB 3FTGA 1D7FA 1IGCH 2B1HL 3W5NA 5CP7B 4Y4KB 5L7XL 4LPYA 3NIFE 1R3KB 2WM0A 4M62L 3TVMB 3WHXA 4OI9A 3U83A 3EHBC 5I66B 2OBGA 4FQJH 3FZUC 4R8WL 1CFQA 3DO3A 1IL1B 1P6FA 1C5DB 2C7UB 3LKPA 4G6FB 4Y4KC 5DI8B 5E99L 1FH5H 1JMXA 3TVMC 2P7TA 4G9DB 3QDGE 4DCQA 5SWQA 4JR9L 1P6AB 4P2YA 1JGDA 2ZCKL 5FYJL 1B9ZA 5FHAH 5JIKA 1RIHL 2XZZA 2AJ3A 2BNQA 2VR4A 2YUZA 4KTEH 1N59B 2VUYA 1TQBC 4K8RC 1CFBA 2OL3A 2NTSP 3GMOA 4MB3A 2BVTA 1NJ9A 1PY9A 4K8RH 4JY4B 1RY7B 4N5ED 5DMGD 5HVHB 4AL8H 5D6CA 4ODWB 4JAMA 3T0XA 5CSZA 5KBNC 3OTTA 3QFJA 1HSBB 1SM3L 2Y07H 4OZHE 4Z5RA 1WWWX 3RI5F 5J57B 1FN4A 4M7ZC 3WV0A 3AROA 1Z9LA 1AXTL 4JRYE 1JNLH 3VU2A 3V4UL 4M8QB 2VDQH 1CTOA 2FSEA 4FG6D 2RCSH 5DRXA 3TH2T 4Z77B 2X4TA 1T03H 4PRPD 2QQLL 2DKMA 3P0YL 1MF2L 4F58L 3QIBB 4LDOB 1MH5B 1DBJL 5T3ZE 1SBSL 1MWAH 3MOBH 5E2UL 2UZIH 4FNLL 3CFDA 2Z4QB 3PGDA 4WRLA 5DD0L 4DGYH 1QLFA 4LSUL 2LFGA 4UDTB 3T2OA 5K59E 2E9IA 4N8VG 4AT6B 2PTTB 4HS6B 5EIVA 1DQLH 1JPFA 1RJZB 1A6UH 4N8CH 5DHXB 5D71H 2EKSB 1A6VL 3PP3H 4LCWD 2HTKC 3W2DL 3VW3H 1HHKB 3OKOB 4OLYL 2LABA 3FONB 4JRXD 4ZSOE 3VGGA 5C08E 4LLQB 2IAND 1CL7H 3BWAA 4X6CB 3LS4L 4ZXBA 1RUQH 4K2UL 2A1WH 5F44A 1OAYH 5GZND 2QQNL 5C0BD 3VFOA 3K4DA 5A3IC 1MJJA 4QRRB 1DN0B 4U2YA 3CSPA 2BDNH 1OSZA 1J87A 1XR9B 4F3FA 3RQ3A 4CRPA 2W0KA 1FNLA 1JL8A 3VH8A 4GLRH 5GRZA 1Q0YH 2DLTA 3WDIA 5I0DA 3L5WA 1W0YT 2H3NA 2VXQL 3SCMD 5GS0L 2VABB 1M05A 2HJFA 3B2VL 2ED8A 2JCCE 3DGCR 4LNVA 1T0NA 1ZT4A 2XFXA 2X2YA 2LTQC 4EBQH 5C0FB 4WO4D 3MJ7A 1ODAA 4OF3A 2AEIT 1UFUA 2Q86A 4I3RL 2DBLL 2VDPL 1U0QA 2HFEA 2EC9T 1NL0H 3PV6B 3WS6C 3BP5B 1IILE 1I8MA 3ULUL 1EPFA 5LGHH 1KNOA 1FLRH 4O4YL 5C08A 1SBBA 1N6VA 3WL9A 4O9HL 3QUXB 2R1XB 1OAKH 3WJJC 4UB0H 1CF8L 4V1DE 5C0CE 4BH7A 3ES6A 5CMAB 3M8OH 3SGEH 3H7BA 1U2CA 1IM3B 3TIEA 4BFIB 3BP7A 1OAQL 4XMPL 4XRCA 1A2YB 1FC1A 3DV4B 1UB5B 5I71B 3CFKB 4NJAL 5TE6L 3RPIA 4OCXH 4KRLB 5ID1A 2GFBA 4NDMA 5JUEH 4KKBC 3INUL 3I9GL 2MCPH 4JM2B 4ODVH 1AE6L 3MRLA 4YNYB 5I71C 4NO0A 2CPCA 1U8JB 1ZANH 1N6QH 3HAEH 4JFFA 5IVXA 3VXMA 4XTRC 4KGLA 4QOKE 4LHUD 1JIBA 3CSBA 4O51A 2G60L 5I1KL 4MD5A 3OHXB 3P0VL 4H0IA 2EDYA 1D6EA 1OW0A 2HWZL 5FGBC 1N5YH 1CVSC 4NO2B 3W0WE 2ZOLA 2ICWI 3RWGB 3QNZA 3UYOD 4ZAKB 2QV2A 4WV1C 1ACZA 1PQZB 3NFSH 4KZDL 2PYFA 2F58L 5DJ6A 2O5YH 2R69L 3ULVD 3FOMA 1C16B 2IJ0C 3FN0L 5KSBB 2V7HA 4HF5L 3EYVA 4X7CC 5DURD 2R2EB 3HNSH 2XYCA 1BECA 1T83A 1GVIA 5E95B 3KS0J 4H26A 4LQFH 2BSSB 5DQDH 1IAOB 3VGBA 4LARL 4GS7B 2HRPH 4Y5VA 1S5IH 1VADB 4ZO6A 2Y6SD 5IW1A 1R5VB 1MCJA 4NSKA 5KSAB 2GCYB 2DBJA 3RVWD 1DQML 1NKOA 1RUAH 3QJHB 3OR6B 3IKCA 4I3SH 5HHOA 3PHOA 2OJEB 5BMFH 4JKPH 5JZ7D 3OAYH 4FFYH 1CE1H 5CSBA 4LIQH 1LNUA 1R5WA 1FAKT 2ARWA 2VLRD 3WE6A 1MJ7L 5ITFA 2R29L 4WEBH 3ETBF 3HPJB 1ZGLP 3C8HA 2VDNH 4JFEA 4XWGL 4Q6YA 5FM4A 5ID0A 1IAIH 1QSZA 4TTDD 1T89A 3MZTA 4XNYL 1CN4A 1KJVB 4IRSB 3RZWA 2A6KA 4LSTH 4RGNB 3GI8H 3SJVB 4PPTA 1H3XA 1KIUA 1T66C 4GXUM 2Q8BH 1U58A 3OKLB 3QEGH 3EOAA 2NZ9D 4IRSC 2H6PB 4RAUA 5DHVH 4EEEA 1IKFH 1ZHBB 4RGNC 3GIZL 3GZKA 3QDME 3RZCC 1X5KA 1FZMA 3S5LA 1NGWA 5F7KC 5CD3A 3ALWA 5A16A 1IGTA 5E9DB 1QR1B 4NRZB 3MX0A 1I9JL 1RZJC 2R1YA 3WEXA 5JW3H 5IEKB 1R24A 4OFPA 5BVJA 1C08A 1CFSB 4ZYKA 1YN6A 1ZVYA 4NWTL 1YMHA 3SKMB 5HYSA 3K0WA 1CLOL 5CZVH 1A6AB 5CWSB 1A1OB 1DSFH 2GEEA 2VH5L 4P57A 5A2KH 2V9RA 4LQ1A 2GJZA 5HHQB 1KPUA 3U7WH 2FX9H 1YMMD 4S1DC 5I1DB 2A6IA 2OM5A 4N1CA 2YK1H 2JELL 3F7QA 4IEFB 3B9EA 4ZD3H 5JHDA 2BRRH 1HINL 1DANU 1U8OB 1UCBL 3P11L 2NLJA 3CUPB 3SDXF 3AS3A 3IETB 3JWDL 4OGXH 2XKNB 5KTEH 2J8UE 1U36A 4OGYL 3VRLE 4G7VL 1LEGB 1INQA 2BCKB 2OR9L 1HYRC 3QCUL 4FMFA 4LCCB 4X4YB 3IDNA 1JMZA 3H3PL 3SKNB 5DMYA 4KI5F 1MWAA 3D39E 4DKEH 3QZWA 1V8HA 4RMQA 1FORL 3MRGB 1MPAH 1IE5A 1J8HE 4CADA 5HYEA 1FLTX 3G04B 4MA3A 3B5GA 5CEYB 1MNUL 5FUCE 1Q9LB 4NM8H 2I26N 2H45A 1YY9D 1EO7A 4WCYL 2X70A 1R3LA 5D1QA 3KYAA 3MLZH 5C86A 5J6HB 2BVQA 4OZGA 4L8BA 4LBEB 1CZ8H 2IGFL 3IFNL 4Y19B 3JWOC 4S10A 4HIIB 2FYYA 1EGJH 2FLBT 4ZTPH 1CVRA 2ESVD 3ROOB 2APTA 3JWOH 3I50H 3P4OB 3T4YB 4UUJA 3THML 1HXMB 3MLXH 5J9PB 1KYOJ 4U4BA 2J8UA 4OI8A 1GRWA 2XZAH 1AD9B 5HDLA 2DQHL 4OIIH 3NFPB 1S78C 3F58H 1BMGA 2CGRH 2WSKA 2E8ZA 1JGVH 4R6UA 1CIUA 5EULV 4JZNA 1XMWA 2CK0H 4W6YB 5FKPB 4N8VB 8FABA 3QXAB 3AC0A 1D5ZB 1XZ0A 2YKLL 1ERNA 1JWUA 3LRHA 4TUOA 4LLDB 4IOSD 2KKQA 1JI1A 1YECH 3HS0A 3QIUC 8CGTA 3F7PC 5DYOB 4JANB 2JB6B 2OYPA 5L6YL 3D6GA 3VXSA 1KFAL 3LKQB 5E94B 2XN9D 3BISA 3TBYA 2E27L 4XZUB 3C5SB 1QZ1A 4JFHD 6FABH 1TITA 2VR9A 1K9TA 3WS6A 1JWSB 5DRNA 1VA9A 5IVZA 1KTKE 2WW8A 5I8CB 1WIPA 1AKJB 1Y6NR 3QPXL 4JKMA 1NMCB 4D8PA 4BYHA 7CGTA 4KZEH 3U9PH 1T1XA 