2LRCA

Structure of thioredoxin 2 from pseudomonas aeruginosa pao1 in its reduced form
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
b'MKTRYSAEAPARDELDRLAGPTLVEFGTDWCGHCQAAQPLLAEVFSDYPEVGHLKVEDGPGRRLGRSFQVKLWPTFVFLRDGREVARVVRPGSASVLEEAFESLVGEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unusual thioredoxin from Pseudomonas aeruginosa
rcsb
molecule keywords Probable thioredoxin
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 30
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2lrcA00
3KJYA 4RI6A 1WIKA 3ZYWA 2O89A 2M46A 2O87A 4HUAA 1O85A 1F3BA 1M0UA 1PN9A 4ZL9A 4X0XA 3F8UA 2VCVA 2JU5A 4AJ7A 3CTFA 2EC4A 3ZMLA 16GSA 3G9BA 4KNDA 5DAKA 19GSA 3KM6A 5ID2A 4TXOB 1K0NA 4K8MA 4GF0A 2IJYA 5IPGA 2K18A 2NPBA 1TJDA 2HI7A 4PUFC 1AIUA 2PVOC 4K2DA 3GH6A 1SK0A 2AJQB 2NDOA 1JLWA 3L0HA 1THXA 5GZZB 1YQ1A 1NM3A 2K8SA 4OO4A 1URMA 2LRTA 5CYYA 1F37A 2H72A 4NAXA 4MF6A 3BD2A 2LRCA 1XXUA 4EL1A 1TRSA 2F51A 2VL3A 5AIVA 2FY6A 1JFUA 5FHIA 2PGTA 1O81A 5DCHA 4MK3A 2HZEA 5G1KA 2B1LA 3BCKA 4PQHA 1QXHA 1QQ2A 1WPIA 1R4WA 2C8UA 4MH3A 3GRXA 2VLUA 3CTGA 1GSDA 1THOA 2N5FA 5DALB 1R7HA 4N10A 3VLNA 4DSRA 1XWGA 4K6XA 5HFKA 5H5RA 4EXJA 1AQWA 1ERTA 4ECJA 2AAWA 3TKRA 1BYEA 4IN0A 3N9JA 1K3LA 5ECPB 3E9JB 4P3YB 2L5LA 2HLSA 4NV5A 2OKAA 2H8LA 4HJ2A 5D8IA 2OE3A 3U6VA 1FO5A 5J4UA 3M3MA 2VOCA 4MJBA 2WJUA 1FAAA 3FEUA 5ECSA 5LNKe 2IMIA 3UAPA 5DQSA 2FD3A 2IMFA 2GLRA 1FW1A 4G10A 2MYGA 3CSIA 1S3AA 9GSSA 3WGDA 1XW6A 2GT6A 5ECNB 2ZUPA 1OC9A 3MWHA 4IP6A 4KDXA 3Q18A 1PX7A 1V58A 3P7XA 4HU9A 1UN2A 4JRRA 3JCML 2E0QA 1PKZA 1OKTA 2AV4A 2H0HA 1Y25A 3IAM2 3HZ8A 4Z7XA 4L8EA 2R37A 3KIJA 2JZTA 4YQVA 3KMNA 1GWCA 2H73A 2YOIA 2P5RA 2H1GA 2VD1A 1TKDB 1TW9A 5IMZA 2AHEA 5B6NA 3F0IA 2DC5A 1A2JA 1AQVA 2CV4A 2R2JA 1EV4A 2C3NA 4PXOA 1NSWA 2HE3A 4NMUA 3EE2A 3UIWA 2LTKA 2A2SA 1PA3A 3FR9A 4ECBA 3H93A 1KEBA 2GGTA 4J57E 3GKMA 2IWTA 4OCFA 1R5PA 1HNCA 3WT1A 5A4VA 2WGRA 4GQFA 