5I8EA 2FR4B 3EO9L 3CVHH 3DBXA 1WUNT 4R96B 2W0FA 4ZFZB 2HT3D 2Q76A 4HIJA 1NMCC 1S7QA 1YEFH 4G6AC 1E28A 1CXLA 3S7GA 4MSWB 3VRIA 3TWCL 1RU9H 1BREA 4J7RA 5FIEA 1HI6B 1QFOA 2YS4A 1BZ7A 2R4SL 3W11D 1S9YB 2L0DA 4D9RD 2M2DA 2P5WE 3E6HA 3MLYH 3SGJC 3OB0H 3C08H 4N1HB 4BUGA 3T0EB 4LRIA 1PZ5A 3GBNL 3IJSA 3HAEA 5MHSE 3I85A 4S2SB 4TUJB 5DJCA 1NUGA 4MNQB 2Z91A 1NCBL 1A6TB 1NGPL 4M7LL 5J1TC 4H25B 5F9OL 5KOMC 3OXSB 3B9AA 4MNHA 3WN5B 1YC7A 5FEBA 1OCWH 1HYSD 2DI7A 2YC1A 4NZJA 2NW2B 1NAML 1KLFA 3WFDH 4Q2ZA 5DK0B 2PR4H 1YN7B 2BY1A 2D9CA 2FIKA 4AMKL 1I9RL 1FQ9C 4KDTA 3STBA 3RJQB 3WN5C 4M6NL 4WV1A 3QB7C 1WFNA 1N8ZB 3FT4B 4DN3H 1WLHA 1T0MB 5CJ5A 1TJHL 4Z7VA 4D0DA 5MERB 4P5TC 2X1WL 2Y72A 1MCNA 3BE1L 2AVGA 4X4ZA 1MCWM 1Z2KA 4JY6B 4O2CB 1LK2B 3MA9L 3T77B 1Q9OA 1JN6B 1T6VN 4FQIH 1BP3B 1NCWH 3KYKL 2NY7L 4U1NB 3ZKXB 2ZKHH 1N4XL 4NUGL 4JCMA 1L0QA 1KJ3L 2UY6A 1GGIH 3FCTB 3O4LE 4OKVA 3DVGA 3PDDA 3Q6FB 2VNCA 3HE7C 5D1XA 1DVFB 2GTWB 4X6FB 5F1SA 3RVUD 1KN4L 4J23A 4ZNEE 3DGGA 5HI5D 5J3HC 3LKNB 3OPZH 1AGCB 4JFDD 3DETD 1HHJB 3NCMA 3S37L 4GAYB 1G6RL 3AM8A 3GMPB 1UM6L 1H0DB 5BV7B 5KOVC 4POUB 5HJ3A 1B0GA 2VO5A 2SEBB 2NYYC 4KRPD 3O2VL 1CR9L 2D31A 1FPTL 3SGKA 2ADFL 3GHEL 4P2RD 5BV7C 1HH6A 3NACL 4LCYA 5DHVA 3WIHL 5JXEC 3UJJL 1KC5H 5IT2L 1ZVHA 2VLJE 1ZT7A 5KSVB 3BX7C 4IRJB 2R8SH 4XWOD 3F7VB 3EO1A 2AEQL 3RZCA 4HH9A 4LVHC 5I0ZA 2AW2A 4HK3N 5C0DA 5FKAA 1QBLH 4QTHB 3AAZB 4FQXD 1QSEB 4E0RB 1KULA 4LCUA 3HZMB 5JORB 5IK3B 5BRZE 3G6DH 4XCFH 2FHFA 2WUBL 1FZOA 3V4VL 4OV5B 5I9QB 1KT2B 1T5WB 2KZWA 2DL2A 4UQ3B 1A6WL 4ISVA 5IQ9B 3ZKSD 5L8KB 2KZ1B 3FB7A 1R3IL 2J6EH 3QEHA 5K9KB 1MAML 5HHME 1PW3A 3UPAA 4KQ3L 1P7KA 3TA3B 4YDIH 3TNNA 4NRXA 5DGQA 1LK3H 4PJHA 4Y1AE 5KVMC 4YPGB 5IP4A 1DQQB 5D7LD 4JG0H 1IAMA 3TA3C 3QUYB 5TPWH 1WIUA 3BRFA 1DE4B 4NKQB 3S97C 1SMAA 1W0VB 2OZ4H 4KY1H 1WF5A 4FOMA 3RTQA 2XXCB 5FYJU 2W0PA 2DKSA 3WXWH 3KR3L 3QUYC 3WS3A 1P84J 1WBYB 5BRZA 5C9KA 5SX5K 1J0HA 5E0QA 3V5DA 3BN9C 4OCLC 3L6FB 5CUSH 4C58B 2P8PA 2E3VA 4JQIH 5EOTB 1SJXA 5MEND 1UACH 2PTUA 3MUY1 3DRTB 4X8JB 4UTBL 3MROA 2DF3A 2PCPA 1MI5B 2X44D 2X4NA 4QRSB 5CEZD 3P4NB 4TNWK 5GRUL 1KTDB 1DBBL 1EGJA 3LAFA 3MLUL 5AWNL 1U95A 5LVEA 3PV7A 4JZOB 4PJAA 3QEQD 4OJFH 4OFYA 5GRJL 2AGJH 4QF1B 1NMBH 1TPXC 4XVJH 1UXWA 3O9WA 4FFVC 3C8KA 2Q7YB 1JTTA 5T5FL 1UEMA 4JO2H 5KJRH 2VQ1A 4ZPTA 5HGHB 3ULSA 4PRHD 1U91A 4MAYB 4YXHL 1AR2A 4MJIA 2DQGL 2Z35A 3MUJA 3SDYL 1CT8B 1IEBA 1P2CB 3BWUC 4HJJH 3MFGB 3MLTB 5I73B 3AFLA 4XAWL 5KW9H 2FECL 2PO6C 4GG8B 4WI9A 1FVEB 1C5CH 4ORGB 1L7TL 4OCRL 5C9JB 5IB2A 2APBA 4LSQH 3TPKA 4JLRB 3R8BB 2XACC 5CJOL 5IB3B 3EGSA 2MJWA 2XKSA 2YWYA 3OMZA 3QIUA 3DV6A 1KB9J 2ADJB 1V3LA 2LAGB 4XCNA 1QFHA 3V2AR 1UKTA 2YD8A 3I6GA 3DRQB 3Q3GB 4I48A 1FCCA 4GAGL 5DEGB 4L8SC 1CD8A 1Q8MA 2X4UA 5D7IF 4TVPD 1FL5B 3RBGA 5BO1L 1ZWIB 4WTZA 4YDLB 5HHPB 2IBGA 4XP1H 1MSPA 3CVHA 35C8H 4OLXH 4J6RL 1LE5B 3EOTL 2VDML 1AGFA 1Z0NA 2X4SB 4KJYA 4LLVA 4EI5B 5C2UB 1UJ3B 4YDLC 3F7RA 1WC7B 2PNDA 5D96C 4F2MA 2E7BA 3O45A 1IZKA 5EBMB 5I17A 5DWUH 1NFDB 4M48L 2R9HD 1XGRA 2DMBA 4EI5C 1AHWC 4PJXB 2VRAA 1UJ3C 1X5ZA 1X5AA 3H9SE 3GSNA 2QLVB 5D7JC 5E2VH 4H20H 4GXVL 1GOFA 5I15L 5IGXH 1ZHNA 2VXSH 4NNYB 5EU5B 3O6KL 3ARTA 3CK0H 3BRGC 3CFBA 4PJ5D 1KTLB 4XPTL 4GKSB 4PJ7A 3MCKB 3U7YH 3SDXE 4XB7A 1EMTH 3BDBA 5T1KD 3GUTB 1QNZH 3IFPA 3IGAA 3Q1SL 5AUMB 3L7FA 1GGTA 1MAJA 1P4LB 4ETYA 4P9HH 5ETUB 1N64L 3MNZB 3HG1B 5EBLA 3IDIB 4KI5E 4I77L 5TDPB 3WLWD 1A0QH 4JHZA 2Z31B 5BS0A 2F5BH 3NTCL 4JFYB 2DD8H 3HRZA 4DZBB 2BJML 2PW2A 1CLCA 2BNUA 3ARZA 1VFBA 4XB8A 3F5WB 4P5TA 2VLKD 3TEUA 2EDLA 1J1OL 3MZGB 4U6YA 3HMXH 1DFBH 3GRWL 3L3OA 4GW1B 5J8OA 3CX2A 1JBJA 2QEJA 1TVBA 5TF1H 2H26A 2D0GA 2NXYD 4FABL 4I3GA 3KPNB 1OY3B 1LO3H 3WMSA 2R2BA 4FQHB 3HE7A 3N50A 5J1AB 4HEME 3SDCB 5I2IB 3EYSL 5B39A 4R4FH 5I1IL 2EDWA 5FHBH 3UXFA 4ODXB 2E7LA 4YJZL 2IG2H 4IOFD 2FO1A 1J18A 2K7PA 1OT2A 1KGCE 5FYKD 2H8PA 4YBHA 3U2SB 1LEKB 1BOGA 3BGFB 2HN7B 4LNRA 1MJ8H 4NQEB 2PXYD 2Q20A 1PKQB 3PL6D 3TC9A 4HUUA 1FNHA 1H3VA 1I75A 3MXVH 1TTGA 1U8QA 1YJDL 3MRQB 4GBXD 3MFFA 1TETL 4N1EA 5JXEA 3HFML 3DUSB 1OB1B 4P46A 3SDAD 4Y4HD 4HUNB 3PP4H 1XF5B 4BELD 2G5BB 3C6LB 3GMMB 3PP3K 4H0GA 3VXUD 2BERA 4QY8B 4PJBF 3B5TA 5C0AE 3BKMH 1NAKH 2A77L 3DX9B 1YQ2A 3O6ML 2WWMD 4C4KO 1S5HA 3AB0C 2J6EA 3HE6B 1NUFA 3CXHJ 4G6MH 5D1ZC 4DUVA 1AIFA 3LIZH 5GS1B 4C56A 2ADIA 2ZUUA 3FT3B 1OGAA 3HI5L 2R0LH 4WUUE 3CLFL 5DT1H 4TSCL 3QWOB 5C0IB 1G7MB 4OF5A 2MHAB 5ESVB 5B4MD 5IBTL 4LSRH 1RZKH 1M6OB 3V5KA 1JYVA 3VXOA 5GPRA 5DVKA 1I3RB 1XCTB 2OZ4A 2E6PA 4HX1A 4N9GB 5FDWB 3UTSD 1J8KA 4ZDHB 2OTWB 3VGEA 3V4PH 2BNQD 1WIOA 3TJEL 1X5JA 4YHLL 1H3WM 2Q7NA 3WJLC 1B2WH 1A7NL 4OFDA 3MYJB 5CJBA 3LKOB 4L1HA 1G7IB 1QSVA 4IOIB 5TDOB 4ODHL 4RDQF 1KBGL 4JG1H 3SQOL 2VQUA 3ABZA 4DQOH 5H35A 4X9HA 3BH9A 1HHGA 4RFNB 4OT1L 1PX4A 2P5EA 2V5RA 2K7QA 4OD1H 1CDYA 3DTXA 3NH7H 1RZ8A 5HYQA 4EQ3A 5ESAB 4PRAB 1JFQL 2CKBL 3FQUB 2CRMA 1CGSH 3LD8C 4HFUL 4WGWB 3RL1B 5J56B 4KPHH 1LP9B 4MXQD 1NGZB 2Y06L 3QDGD 4MJ5A 5INDB 3CSGA 3S3SA 1JCKA 4E41B 2Q6WA 3GGWB 4N8PA 3G5XA 2C26A 4OFIA 1DQJA 4U1SA 4PRNB 4X6CF 3GI9H 4L8DB 3QDJB 1UWGL 5CIPH 5EG6C 4K07A 4TSBH 1I1AB 3R8QA 1KJ2L 2DS4A 3BT2H 3D18B 5C07B 3S88H 4M1DH 2BVYA 1NPUA 3UTTA 2XTJE 4JDTL 3MV8B 2IADB 3MOAH 3EZ8A 5TE7H 3KPRA 3LY6A 4JRYD 3MRJA 1RUML 1VGKB 1UH2A 5GS2H 4B41A 4OLVH 4JHAH 3UO1H 3BDXA 3UPRA 3O2WH 1EHNA 4LGRB 3RWEB 2XICA 4EUPH 4MQXD 2IFFL 5T3XD 1SJEB 1GZQA 5EZLA 3L3JB 1I8IA 2FBOJ 5JDSA 5T3ZD 4NQVA 4XVSH 1QFWI 5IG7B 2RFXA 2HKFL 4KKLD 1JNHB 1D5IH 4NNXB 2AI0H 3LMJL 1MLCB 4KMLB 5DUPH 3IU3B 3G5ZB 5H2BA 2P8LB 2BFVL 4HPOL 4K94C 4J4PA 2AJZA 1UH4A 3QIWB 2DB8A 3TJHD 3G6JA 1M1SA 3BP4A 5INCA 4UNUA 1ZTXH 1MUJB 1S8DA 4S1SL 1EUUA 3MLRH 3LN4A 2YD2A 4QRUB 1G0DA 5C08D 3IYLW 3ARDD 3KPQA 5EBGA 1B4JL 2VKWA 5LXGH 1AHWA 4POYA 4EN3A 2BHYA 4Z78B 3BN3B 5EH1A 4X4XB 3ZDYF 5T33L 4ONHB 1J05A 5D7JA 4JM2F 4BZYA 1DCLA 3VFVA 1J0KA 4YXLL 1JZ3A 5D2NE 2GT9B 1FJ1B 3RKPA 1AFVH 1U8KB 1M7DB 1QFPA 3GMQB 3OR7A 1GPOH 1A14H 1ZHLA 3WFCH 5FUOH 4FXGB 1DLHB 2YEZA 3DPBA 1EEZB 3HKFA 4QCIB 3BIKB 3BIBX 4OLEA 1JGUL 1KCUH 1H8SA 5E8NB 4NKMB 3T08A 2C4FU 2CIKB 3DMMC 3QCVH 1S7RA 2D9QB 3O8XA 1VACB 2O5ZL 3KLDA 3RIFF 5KSBF 3KPSE 4N0YH 1JZ5A 3SEPA 1GCFA 1SEBB 4HAFA 3F62A 3HMXA 4HS3B 3OX8A 4Y4FB 1WSST 2NY5H 5CBEB 2EC8A 2OXGA 3GJEB 4B50A 4CKVX 4V1DD 4JKWA 5C0CD 2YD1A 5CLWA 5CBAB 1JHLH 4JJHA 2HT4C 5ECJE 5C0RL 1U93B 4U6VH 3WSQL 1T2QH 2YZ8A 3BAEH 3T1FB 4QRTA 2MFNA 1CLYH 3MTRA 4P5MB 3QXUA 1U3HD 5FGCE 2HH0H 3QUML 2IH1B 2V17H 4NQSA 5HGGS 4TPRH 4FMKA 1BX2A 2NR6C 3MPCA 5SX4I 1F11B 1IM9B 3MV9E 4AZ8A 3ARBD 3TPUB 5HHOD 3QULA 4JHWL 5KG9A 2KBGA 3G5VA 5IFHH 2GSGB 4QHNA 1JE6A 1CGTA 2EH7H 3MREA 2UZXB 3WFBH 2RIKA 3HNVL 1M71A 4HCRA 4Q6IA 5DRZB 5IB5B 1JNNL 3NCYS 5ICZA 3W0WD 3MLVH 2CDEB 4HWEH 3KAAA 1JYWA 1QSFA 4LPUA 4MDJA 1KG0A 4X5XA 5F7EH 3ARFC 1HH9A 3RVXC 5D7IE 5CGYC 4M6MH 4D3CH 1EXUB 5ISZE 4MA7L 1X7QA 1H15B 4UBDD 4OD3H 2AK4B 4DVBB 2X9YA 1Q1JH 2FJFB 2DWDB 3MBEA 1IARB 5T5NF 1CFNB 1GHFH 1V3MA 4HJ0D 4Y89A 3UC0H 5GS0D 3VXNA 4RMRA 4TNVF 5CP3H 4PJFB 5D72H 5KVGH 1R0AH 1JRHI 3DHMA 4ZS7H 1XGQB 3QBTB 3MO1B 1TZGH 3MV7A 4MZ3A 4K55A 1JTPA 5JIIA 4KTEL 1C5BL 3DX7B 2YA1A 3JVGA 2JB5H 5IWLA 4PR5A 3TBVA 4K8RL 3CPLB 3LEXA 3DVNA 3QUZB 3HR6A 5D7IA 4V2CB 4ELKA 1B6DA 4JPIB 1I85C 1U8IB 5ISZA 2HRLA 2OR7A 4FTVA 2ATPA 3TNMB 3L5HA 3F8UB 3LDBB 3MMEB 5GGRA 1HOCB 4UOW1 4WW2C 3OSKA 5LWYH 1KENH 3SY0B 3MBXH 2EDNA 3QAZB 5CEXB 1HEZB 3UAJC 1X6NA 1DUZA 5BZDB 1QBML 4YEFA 1A5FL 3N06B 3QDMD 1G7LA 4HH8A 2CRYA 4XP5H 1JYNA 4XP9H 1AGBB 5DVOA 3UZQA 5GGSA 1BD2B 1MWAL 2BXZA 1OAZL 2FD6H 1OARH 5CILL 1YEGH 3BZFA 1EDQA 4PG2C 4QRQA 2VLME 3E8UL 4FQCH 4N9OB 4MA1C 1P4BH 3X11B 2BNRE 2AQ2A 3OB0K 2W9DL 5C2BH 1DEEB 2NY1B 4LPXA 3X14A 1GYAA 4OV6F 3L5XH 5MI0B 1A1NA 3D2UA 3L3DB 4TOYH 5I75C 2FX7H 2VZUA 4QHLA 5CIPA 2VDKH 3ZKQD 3LHPL 3SE8H 2QHRH 5EUOE 4QXGH 5D1QD 1BZ9B 4WENB 2P42B 4U1LB 1A7RH 4U0RC 4BK4A 3VMPA 3LS5H 4EDXA 2A74A 4YDJA 3FRPG 2H32H 5C0NC 4RAVA 3OKKB 5JLZA 1YQVL 4G8GA 4PGCB 3P2TA 2VWEC 5GISL 4CMMB 1NGQH 4RWYL 1QFUL 3VFUA 3A6CL 4P23B 4Z0XA 4LAJH 1P69B 4EUPA 2F8VA 2VZ1A 2VKXA 4F7CA 3DX8A 3SO3B 4X7SL 1Q0YL 4JFOB 2ZG3A 2K9UA 3WIIH 1CGWA 2IFGA 4S1RL 4PBWD 5JO5A 4P23C 3D39D 2D03L 1QP1A 3WHE1 1BJ8A 3QA3A 5ICYB 4JPVL 3SO3C 1J8HD 1RFDL 1DBAH 2I24N 5GHWH 1IEAA 2JK5B 4U6HA 3X13B 4R0LB 3U1SL 3FAXA 5SV4A 1VHPA 1ZT1A 5E03A 4R2GB 2QKIB 1TZHA 2BSRB 3VXSD 5F96H 2GITA 1MQKH 2WMPA 1BVKA 1CGVA 1HDMB 4ODSH 1BLNA 1O7VA 5L2JA 3RIAK 1DTUA 3EKCA 4U1KB 5KVEH 4YR6A 2WBJC 3M8OL 4IRZL 2EDRA 4KUZH 3FFCB 2LV4A 5DVNA 1ZVSB 5FV1L 1QLRA 3GO1H 3EYFA 5DMKA 4YHNB 5SWZB 1YPZA 1LILA 5I6XB 4YBQD 5IM7A 1N3NB 4PRBA 1ULVA 4E5XA 4GSDL 5CKAA 3MRIA 5K9OA 1RZFH 5CD5D 1VESA 1I8LA 5HGBA 2Q8AH 4JE4B 5L8LB 3ILPB 2ZPKH 5EU4A 2ZCLL 4Z76B 5DI8A 3QQ3B 3IJHA 4LSPL 4BQCA 4G7YL 2AJYH 3GKZA 4JPWL 5IBUG 1G9MC 4PJBA 3MRPA 5A2FA 2MMXA 4XI5C 1AD0A 4EI6B 1X3DA 3H9YA 4PJCA 4D0BB 4KJPC 4TULH 1G9MH 4UU9A 5FUZH 5T1DL 3DXAB 1BBJA 3U6RA 1N59A 1BQHG 2WANA 4YHIA 4LSVL 4YGVA 4HZLB 4D9LH 2K1MA 3S36H 1KTRL 2RB8A 2ZSWB 1JK8A 1QRKA 3RDTD 2XA8H 1SYSA 1PVHA 4PRIB 4KKAD 4GFTB 1C12A 4JGJA 4ZO7A 1MY7A 3FO0H 2B20A 3GBLA 4X6CE 3V6FA 2NY3B 2VMFA 