3ZLPA 4ZL7A 1ZZYA 1XW9A 3KGKA 2KP2A 6GSYA 4AF2A 4HEA2 1SL1B 2MMNA 4IP1A 4MABA 4V2MA 3KZQA 4ECCA 1JLVA 1XCCA 1N8JA 3L9UA 1GNWA 1GTAA 1OKDA 4KH7A 2WB9A 2D2ZA 3UBLA 5KN3A 2HXKA 1Z3EA 1ZCPA 4H86A 2CVKA 1SYRA 2IL3A 5G5EA 3D6IA 1ON4A 2DJKA 3CBUA 4MH2A 5ECMB 5LCZA 2K6VA 3W8JA 2HSYA 1PL1A 2KLXA 4NHZA 4ECIA 5IO0A 1GSUA 3IE3A 5IOXA 1OC3A 3L9SA 2CAQA 4TXVA 5JWQB 2CVDA 4WBJA 2CVBA 3ISOA 1QMVA 5CO3A 1X9SB 4BA7A 1HQOA 1O6JA 4JZQA 1XIYA 3GKKA 1IYIA 1WOUA 4BWSA 3E3EA 1PX6A 4PUAA 2PWJA 2R4VA 5A4UA 1ZYQB 3P8WA 1Z7RA 2L6DA 2YWIA 3FZAA 4Q5FA 2OE1A 2DBCA 2JL4A 1G7EA 1Y6EA 1G7OA 1WMJA 4IQAA 4G9HA 5IIZA 4BVYA 1U88A 1MTCA 4NV2A 1OC8A 2L4QA 4F2IA 2JADA 1YEXA 2CX4A 4GRFA 4BL7A 4G2EA 3FRCA 4OFNA 3J7Yk 10GSA 3GN3A 1ZOFA 3FK8A 4ZB8A 5LD0A 3WYWA 4HJMA 1HNAA 2A2RA 3Q74A 1YY7A 3D21A 2ES7A 5L71A 2H76A 1XPVA 3EINA 4K0NA 4LA1A 1W89A 1PRXA 6GSXA 3C73A 1Z7PA 1CQHA 2P0GA 4BPYA 4PQIA 3IAS2 4OO5A 5B8AA 3HJMA 3FZ9A 1M9BA 3KMOA 1GSSA 4ZB6A 3PH9A 2LS5A 3G7IA 3HJOA 3US3A 1GP1A 3LYKA 1F3AA 2RLIA 5JCGA 5JWOB 3D0ZA 3KEBA 3TCOA 2H19A 2ON5A 4MJAA 3EVIA 1A2MA 5ECIB 3KTBA 3DGQA 4JEDA 3C7MA 1XOAA 2H71A 3M0FA 1MDIA 2VL9A 3IDVA 2OE0A 3OR5A 3W8SA 2VL2A 1GTUA 2KUCA 4YH2A 2XHFA 3NIVA 1AXDA 4OWYA 4CHSA 4POLA 8GSSA 2YNXA 4MPFA 1A0FA 3EWLA 3IXRA 1VF3A 4ML6A 3GL3A 1SKWB 1EGOA 1XBSA 1AW9A 2PERA 4WXTA 4QQ7A 1EOGA 3ZVJA 3CRTA 4ILFA 2R5GA 1UVZA 6GSUA 2X8HA 1B8XA 4DSSA 4FH8A 3ERFA 2EIOA 2RM5A 1M2BA 3FR3A 3QFBC 1X0RA 2MMOA 2OJLA 1A2LA 4QL9A 5DJMA 2DSAA 2LV3A 4KGIA 3RHCA 4D73A 5D93A 1YZXA 3HVSA 1TI3A 5J3RA 3DWVA 5ECQB 1MD3A 5EY6A 2FWGA 1GLPA 4O5RA 2IMKA 4KUNA 4MMMA 3FYGA 4PURA 1EZKA 4GWRA 3F3QA 1ERUA 2HT9A 2DJ3A 4DEJA 4EVMA 2H74A 4XRAA 3UJ1A 5IOWA 4LLRA 4WR4A 5D96A 3U5RE 1TRWA 3O6TA 4KCAA 3ZIJA 3QAWA 1BX9A 5DAKB 5G1LA 2G0FA 4V2NA 4IGJA 1X5CA 3KD0A 1TI1A 5ID2B 1SKRB 1B48A 2K8VA 3LSZA 2TIRA 3HXSA 4TR1B 2VM2A 3HCZA 2F3MA 3C71A 4XS1A 2JSYA 4I97A 1XWKA 5D9VA 3F3RA 3ERGA 5INYA 3QR6A 