4LLWB 3L3IA 3PJSB 1XF4A 1S5IL 4ZFGH 3MCLH 3TO4A 3U46B 4AEHH 1U42A 4HFWB 5MP6L 1G7QB 2IF7A 1JUFB 2B0SL 4GW4A 4QRRE 5DD5H 3MRNA 3EDKA 3OKEB 2IH3B 2P5WD 1A3RH 4RGOL 3QIBA 4OCYH 2X1PA 5BMFL 3WNOA 4JKPL 4ONFH 4FFYL 4PS4L 5JHLL 4K7PH 1VFAA 2R1WA 3FB8B 3PQYB 2DQTL 2H9GA 1AGDA 5D1XD 1K4CA 2P24B 4OB5L 4LASH 4X5WA 1TTUA 1JI2A 1PYWB 2R23B 3FQNB 4WI2A 1JF1B 2YPVH 4FRWA 3MUZ1 3IFOB 2EKSA 3ZSTA 1D9KB 4HC1H 1H3PH 2C3XA 4MB5A 3BSZL 4PFEA 3OKOA 2X7LA 1F8TH 4LLQA 4X6CA 1NBVH 4YFLI 4HIEB 5F9JB 4ENED 4S1QL 3D3VB 3MRRB 4RMSA 2GK2A 5DUBA 3HN3A 3VFTA 4GRLB 5I1EL 5I16A 1MCRA 4QRRA 1DN0A 2Y5EA 4BZ2H 4RMUA 4TSAH 4P3CL 4QRPB 2DICA 3OJ2C 5CP3A 4WEMB 5E8EB 2FGWH 1ZEAH 4J3XA 1BIIA 3WYRA 4GRLC 2OXHA 4WI7A 1IRAY 3O4LD 1RZJL 1CDHA 5I8KH 3VRJA 1WFUA 4GAJL 4MXVF 5CLTA 5GGVY 4ESKA 4PGEA 4IDJH 2CMRH 2DI9A 1KLUB 4JQXC 2A73B 1GGCH 4Q9BA 1MJUH 3ULVF 3O6LH 3PV6A 3PDOA 4KQ4H 1UA6L 1HZHL 1YEEH 1FGNH 3BGAA 2FX9L 4N5EC 4K3EH 3RGHA 3AU1A 5JOFA 1FFNB 5DMGC 3VFRA 3GJFB 1HE7A 2QSTA 1I85A 5B22A 4NYLB 2NCMA 1XGUA 3QUXA 2UYLB 1TNNA 1BOYA 3UTPE 2P48B 3SBWC 1CK0L 4PREB 2R4RH 1ES0B 1AXSB 2YA2A 4P3WA 4DZ8B 3V7MA 4X98A 3S4SG 4APQB 4WW2A 1FRGL 1AC6A 1CLZH 2ZCHL 2P1YA 5KSBE 4YXKH 2VLJD 4FG6C 5GJSH 4DGIH 2Y1VA 4HUWB 3L95A 4XBEL 1UB5A 4L3EA 2W9EL 3CFKA 3ZSSA 1ZGLB 3PUCA 3CXDH 3MNWB 3OG4B 2A6DA 3RJDA 5AZEH 1TENA 1IEHA 1OHQA 4HKXB 3B3IA 4PGDA 2NNAA 5JXAH 4PRDB 3C5ZB 2ID5A 5BRZD 4XC3L 3RKDD 3VDCA 3KGRA 1ORSB 3VJ6B 2HJLA 1U8JA 4LAQH 5JIHA 1FNEB 1LDPL 3IXAB 1YYLL 4GG6A 4LCWB 2AKRA 1TQCB 2ITDB 5ADPH 4ZOAA 4GW5B 3C5ZC 4DEPB 4NZTL 2NXZD 3OF6D 1T7ZA 3ARSA 3RWJA 1BQSA 1MFEH 2F9BT 2V7NA 4PJEB 1J5OL 1S9WB 1JVKA 3BESR 4Y1AD 4F37F 4OCSL 1BEYH 1FNGB 2FEEL 3JWOL 5DD3H 4YHYC 1A4KA 2H32A 1RVFL 4I2XA 2BZDA 5ALCL 3RL2A 2CRZA 5ABDE 1LEIB 3F58L 4WFGE 5DDHB 3L3KB 4RGNE 4Y7MA 5GZNC 3O9WD 5KN5B 3SJVE 1I9IH 1NCCH 3PWLA 4RMTA 5AD0B 1WCBA 4JY5L 4WUKH 2VDRH 3GSXB 2J5LB 5EA0L 3UJIH 1QYGH 4XNXH 4K9EC 2VISB 3SCMC 4Z7WB 2MOVA 4P2OD 1MCBA 3B9KA 4ERSH 2VE6A 3HPLB 4K9EH 5E9DE 1E27A 5IHLB 2WQ8A 2GJ6B 4WO4C 2HT2D 3BO8A 3S96B 2V5SA 5C6TL 1JPGB 4GRWB 1IC7L 1NC2A 1UGNA 2DQUH 4FZ8H 6FABL 2IMMA 4JEGB 3BPNB 3MJ9L 2EZ0D 4GXUN 4OQTL 3VG0L 1T21B 4L4TA 2A6JA 5DR5H 3VXRA 3CVIH 2XI9A 4MJ2A 2ARJA 3DX6A 4JN2A 2X4RA 4HV8B 5JMRA 1W72H 5LQBL 4PJXF 4C4KT 1T80A 3FQXB 1XGYL 1D5XA 3ZO0A 4Z95H 1JV5B 2WBJA 2YRLA 4AENA 1QFWH 1Q94B 3I2CH 2BY0A 2WZPD 5GRWA 2XZQL 4O02H 3PWVA 4RFOH 3RWFB 1SJVA 3TT1H 1QVOA 2AAVA 2DOCA 3GSNL 2EDXA 4HS8H 2DQEH 1TJIL 3BZ4A 4LCIL 4MS8D 4NRYB 4MQ7B 3U9UB 3KXFA 1UXSA 2DQCH 5HHNB 5IEKA 5GJTL 1OVZA 2ATKB 4KXZI 3ZL4L 5EU3B 1RHHA 2BVEA 3QXWA 4F7PB 2F5AH 4JVWA 3SKMA 1A1MA 4L4VE 4I4WB 5IV2B 5ILTH 1OWRM 3GK8L 3WXVL 4AIOA 1BAFH 2YD6A 4UV4L 2QQKH 2B4CC 4NC2B 4N0FA 2NTFA 3S35L 5I1DA 4JB9H 3BKJL 1SY6H 4Y19E 5FA3B 1K2DB 1D5MA 5FK9B 4H1LG 5BS0D 3ZTNL 3ULVH 4CNIA 1U8OA 5K9QG 3CJJA 4E42B 3N85L 5L2KA 4I18C 3SE9L 1TXKA 2EEBA 1LEGA 3KYNB 3D9AL 1CBVH 1GC1H 2Y6SC 4FP8L 5JPNB 2EE9A 3B8SA 3H9SD 3RVWC 1BQHB 1A7BA 1JHTB 4YHPA 2QHLA 5DK2A 3QRGL 3LEYH 5JZ7C 4MD4B 4L4VA 1VGEL 5MEQB 1F90H 4RZCA 1MCWW 4MXWH 3I6KB 3HZYB 1LO0H 3LKSB 3OXRB 4FQ2H 5B3JF 1DLFL 1IBGL 3K74B 1T1YB 1E4KA 2RGSA 2R0ZL 4HC1A 4TTDC 4KI5D 4LBEA 4M7KL 1RZIB 3P30H 4Y19A 5HHXL 4HIIA 1MCEA 4OM1H 3L3HA 1LE9A 1AP2B 4UV7H 1ZS8A 2IAMA 2WBKA 4LKXB 1F97A 1ZSDB 4XH2B 2EXWC 4XHJD 5LJYH 1B88A 1XT5A 2AV7B 2DMCA 3GB7B 2NZ9C 3NAAL 3NFPA 1AC0A 3QSKB 5BV7L 4NQTA 4Q0XH 5HDBE 2I9TB 5LGJB 1UH3A 1OP3K 5IOPB 2GYSA 4M03A 4OZ4A 5IHZB 3IDMA 1WFOA 2EIBA 3QXAA 2FJGB 1CE6B 4KDWA 2EDKA 2ZG2A 4PGZA 5EOCJ 2XY2A 4D0CB 1XH3B 1MCOL 1HQ4B 1AR1D 2DLIA 3O0RH 5DYOA 1KELH 3HCVA 5EIIB 5D2LB 3T0EE 3C60A 4L29B 3VFSB 2JB6A 2VITA 1GAFL 3TH3T 5E94A 1VCAA 5D8JH 4XC1L 3C5SA 4MNQE 3MA7B 4YGAB 1KGCD 4U1HB 3BP6B 5E6IA 4MNGB 4U1JB 4QKXB 3BEVB 1OGAD 4NKDA 2O5XH 2ZZUT 3O3BA 4MWFB 2XG5A 3OKDB 5E08L 3MNVB 4AH2A 2VXTL 1XIWD 1XR8B 4JFQB 4YX2L 1MRFH 4LSDA 1NBYB 5LCVH 3RWIA 2GUOB 1F58H 1B0RA 4UI2A 4F57L 1S7VA 3NN8A 1NSNH 4RFEA 3T09A 4DVRH 4PRPA 5F7DB 4I0PB 3ARGA 4EOWL 3HUJA 1WZMA 3VXQA 4NQCB 1LP9F 3PWJB 5FOJA 2DLFH 1ZE3C 2X1OA 4R90H 2FGZA 1MHEA 3IVKB 1DDHB 4HKZB 2IQAA 5D5MA 1A6TA 1SMOA 1YY9C 3OZ9L 3RGVD 3S4SB 4ZUTA 4XMKL 3BW9A 4WUUD 3SOBH 2HLAB 5HI4D 2AGJL 4NZRH 1FFQA 5IESH 3UJTH 4YE4H 4Y2DB 4I0KA 5CZXD 2AXFB 2AJUH 1S9XA 3ZKND 3RY4A 5FYLL 2J3SA 1N8ZA 4JRXA 3BD4A 4C57C 2IANA 4XBGB 3CH8A 4NN7B 2R2HB 5DA0B 3U36B 4FQ1H 1PBYA 3KPOB 3WNKA 3GSVB 4NQXB 5F9AC 32C2B 1RD6A 5E00A 4KC3B 4GKZB 3FL7A 4Z6AT 4NN7C 4ODBD 5DTFB 1T1WB 4P5KB 4WW1A 5CJ8A 4NM4H 4HAGA 3FQWB 4GRMB 4BFBD 1GZPA 