3ZTLA 2V1MA 3D4TA 4J56E 2R6KA 4ZBAA 2YCDA 3TUEA 3DVXA 4TR3A 3UVTA 3QMXA 3UOMA 1TRVA 3QAGA 3F6FA 1UC7A 3FKFA 1J08A 2PMTA 2FCHA 4POKA 1JZWA 2IN3A 3DYRA 4IS0A 4TW5A 17GSA 5B6MA 4J2FA 4GTUA 2ON7A 4KDYA 4QL7A 2AYTA 2MZCA 2WS2A 2F8FA 3GYKA 4XHMA 5JCWA 1SK2A 2J9HA 4V1Ap 12GSA 2L6CA 1M7TA 1O8WA 4ACSA 2X64A 2OADA 1XW5A 2VCXA 2RUFA 1TK0B 5IMAA 2I3YA 2DJ1A 5IO2A 2V32A 1GTIA 4OMVA 4JU5A 1RQMA 1VF1A 2C0EA 4K7OA 4EO3A 1LBKA 5ELAA 3L78A 3HVXA 1I9DA 1OVNA 3HHVA 2TRXA 2DIYA 2V41A 3FHKA 5ECRB 2JSZA 3TRXA 2XBQA 3TB2A 2C0GA 5DBQA 1NHOA 1FVKA 4GSTA 4GLTA 1EP8A 1BQ7A 1DBYA 4O7HA 3ZREA 4MZWA 4XS6A 2HRFA 3EU3A 3GTUA 14GSA 3D5JA 3C1SA 3GV1A 5C00A 3VPTA 3W6GA 2MMAA 1IYHA 4IJ3A 3QD9A 3PINA 2E7PA 1GTBA 3J7Yb 3V1WA 2H1AA 2BMXA 1GLQA 2K9FA 1OC9B 1N2AA 4TRXA 4IQ1A 4EKZA 2RM6A 3NZNA 2LSTA 5DALA 5JWRB 1H4OA 3EC3A 3APOA 3H79A 3P90A 3C8EA 5KN0A 3LWAA 3KTLA 4K9ZA 3LEFA 1H75A 5ECLB 1BG5A 2VIMA 3LXTA 1YKAA 2P31A 2PVQA 3QCPA 1YKCA 2KHPA 2GZPA 2GSTA 3GA4A 4MA9A 4AJ6A 2N5BA 1V98A 4PX1A 3SWLA 3LFLA 2I1UA 1Z9HA 2DJ2A 2ZCTA 2OA7A 4FIWA 2L57A 1A0RP 2C0FA 4I8BA 3QFAC 2VCTA 5CREA 4V2LA 3F6DA 2VCZA 3NOFA 2IFQB 5AISA 1OAZA 1GUMA 1WJKA 5A5KA 5CP1A 1TU7A 2FWEA 1T1VA 2B5EA 1BAYA 2BJXA 4RUVA 4L5LA 2QGVA 3LXZA 2OBIA 2IMDA 2LKUA 3O76A 4MP4A 4TR0A 4ULXA 5DVBA 1PQNA 3D22A 4L5OA 2NBSA 3ZZXA 2YP6A 2YWNA 4LL1B 3E0UA 3WT2A 3GKXA 1K3OA 4TN8A 2GZZA 5B8BA 3BCIA 4GSSA 1FB6A 2A4VA 2O8VB 4IBPA 1WP0A 4MJCA 5JCUA 4EE0A 3IBHA 1V9WA 1ML6A 1S3CA 4ISDA 4MZCA 2L5OA 2YV9A 2GZYA 2PU9C 2KP1A 3ZITA 2NVLA 3F4SA 3RBTA 1TDIA 4K7IA 4MF5A 2B6MA 3VWVA 3A3TA 5AIXA 4IW9A 2HYXA 1F6MC 5CAXA 1FVJA 3EMPA 2H75A 4AGSA 1USBA 5DCGA 3A2VA 1Q4JA 1PSQA 4ID0A 1DUGA 5KN2A 2LJRA 3MNGA 4NPBA 1XWCA 2LJAA 2H6XA 6GSWA 3KH7A 4FYUA 4TVEA 1U6TA 4K7NA 3QDNA 1ERVA 1K0AA 2MMZA 2DMLA 2VUPA 4OFMA 1OE8A 3UMAA 3VI7A 4JBBA 4BWQA 5G2ZA 3FZ4A 2AUVA 2LUSA 3HY2A 4L0WA 4MCUA 4ZILA 2VD0A 4EC0A 3I69A 3DKSA 2DJ0A 3VURA 5DDLA 5HFGA 