2XN9B 1FVDB 4GAFB 3L7EA 3REVB 2GTWA 4KTDH 1QSEE 1IGJA 4HXBH 5J1SC 2AK1L 1UC6A 3AREB 1AGCA 1CICD 5ADOL 2ZSVA 4F33B 1AI1L 1WEJL 3TBTA 3DO7B 2QADB 4HWZB 1G84A 1JPTH 3OAUH 4P4KD 4X6DB 3RUGA 1S3KL 2B1AL 2IPUG 4OLXL 1W72A 4ZQKB 3C2AL 5E70A 2OI9B 4QYOB 4MXVE 2SEBA 3D87B 3W39A 2I25N 2R15A 2HT3C 4HWBL 3NZHL 1IZJA 4Y5YA 3MUGA 3VWKA 1MIML 5HGDB 4J4PD 3DIFB 1YNTA 2EXYD 5HPMB 3PWPB 5ERWB 2FNBA 1MFBL 5J6GA 1JRHL 3W11C 1LO4L 2ICES 3QDAA 5HSFA 1BQLH 2XTJD 5T1LB 5HVWA 2I60L 4QTHA 1J1PH 1QSEA 3ZYJA 5SWSB 3U30C 3NGBB 5EZIL 3HZMA 4MJ4A 1RMFL 4O2FA 4X7TB 4WWKB 5E2TL 5I76B 4EN3D 1MLBB 1KT2A 3FMGH 4UQ3A 4BQBA 2YD7A 4LHUA 1NAMB 2BHUA 1HYSC 3QCTL 1E0OB 1OAUL 4PB0L 1U92A 1MI5E 3D0VB 4JKKA 5FYLE 1D5BB 2F74B 2DIJA 1A9EB 1SY6A 3BKYL 1DQQA 3W9EA 1INEH 5FM5M 1UZ6E 1C1EH 4ZS6D 4NOFA 1BFOA 5DJ2A 2YPLB 1V7NH 4FZEH 1DUYB 2GK0A 1NEZB 3O8XD 3WCYA 4PP2B 4XVUD 2XNAA 2BVPB 1G7HA 4I18A 4B53A 1KB5L 5E7BA 4M1CD 5DUML 2ENYA 3RAJH 4ODUA 3NPSB 2YMXL 3QWRA 3VCLA 1CIDA 5EOTA 2DQJH 4R97B 3LRGA 4I8DA 3NPSC 5HI5C 3B2UD 3KWWB 1G6RB 1SVZA 4QHUB 43CAA 4BJLA 1CXIA 3DETC 5D6DC 5FHBL 1EZVY 4H1LB 4W6XB 3VXPB 2VLRA 4HUKB 3STZB 4AIZA 3O41B 3QI9B 1CFTB 4WIQA 4P2RB 5EORL 5D7KE 4OAWB 4G8IB 4GKOA 1PLGH 1UJTA 2RHEA 3VD9A 1NC4D 4U7MA 12E8H 1T2XA 3H3BC 3OJDB 4WFEE 5FO9B 3MLWH 3FRUB 2R0WH 5GGQL 3KPSD 4HCRL 3IS0X 3EO0B 3KYOB 1KXVC 3IDXL 4PJIA 3HMWL 1II4E 2CSPA 2NX5B 4M1GL 2C3WA 2G9HA 1Q9WB 1G7PB 4XWOC 1T4KB 4IM8A 5FA4A 1ZXQA 1UKSA 4RCAA 4NJ9H 4FQXC 1KXQE 1NFDE 4PJFF 4HIXL 1FVEA 4R7NB 1U6AH 4OCWL 4PJXE 1CYGA 4NO3B 5IB3A 2ZNWA 1MAKA 1R6VA 2FWOB 4K3JH 2WWKO 3RIFK 2EO9A 3N9GH 3TFKD 15C8H 3MBED 2FX8L 3WIFB 1XCQA 1EAPA 4F7MA 3DRQA 4AEIL 3UYRL 4J3WA 4X7DC 2YPKB 3PHQB 2DJUA 4IIQC 4WJ5A 5EFIB 4PJGF 4QLRA 1ZWIA 3MV9D 2Y5TA 4HWNA 5I18H 3HG1E 1YMMA 4XPHH 2A2QT 1WBXA 2FCBA 4XCCL 4M9PA 1J1XH 3GIVB 2X4OA 2AABL 4YFEA 1REIA 4Z8FH 5KVDL 1CDGA 4IMLB 5E8PA 2AEPL 2MSPA 1NLBH 2MNUA 3CZFB 5E6YA 4OLUH 4OM0H 5A43C 5H94B 3T3MF 5ISZD 3MGOA 3FFDB 2AS5M 3CSYA 2VR5A 1OF2B 4JDVB 4K7FA 1YEKL 2M26A 4JFXB 4F8TA 3KLAB 4WU7B 4BSVA 5M94B 3EUUA 3MCKA 3GSWB 1NMAH 1MEXL 3QPQD 4JQVA 1A7OH 4YLQT 2NY4D 1FG9C 1P7QB 2NY6D 3QXVA 2W91A 3AXLB 5DQJA 4ALAH 4G8EB 1URLA 3C6SB 1WITA 4JM4H 5ETUA 3MNZA 4M5YH 3HG1A 5D7SL 4CGTA 3VH8G 3BDYL 1S9VA 3IDIA 4HLZG 3SKUD 5CEZH 3K80A 2IQ9H 3GMLB 3T0AA 1QQDB 5I30H 4O58H 1I1YA 1S7WB 4HPYL 5KAQF 5I1LB 5IEHB 2ESVA 3KPMB 5ANMA 4BKLB 1VENA 3KJ6L 4DZBA 4FXKB 1U8NA 3RNKB 4NQEE 1PKQE 2VC2H 4LPCA 5B3JE 1SEQL 4AY0A 5BVPH 3ARRA 1QD0A 4UILL 4XNMB 3U4BH 5CJQL 4TNVK 4M7JH 4GW1A 1E4WH 1RULH 4NWUL 3P40A 4GMTH 1QPXA 4PY8J 2EYRA 1YEJL 3ARPA 4JO3L 1T1ZB 3K8MA 1R3HB 2YD4A 1OPGH 1KCRL 3GKWL 2L4OA 5GS2D 3S98A 4G8GD 4YQXH 5ITBH 1GJIA 5J1AA 1N5AA 4WI3A 5E4IA 3SDCA 4CJ1A 3BEWB 1WQVT 3G6AB 1YEDB 3KVQA 4H8WH 5F88B 3U0WH 3FO1B 1N0LA 4I5BA 1U3ZA 4CU7A 3BUYA 4ODXA 4YDKL 5IMKB 4FFZL 1D5IL 2WUCH 2VLMD 3T2NL 2XT1B 4HBCL 4JO1H 3MRDB 2HN7A 1VPOH 5BJTA 2CO7B 3GMNA 1INDL 4GMSL 4JN1L 1AQKH 1MVFA 2A9ML 3UTZA 4K94L 4LRNH 3MRQA 1FFRA 1MREH 4WGVB 4Y8DC 1IFHL 4BK5A 1ND0B 4HT1L 2R9HC 3QEUB 1ORQA 4CW1B 3IFLH 4G8FB 3LQAL 3FQRA 2D7OA 2DQFA 3SKOA 3C6LA 1D6VL 4MJ6B 3CMOL 5HXMA 1HCFX 3NCJL 1Y0LB 4X9GA 4FQLH 1N6UA 3AS2A 1FL3A 1RIUH 3BGMB 3E3QE 5JNYA 3WFCL 2R39A 1VEPA 3TBWB 3HE6A 3UTQB 3BPLB 4TUKH 4TRPH 1TCRB 4BSWB 4P9MH 5BCAA 5GS1A 5KS9A 1JGEA 3NA9H 2VDLH 2XIDA 5EPMB 2OSLA 3WLWC 4G6FD 2JLLA 4DN4H 1F4YL 2D4DA 1FE8H 1KPRB 3B6SB 4PTTB 1MFDL 5C0IA 3BPLC 1LP9E 5E1AB 4O5LL 5I1GH 5DZOA 5ENWB 5DO2D 3TCLB 1N7MH 4E41E 1AJ7L 4X0KB 1I7ZA 3TCXA 4UOJA 2X4PB 3D1MC 3EYUH 4OZFH 4LHJB 2OTWA 4J3TA 1EAJA 1OTUD 2C1PA 2NXYB 2J2ZA 2MQCA 5EO0A 3QDJE 1SYVB 4W4NA 3MCG1 5FECB 4XVTH 3LKOA 1AH1A 4HJGB 2AJSH 2MKLC 2E7CA 2HTLD 3O2DH 5DRWB 5EZOL 4M8VA 5C07E 2NXYC 4HLJA 3Q6GL 3IDUA 5IMMB 2ZWLT 2CLRB 1UB6B 4UOW0 3U4EB 5IKCA 3MV8E 4H88H 3BKCH 1T04B 5EBWB 2X40A 4MCYA 3J7HA 2XA3A 4KK8D 4MD0B 2NY2B 3MGTB 1ZLSH 1OAXH 4RBPH 3FQUA 4JFDA 2EH8H 3KNBA 3F7YA 5GGVL 3TGXA 2PXYB 1FZJA 2JIXB 5TDNA 3KYMA 4YK4C 4IOFC 3K8LA 3L5JA 3QNXA 3BOVA 5AYUL 2ILLA 4OF0A 3QIBD 4OKDA 3S5LG 2GY5A 3QO0B 4E41A 4UNTA 2MPAH 2EYSA 3CFIC 1QR4A 3GGWA 5FCUL 2FL5A 2PXYC 3HI1A 3PL6C 3FO2B 2GAZB 1S7SA 2LU7A 3QDJA 1FO0L 2DWEB 4HWEL 1FDLL 4GBXC 1E6JH 5IF0A 1OSPH 2P8MA 4WNQA 1HHHB 1I1AA 5HYSG 4U6TA 1RQ5A 2ADGB 2VTFA 4D3CL 4TN9A 1FYTB 1MFAH 3NABH 3AMKA 3FTGB 4YIQA 1QBAA 3SDAC 5T1MB 5K9JH 4ZFFA 4Y4HC 3O4OC 3OQ3B 4UIMA 4PJ9B 2I07A 3MODL 3E2HC 1ZLUH 3WHXB 1X6LA 5JR1H 5EDXA 3WUWB 4RISH 4M6OH 2WWMC 4KVCH 1MRCH 3LKPB 4J8RA 3ZDZE 4WHCA 1EEUA 4QRRD 2BVOA 2AXJA 4XPFH 5D72L 3WKMH 5KVGL 2P7TB 5F9WB 4NC0B 5SWQB 2YXFA 2OQJB 2ZUVA 5C0EB 1Q72H 5C7XL 4YHMH 1JNHA 2BNQB 4QT5B 5F9WC 5B4MC 3RNQA 4WY7L 3VFNB 5I8OL 1FV1A 2OL3B 3QZWG 2P8LA 5D7LA 3SE4A 3I6LE 1K4DA 4PG9A 1JWMA 5EO1A 1I7UA 4QEGA 5D6CB 4JAMB 5CSZB 5JPMA 3QFJB 3WFEL 4MCZB 1U8LB 1MFCL 1PY4A 3PGFH 4Z5RB 2EIDA 2UY7A 3ZYIA 1FN4B 4YZFE 4QRUA 1JPSL 5LWYL 4H5SA 5CCKL 1AQDA 4OTXH 1MCPH 3QUXD 4YHKL 4YWGH 5CHNA 2Z8WC 5FO7A 4TQEL 4ONHA 2ZJSL 5DRXB 2CLVA 3NA4A 3IDJA 2X4TB 3GSUB 5MENA 1KIPA 3CD4A 2ICWB 4PGBA 1T7WA 1M7DA 2CKBB 5AZ2H 5ACMA 1FGVL 1FIEA 1TLKA 1L0XA 5D93B 2DTML 2FD6L 3GSQA 4LLMA 1S7XA 1MHHB 4UT9H 4MXQC 4X4ME 3BIKA 5TH2A 2PYEA 1VFMA 1QLFB 4WI5A 4PJEF 1P4BL 1YNLH 2HVKB 5IJVA 4JFZL 4NKMA 5D93C 4JM2D 3IB4A 2CIKA 1DEDA 4YC2B 5GRVK 3CCHA 4MHHG 3R06A 2F8XC 3MXWL 4QTIL 1IAIM 3C8DA 2HFGH 3QG7L 4RIRA 5DJXA 2DDQL 3H0TA 3OKNA 3WD5H 3OKMA 2BP3A 4YC2C 1IT9L 4PRHA 2WV3A 4F7TA 1BPVA 3BWAB 4XGZA 4HS3A 4Y4FA 4ZXBB 1KCLA 4G3YH 1KEGH 4K71C 5HHVH 1IGIH 3UTPD 3GJEA 2DYPB 4ZAKD 4LFHG 1FNSL 2IPKA 5IFJA 4DGVH 3R1GH 1MJJB 1RURH 2BXYA 3QO1A 4M5ZL 1KEML 1OSZB 2V5TA 5HGAA 4F3FB 3ZYOA 3QRFM 4ZXBC 3VH8B 5K9QI 1MHCA 1BVZA 2AK4E 2MCG1 3T1FA 3L5WB 4MQXC 1ZA6A 3LEVL 2H3NB 3EJJX 1CDIA 4GRWF 1M05B 2HJFB 2XQBH 3HZVA 3MJ8A 4P5MA 3ULUF 1T0NB 2XFXB 1DR9A 1HIML 1UWEH 2CJUL 5DLML 1I4FB 5LBSH 1GGBL 3OAZH 3TO2A 1NEUA 1P53A 3PWUA 5KSAD 2APFA 4PJFE 1ADQH 4KKLC 3KHQA 5T3ZH 2Q86B 3B9KD 1DQDL 1NDMB 4X8XA 3ZMRA 2CUIA 3TPUA 4YHZH 5DZLA 1I8MB 1N2RB 1KNOB 4ZFOA 1IGFL 3HAEG 1I8KA 3V8CA 3GSOA 1KCVL 4NGHL 3TJHC 5F7HA 4OUUA 3WL9B 5I1AA 4Z0BL 2FHCA 5A2LH 4DAGL 1K6QH 3HI6L 4BH7B 1LO2H 3ES6B 3KLHD 3ARDC 5C1MB 3H7BB 3KJ4B 4IJ3B 3BQUA 1CD9B 1EHLL 4DVBA 2B1HH 4WFGD 4Y8AA 3TIEB 3BP7B 4XRCB 5L7XH 3SJVD 4M62H 2W60B 3RPIB 2NW3A 4PJ5A 4NDMB 4CU6A 2B7DT 4R8WH 1AO7A 3DJ9A 3VWJA 2C3GA 5T1KA 5F1OB 4K7PX 4S0SD 5IW3A 5E99H 3DI3B 4NO0B 2B5IC 3T3ME 3QHFL 4JFFB 5DVMA 5IVXB 3VXMB 5E9DD 4JR9H 1BD2E 2G75A 4O51B 2ZCKH 1G9ML 5FYJH 4MD5B 2J88L 1RIHH 2V9QA 1D6EB 3MRBA 5A2JH 3TH4T 4L8CA 1KACB 3GHBH 1JF5A 4PY7A 2ZOLB 2EICA 4OZFA 3UCRA 3DSNA 3DX7A 1HILA 2CK2A 2FEDD 3CH1A 5F3BA 4PLJD 2PYFB 4PJGA 5DJ6B 1U8IA 4NCDA 1P5UA 4YBLC 2Z8VC 1MIEL 2V7HB 3EYVB 2VLKA 5TFSL 1I3GL 3O2DA 1SM3H 3TNMA 1QUNA 2D7PA 1YUHA 3L1OH 1X9QA 1AXTH 1NQBA 4H26B 3V4UH 4EJ1C 3EYQD 3W9DA 4MDIA 3MV11 5BZDA 4Y2OA 1FYHB 5IW1B 4HKJA 4MB4A 2QQLH 5EOQL 1GSMA 4AEFA 3P0YH 2I9LA 1MF2H 1ZA3B 1U3HC 4F58H 3IKCB 4P4RB 5HHOB 2AV1A 3PHOB 5FB8B 1DBJH 5KZCB 4Y5VC 1SBSH 5E2UH 4FNLH 3RX5A 1LNUB 1IGML 5DD0H 4LSUH 1NANH 4G6JL 2ICEB 1OWWA 5ITFB 3RVTD 4L4VD 5DC4B 3TV3L 1RHFA 2Y7QB 4JFEB 5ID0B 5A40E 2XG4A 4Y0GA 5C0GA 1A6VH 3W2DH 2X42A 3KPLA 4UAOB 2A6KB 4WHTB 5HI3D 5E56A 4OLYH 4HGMA 2OP4L 2R0KL 4KRNA 4KJQD 3G5YA 1T89C 3LS4H 4Y19D 3LOWA 4UBDC 4K2UH 3CLEL 2Y9RT 3EOAB 4I9WE 4RAUB 4UAOC 3SDAA 4BH8B 3FKUS 2QQNH 3CDFA 1FZMB 3S5LB 1NGWB 5CD3B 3FFCE 5A1AA 5A16B 1IGTB 4HJ0C 5GS0C 5CSGA 4L5FL 1BFVL 5D2LF 4JFOA 2R1YB 3WEXB 4DW2L 3PIQA 5GS0H 4IHOA 3B2VH 1R24B 3EDFA 5D9SB 5GGTL 5BVJB 1C08B 4BUHA 5HVFB 3VFGL 1UZ8A 3BIAX 4JPKL 4NBXB 1YN6B 3P9LA 1U8PA 4M61A 1YMHB 3TYGL 2JK5A 5HYSB 3VD4A 1K8IB 4QGTA 1T3FA 4I3RH 1X44A 3RHWF 2DBLH 4G42A 2VDPH 4P57B 5EWIL 3OGOE 1TQBB 4GRWH 3C60D 2OK0L 3ULUH 1KPUB 1BJMA 2BOCA 4O4YH 3UTSA 3DXAE 2A6IB 1DANT 5SV3A 4M43L 1PD6A 1ETZA 4PTUA 3V52L 1Q0XL 2N1KA 5EU7E 4NN5C 3O3AA 2EDFA 4O9HH 1MRDL 1DP0A 5JHDB 4NIKB 1R3JA 5E6ID 1CF8H 2NLJB 1AKJD 4M7ZB 3ME0A 2ITCA 4NOBA 3A0OA 3ZT7A 1CS6A 1N3NA 1INQB 3FN3A 4PRIE 1OAQH 4XMPH 5F1IA 3IDNB 4NJAH 5TE6H 4BM7A 4TTGA 1MWAB 3QZWB 4OF7A 3INUH 4IDLA 1E4XI 4CADB 3I9GH 1EH9A 1AE6H 1EO8L 5KSUA 2P4AB 3ZT5A 3CNKA 1BWMA 3ARGD 4KK6D 3QDGA 3T0ED 4AG4L 1F3JB 2QL1A 5I1JL 2G60H 2X70B 4PY8I 5I1KH 3P0VH 1R3LB 3QNYB 2KDGA 2HWZH 3PQYE 2BVQB 4OZGB 3CGTA 4L8BB 2YUWA 2XY1A 1MFEL 2BC4A 1OTTD 3OGCA 2R56L 1F00I 2FYYB 3S6CA 3ZE1E 2D3VA 2XWJA 3GSRA 4UIKL 1PG7W 2A38A 5D1QC 4KZDH 2F58H 4UUJB 2R69H 3BHBA 3T2PA 3FN0H 4HF5H 4NNPH 2VZSA 3PE9A 4OZHA 4GQ9L 4KAQL 5HDQL 4WTZG 4JZNB 3S34L 4JRYA 3D69A 2IPTL 4LARH 3D3VE 3P3YA 3SQBA 1OTSC 4LLAA 4DOHB 1JWUB 2W07A 1IKNA 4TUOB 5ACZA 2GHWB 3OKEA 1J86A 1DQMH 4NKOA 4LU5L 3HS0B 3IAPA 3RX8A 4QRPE 1CDCA 1EZVX 1ADQA 4J1UA 3F65A 2LTQB 4KMTL 3VXSB 5J3HD 3IU4L 4X6DF 3K7UA 3PQYA 5FUCC 3AS1A 5D70L 4KK5D 1DVFD 5FYJE 4FHBD 4LLYB 5J4MA 3P77A 2R29H 5DRNB 5IVZB 2R23A 4RGMC 4YAQA 3NCBB 4XWGH 4D8PB 4UINL 4O2EA 4KUCF 3TZVA 4XNYH 4KWUA 3TN0A 3OV6A 5I8EB 4G80A 1W72L 4MQTB 1P4IL 1QOKA 1CTNA 4Z95L 1K3ZA 2Q76B 4ZSOA 4HIJB 2WWKT 1SHMA 1E28B 3ARDA 2DM2A 4OUOA 2QSCL 3TESA 2AJVL 4CAGA 4YBQC 1PAMA 3A6OA 3IXTA 1BZ7B 2VIRA 3E6HB 3VWKD 5CD5C 3P73A 4IRJD 4EDWL 1PZ5B 3IJSB 1I9JH 3HAEB 5DXWA 3BJLA 2JTDA 5DJCB 3UDWA 4QNPE 2Z91B 4A6YL 1QSED 2JCCA 4LRIC 2H1PL 4MNHB 4NWTH 4YO0B 3SN6N 1KLUA 1CLOH 2YC1B 1BVLA 4Q9QL 4Q2ZB 2VH5H 3MACL 2FIKB 4LCWE 4JRWA 2VLLA 4FFWC 2YZ1A 3BJ91 4WV1B 2JKXA 4P59L 4JB9L 2B4CL 3MRHB 2XKUA 3RDTC 3LN5A 4JFPB 1SY6L 5DEZA 5B39G 2JELH 2UYLA 4PJEE 4Z7VB 4KDTC 4D0DB 1JZ8A 1HINH 2APWA 1UCBH 3P11H 4UZGA 4V1DA 4ZPVA 4APQA 5C0CA 2VXUL 2AJXL 3JWDH 1F6AA 1XF3A 2FB4L 4X6BA 3QUYD 3EW3B 4OGYH 2YOCA 1Q9OB 4G7VH 4GUPA 5I19L 2OR9H 3VD5A 3I3DA 3QCUH 1ZGLA 3H3PH 3VGHA 4OKVB 3DVGB 1NBQA 1FORH 1U3HA 3AGVA 3LZFL 3HLAA 3CFJA 3N1FC 1TZIA 5HYJB 3HRPA 2W65A 3DGGB 3VJ6A 3QWRD 1QKZL 1MNUH 4MXWL 1FNEA 2EDDA 5D1XC 4NC1E 3ARBA 4QOKA 1EEQA 2GJ6E 4WCYH 1XEDA 1ED3A 1F3DH 4GRWE 2IGFH 5HJ3B 1MI5D 3IFNH 3W0WA 3ULUE 4PJEA 1S7UA 4R3SB 4R7DA 5FYLD 1S9WA 3AM8C 2XV6B 3V0WL 2BX5A 1T7YA 1BWWA 2D31B 4H0HB 3T65A 3THMH 2V2WA 2DKUA 4LCYB 1M7IA 5DHVB 1IQDA 4ENEC 2OTUA 3PF2A 1F4XL 3LVEA 1ZT7B 2DQHH 5C09B 2B2XL 1BZQK 5TF0A 3EO1B 3SGKC 3RZCB 4HH9B 1J10A 2CDFA 4KTYA 4WI6A 5C0DB 2DQDL 5FKAB 2EEDA 4LCUB 4U05A 2YKLH 4MAYD 4MA8L 1Z9MA 2VUOA 5IHUL 1FBIL 1FZOB 1H5BC 3HPLA 3QQ4A 4ISVB 2EIZA 5L6YH 1KFAH 3QEHB 2ICCA 2E27H 1P7KB 4RNRB 1Z5LA 4NRXB 3UPCA 2V5MA 4JGUA 4PJHB 4XCYA 1T21A 1XGTA 2C1OA 3QPXH 3MRKA 1VSCA 1G7JB 5FO8A 4WFED 1K5NA 4HMDA 3EO9H 4ZOEA 2XPGA 2YBRA 3RTQB 4OSUH 3QFDA 3LQZA 2FDBP 3TWCH 3HNTL 3WS3B 3QG6A 1SQ2N 1RIVH 1BM3L 5IR1A 2Q3ZA 1OM3L 2R4SH 3V5DB 5F70A 3QDMA 3RTQC 3QJFA 4IBLT 2ZOKA 5DFVD 4MQ7A 3GBNH 3RBSA 3RKDC 4EXKA 2P49B 1PSKL 1FZKA 4QHKJ 4YDVA 4GQPH 1NCBH 2ED7A 3QH3A 1NGPH 2X4NB 4M7LH 4CDGC 1NCDL 4JREC 5F9OH 4UDUB 2J1KA 2NXZC 2VDOL 1A47A 1FIGL 1WICA 1NAMH 3SOBL 1U95B 1KN2L 5AYQA 4PJAB 4AMKH 5JW4M 1KCKA 3R4DA 1HHIA 1L6XA 3B8YA 3HG1D 1A6ZA 2VQ1B 4XX1G 3RPKA 4ZPTB 1TJHH 3ULSB 1U91B 3DUUA 2Z31D 4W81A 4YUEL 3O9WC 4MJIB 2Z35B 2ERJC 3BE1H 4P0DA 4DTGH 1A7PL 1CXKA 1IEBB 4E42A 4MYWB 1PX3A 1E4JA 3MA9H 2E5EA 1AY1L 3KYKH 2NY7H 3QHZL 2CIIA 3E0GA 5IB2B 1N4XH 4NUGH 4QHMA 5DA4A 5EO9B 1KJ3H 5ICXA 3BH8A 4P2OC 1JYXA 5IMOA 3D39A 3U48A 3QIUB 4MMXC 3DV6B 1KN4H 3EDJA 5EOCL 1J8HA 2EYTA 2VAAA 4R26L 1LQSR 2HT2C 4XCNB 4HBQA 3I6KA 3I6GB 4FA8A 4I48B 3S37H 3OXRA 1G6RH 4GJTB 1FFPA 5D2LE 2EZ0C 5ALBL 4D9QE 1T1YA 3SDCD 1GIGL 1OD9A 3LRSA 4PUBL 3U82B 5GSRB 4DKFL 4HG4K 4RBPK 2XTLA 2ZUYA 2D0HA 3O2VH 4KJYB 4LLVB 1WCQA 1CR9H 2OCFD 2PUQT 4MNGE 43C9A 1FPTH 3SGDH 1EO5A 2ADFH 1ZSDA 3GHEH 2KL6A 3MOQA 4F2MB 3NACH 1RJLA 3O45B 5I17B 5IT2H 2UWEB 4NQED 3BZEA 1XGRB 2DM3A 3U0TA 4X6EB 5LGJA 1A7QL 2AEQH 4XP6L 3GSNB 3QT2A 5B38A 4GKNA 5IHZA 5GXBB 4KHXL 3QP3A 2ZUQC 3CFBB 3VDBA 1EHXA 2LVCA 2EDHA 1EFXB 4PJ7B 4HSQA 2WUBH 1L4IA 3V4VH 3C6LD 3IFPB 3IGAB 1Z3GL 1A6WH 1HXYA 1J0IA 3VFSA 3LSOB 4NQCE 2EDTA 1NBZB 1VFUA 1R3IH 3NVQA 4RQQB 1PG7X 1ZLUK 1MAMH 4M4RA 2D4FA 5DS8A 3EJYD 3KPPA 3HE6D 3VI3F 2YUXA 5BS0B 7FABH 1LO5A 1MCLA 3HRZB 3RDTA 2PW2B 2BNUB 4OLWL 2JJSC 1ACYL 4HDIA 5D4QA 5DJDA 3VMOA 1VFBB 3JZ7A 3HC4L 4P5TB 2J12B 3QQ9D 3MNVA 4U6YB 4BZ1L 1XR8A 3CFCL 2VXVL 1P5VA 3KR3H 3WO3B 1TVBB 2H26B 5F93C 1T7XA 5E8DL 5GGUA 5BQ7B 1QG3A 2R2BB 2P5WA 2HLFD 3HE7B 4NQCA 3CU7A 4KKNA 3EOYG 3UBXA 1WISA 2XN9E 2YSSB 2HJKA 4UTBH 3TBSA 1CFVL 4CMHC 1YC8A 2H8PB 3L9RA 5GRUH 1PG7L 5E5UB 5GZOD 3NFNA 1NH6A 3VFMA 1DBBH 3MLUH 5AWNH 1BOGB 3ZHDA 2HLAA 4UTAL 4LNRB 5GRJH 4GLRI 4JVUA 2E7LC 1N0XL 4U6XA 4KKCD 4X6DE 3W5MA 5T5FH 4E41D 2CR6A 3MFFB 4XHJC 1YEIL 1BFTA 3NCYP 4MHHI 4KJWD 4OZIB 3F6LA 1HKLL 4QGYA 4YXHH 2DQGH 3BPCA 4UT7H 4P46B 3QDJD 1WT5A 3SDYH 4GKZA 25C8L 4LVHB 1IC4L 4XAWH 3BVNB 4HGKC 5DTFA 1MY5A 3VE0A 5C0JB 1I1AD 2FO4A 1L7TH 5C07D 4OCRH 3PWPE 4QXWA 4P46C 5JOEA 1YYML 5F1NB 3V95A 5CJOH 1S5HB 3MV8D 3O4LA 1H5BA 5TQ0L 4K3JL 2ORBL 4PV9A 3LH2L 5SWSE 4ZNEA 3AREA 4RMWA 4C56B 3SGEI 2ADIB 4EQ2A 1OGAB 3MRMA 4GAGH 4OLZL 2XRAL 5CKGA 1U9KA 2YXMA 1A4JA 3X12B 5BO1H 4XP4L 3LB6D 4XNZC 2NMSA 3V5KB 5I18L 1PJ9A 1MCSA 3VXOB 4ZQKA 2KH2B 4J6RH 3EOTH 5L9DL 3OAZK 2C4XA 4IS6A 4XPBL 5CGTA 1CD1A 3H9HA 1XIWC 2KQNA 2YPLE 4M48H 3TT3L 2VLJA 3QIWD 5ERWA 1U3YA 4G6KL 5F7UA 4LKCA 2RBLA 3HHRB 4GXVH 4OF6A 4OIAA 5I15H 5H35B 3BH9B 5SWSA 3O6KH 5I76A 2P5EB 3LQMA 4XPTH 3WLBB 5JQ6L 3DTXB 4A2MA 1RZ8B 5TQ2L 3CX5K 3MUHL 3RGVC 2Z8SA 3EDDA 3Q1SH 5FFLA 4HIHB 3O6FA 1NAMA 2F53B 1N64H 4JO4L 5B8CC 4NHUA 4OQ1A 5DHYA 3OF6A 4EUPG 2Q6WB 4I77H 3G5XB 4U7SA 2DQIL 5HI4C 1DQJB 4HGWB 4U1MB 4GH7B 4U1SB 2PETA 1TPXB 3ZT6A 5CZXC 3NTCH 4Y1AA 3ZKNC 2PYED 1HQRB 3PG2A 3VD7A 1FG2A 4P2RE 4YPJA 2FATL 1CI5A 2HVJA 2BJMH 2GY7B 3I6LD 1I1FA 2LU3A 5EC2A 3NCCB 1J88A 2V6HA 4S0TD 1NEZA 5BVPL 1VFOA 4RRPA 5E4EC 2BVPA 2CDGA 1J1OH 3EFDL 3UTTB 2VSDA 3GRWH 1XGPA 1RULL 2NX5E 3KPRB 1XF1A 2PO6B 3MRJB 5IBLD 4FABH 4Y4FD 5GIRA 1KSRA 3A67L 3UPRB 3M07A 1IAII 3SDDA 3FQTA 4P2OA 1WZKA 3OJVC 2YRPA 3X3FL 1NKRA 3KDMA 3RY5A 3SPVB 5ELIA 2X9XA 5DQ9A 4Y16A 4B7LA 1LMKA 1GZQB 1G6RA 5EZLB 1CICC 4JKLA 1I8IB 4HK0A 3EYSH 5EUKA 5JDSB 2RQ8A 5I1IH 1ONQB 4NQVB 4QXUL 1XF2A 1FSKC 3JBG7 4L8SB 5C92A 2RFXB 1CU4H 2BY3A 3O41A 3K1KC 1YNKL 5I74C 4P4KC 1T5XA 1F4WL 1OGTA 4G8IA 5H2BB 5H37G 4TVPL 1BBDL 5JA9A 1B6UA 4MX7A 5EZJA 2Q87A 5TGBA 4FN0A 4ZUUA 5C8JA 3G6JB 5IB4A 1ZOXA 4LVEA 1YJDH 3BP4B 5INCB 3KYOA 4OGZA 4TNWF 1U3JA 5D96B 1TETH 5DMIL 3HFMH 5LAXA 5F7LB 1RUKH 2NX5A 5F7YC 4J4PC 2EXYC 3KPQB 1G7PA 3EZJB 1AHWB 3FT2A 2W9LA 4U31A 4EN3B 2XTJC 3DSFL 4Z7NF 5D7JB 2G2RA 5CS7A 1U8HA 3VFVB 3VG9B 4R7NA 3OR7B 4EN3C 1VKXA 2A77H 3BQUD 5MEOA 1ZHLB 3ALPA 3O6MH 4NO3A 1L7IL 1DL7L 2AK4D 4OD2B 2FWOA 2Y36L 2YEZB 1Y18A 5I1HH 1ITBB 3WNLA 1NFKA 3VG9C 2C4FT 2D7NA 3V6OE 5IB1A 2CUHA 1ZHKA 3G08A 3NA9L 4NKIL 3VWJD 1AO7D 3HI5H 3RWCA 3CLFH 5CINL 4P9HC 4TSCH 3G9AB 1S7RB 3DI2B 4A2LA 3JTTA 4NPYA 3L5IA 3O8XB 5IBTH 2FRGP 4RDQG 3SE3C 1IC5L 2HKHL 1BGXL 3GEWB 5MEPA 4M7LT 4ZS6C 5DEFA 1WBZA 2NPLX 2WIMA 2JJSA 1WZ1L 3TJEH 3O8XC 2DLGA 1G0YR 3IJYA 3OX8B 4YHLH 4L9LA 4XVUC 1A7NH 4XT1C 4ZUSA 1KB5B 3GNMH 3DVFA 3OB8A 1E4XL 4MAUL 5ESQA 3CZFA 3CC5A 3QUZD 4M1CC 4ODHH 4XPAH 1KBGH 1NDGA 3FFDA 2WAHA 3SQOH 3H9SA 5DMJB 1J12A 3JV4A 4P2QB 4Z7OF 3BKCL 3U7AA 4PIRF 3KLAA 4TVSa 4YH6A 1LD9A 4OT1H 1J0JA 3RU8L 2FEEI 3B2UC 5E2WL 4NQDB 4Y5XC 4WDIA 3SDXA 4NQSB 1JFQH 2CKBH 4HFUH 2FHBA 4K23L 2Y06H 3SKJL 1RK0A 3P9WB 1UT9A 3QULB 5KG9B 3G5VB 4HMCA 4NZUL 5F9DC 2E7HA 4WFHE 5FYKL 3MREB 2Z9TA 1M71B 2EKJA 5EUOF 2CUMA 4HXAL 5ICZB 3DLQR 5DJ8B 3C9NA 4FXKA 1QSFB 1UWGH 3Q5TA 5DD1L 4NHCL 1OSPL 4X5XB 2NY1D 4Q6IC 1HH9B 1KJ2H 4XNMA 3I02A 4KVNL 1X7QB 3DYMA 4RX4D 3JV6A 3ZTJG 4JDTH 5BXFA 1G9EA 1MHPL 1RZ7L 1G9NL 4XPGL 1QEWA 1CDUA 1RUMH 3L3GB 1T1ZA 4LSSL 2AXGA 1X4YA 1DJSA 2JJUA 3DROA 3H8NA 3VXNB 3ZKMD 3C09C 3B9DA 3AB0B 4XPFL 4OF8A 2IFFH 4NN6B 1H3TA 3TFKC 2QBWA 5D1ZB 3MBEC 4D2NA 4ZTOL 2A83A 3V6BR 2VYRE 4WFFE 5KVFL 3MV7B 1J0ZA 4EKXA 2QR0B 5F21B 3O3DA 1YZZA 5BW7A 4NN6C 2HKFH 4OCNC 3LMJH 4HQQL 4DK3A 2BFVH 4PR5B 3TBVB 5J7CC 1NCAL 2JJTA 4HPOH 3LEXB 3DVNB 1EBPA 1RZKC 1QRNB 4PBVC 4OI7A 3GBML 5DD6A 3I75A 2IALA 4R2GD 3JVGC 2ATPB 1TCMA 4FTVB 4S1SH 1Z6JT 5IWLC 2VL5A 2DJSA 1XFPA 1XIWA 3VI3E 1UQSA 2OL3L 1B4JH 4G8FA 4Q9RL 1WTGT 4G9FB 4I9WD 3Q2CA 2NY4B 1DUZB 2Z8RA 5T33H 3TLRA 4HKBA 4YXLH 1G7LB 1PEZA 3DVIA 3ROLA 2OJZL 3FFCD 2GTZA 4LGSB 3QPQC 5FF6B 5C0AA 5HTSA 3ZE0F 5J0BA 5GGSB 2NY4C 2NY6C 4IMKA 3ZDXF 3LD8B 3H9ZA 3BZFB 3HC3L 3RGVA 4OZGF 5L88L 4QRQB 1PDKA 4XI5D 2CLZA 1JGUH 3A6BL 4ZUWA 5B8CA 5BOZG 4WUUA 1I7RA 1JHKL 1EUTA 3HC0A 1R5IA 1A1NB 2NY0B 2O5ZH 3D2UB 3O11A 4QHLB 5CIPB 2CKNA 1FCGA 4MVBC 4LGPB 2FJHA 4N0RA 1HSAA 1O0VA 3DXAD 4RAHA 1VEOA 3LN9A 2NY0C 4YHOL 3GRWA 2VL4A 3RP1A 3P4MB 4EDXB 5HHVL 1JGLL 2A74B 4AM0A 4YDJB 1TVHA 1O7SA 2F19L 4RAVB 5JLZB 4HJGA 4G8GB 2Z93B 4F9LA 1UYWL 4J3OC 3VFUB 2H2PD 4Z0XB 2FBJL 4EUPB 1FYTE 3NCFB 5C0RH 2CLRA 4F7CB 3DX8B 1FL6A 4PD4K 1UVQA 3U4EA 3WSQH 1T04A 2BVUA 5DGRA 2W0LA 2XQBL 3VI4F 5JO5B 2NY3D 1IQWL 1AGEA 4JZJC 3K1DA 3MGTA 3QA3B 3K2UL 1CICA 3QUMH 1NLDL 5T3XL 5I1CL 1Z9SA 2J8HA 1DBML 1IEAB 4U6HB 1QO3A 3NZ8B 2APVA 1YEHL 1KCSL 1ZT1B 4PP1D 4P4KA 1EK3A 1MCIA 4X5LA 1U2HA 1TZHB 3PABA 3HNVH 2GITB 4X7FC 3PQYD 2BNQE 2GAZA 3MLSL 1JNNH 1BVKB 1I7TA 1BLNB 3DURB 4JDZA 2DWEA 3JTSA 5IFAL 3RI5K 3GMRB 4NP4L 4XMLL 1NGXA 4YR6B 2ENSA 3KPTA 3I3BA 3OAYK 4WI4A 5F89A 1FYTA 3TZVD 4MA7H 1QLRB 1KIRA 1RK1A 2DN7A 5DMKB 3QFJE 1YPZB 5T1MA 5IM7B 3TN0D 1D9KD 1FAIH 4PRBB 3WKNA 4E5XB 4PJ9A 4X80L 5K9OB 3MRIB 1RUPL 1HNGA 1TJGL 3FB5A 1FHGA 4PJ8A 3WUWA 4Z18A 3UEZA 3D3VD 4P2CG 1QLEL 2D7TL 3FOLA 5HGBB 3VA2C 1PKOA 4UQ2A 5EU4B 3X3GL 2BMKA 4GRLD 3IJHB 5JTWA 4PJBB 3MRPB 1AD0B 2FH6A 4KHTL 1WWAX 4QRPD 4OGAD 2OQJA 4PJCB 1CCZA 1I8LC 1MELA 5C0EA 4UU9B 5IQ7L 5FOBB 3MRFA 1BBJB 3U6RB 3DMMB 3ECBB 3GHBL 1Q9KB 4QT5A 2IBZX 1C5BH 1UM4L 5DO2C 3VFNA 1H3GA 3STLB 5FYJD 3V7AG 4YHIB 3SE3A 4YGVB 2FZ3A 4LEXL 4DUXA 4Z7VF 1MCKA 1RJYB 1JK8B 2I5YL 3M1BA 1P7HL 5DJZA 1OTUC 1SYSB 2WK2A 4MCZA 1U8LA 4D94A 2EIEA 1KLGA 2CO6B 3P9MA 3L1OL 1C12B 2F54B 2HTLC 2NY5C 2ZUWA 4K3DL 5TE4L 4U1GB 3V6FB 5HVHC 3L3IB 1F4AA 1XF4B 1E6OL 2GQHA 1KJMB 1QBMH 1ZLVH 3TO4B 1A5FH 3C5JA 5IJKC 4GW4B 3GSUA 4APQD 3MRNB 4PLNC 5D2NA 2ICWA 4ONGL 4U1GC 5T3XE 2CKBA 4KK8C 3BPOB 4Y5XA 5BZWB 1OAZH 3TO4C 4XBPA 3VXTA 1VFAB 2R1WB 3H42L 5CILH 2WNGA 1MHHA