1Z6NA 4MPGA 1SYXA 2PPTA 1SL2B 4F0BA 3IOSA 3GSTA 3UEMA 1PGTA 5D9TA 3GHAA 1BEDA 1GUHA 3KP9A 1QGVA 4I2TA 1SJZA 3A2WA 5HR2A 1MD4A 1TU8A 3BJ5A 3GIXA 2EIRA 3IHQA 2EIQA 3ZRDA 5COHA 4X1UA 2VAFA 1XZOA 1GH2A 3F9UA 1T7PB 2GQKA 2FA8A 2F9SA 4AJ8A 1JHBA 4N0ZA 3ED3A 4PNFA 4XCSA 3GX8A 1ABAA 4YQMA 3HJPA 1DSBA 2GSSA 3S9FA 1M9AA 1O8XA 3IPZA 3A5WA 2GT5A 4KW6A 22GSA 3GFKA 5G30A 2HSHA 4KB3A 4WEYA 3DRNA 5ELGA 4LMWA 1V57A 2QKEA 4NHWA 1KBNA 4KX4A 4GQCA 3QOUA 4WR5A 2C0DA 4X43A 3VK9A 2I81A 3LYPA 1TRUA 4XRDA 3CXGA 1FHEA 2OBKA 2YZUA 5F06A 1O7UA 5GAND 3EYTA 5CRDA 2KOKA 1CQGA 4I6XA 4HQZA 1TOFA 2LRNA 1SJIA 5A4WA 1SD9A 3ZL5A 4F03A 1PD21 4MDCA 2YZHA 2RIIA 3TGZA 3APQA 5B7CA 3UARA 2LNTA 2H6YA 1K0MA 3TRPA 4DSSB 3QAVA 1EWXA 2Z9SA 4EF0A 1FG4A 2O85A 3UBKA 2FUG2 1J9BA 4F9ZA 1O73A 5ECKB 4ZIJA 4D73B 4XS4A 3HYPA 2FHEA 2PN8A 2QC7A 3IR4A 1OYJA 1SU9A 4EDYA 4PNGA 4JR6A 2N5AA 4IELA 4JR4A 2GTUA 2FWHA 4HQSA 1X9WB 2B5YA 1DE2A 3HZ4A 4RQXA 4FYBA 1E6BA 1WE0A 4N30A 1XVQA 4PGTA 2GVPA 1RW1A 3TKSC 1FB0A 3M9JA 1XWBA 4KA0A 2B1KA 2FGXA 4BVXA 2VLVA 2C4JA 1YEPA 2XPEA 1T8EB 1GRXA 4F82A 4TOPA 1G0TA 3GURA 5ECOB 2DJJA 6GSVA 1B4PA 5E4WA 5J5NA 3ZIVA 1B9XC 3IV4A 2WRTA 5J9BA 1EGRA 5CRGA 1KTEA 4WBRD 2I9HA 1VGLA 3DEXA 3K8NA 3RHBA 1XWAA 3GMFA 5HR0A 4V1Ag 1AQXA 3FR6A 1M2DA 3GH9A 2H30A 4HDEA 4YQUA 1TXXA 1PKWA 3CMIA 2H70A 5DJLA 1B9YC 2J23A 1T4ZA 4HS1A 1SL0B 3Q19A 2QSIA 2O7KA 3M9KA 3CRUA 2YWOA 1HD2A 2IMEA 3I43A 5IPHA 5D9XA 1YF0A 5IMVA 2CX3A 4KDUA 1K0CA 4K0GA 5DQYA 4YAPA 3QPMA 2B5XA 1S3DA 1XVWA 3H1NA 3H8QA 1XFLA 1C72A 2HZEB 1G6WA 1GSQA 4KCEA 1W4VA 3CYNA 4TR1A 3VWXA 3TJGA 2C80A 5AN1A 2VO4A 4DSQA 2JACA 3HVVA 4HU7A 3C1RA 2WDUA 3TKSE 2DLXA 2WFCA 3M1GA 4MZBA 1NHYA 1I5GA 2XBIA 3D4MA 5KEJA 4TXOA 1QUWA 2AB6A 1JZRA 2GQLA 2CT6A 3GTUB 3DIEA 3FZ5A 1T00A 4MJEA 2PBJA 1T4YA 2YJHA 3BOAA 1VF2A 3CSJA 2YWMA 4EDZA 5ECHB 1XOBA 2PUKC 3TOTA 3F4RA 2YV7A 3IK9A 3ERWA 4KAEA 4Q5QA 5J41A 2F8AA 3LQ7A 3IA1A 4ZBDA 4HOJA 3HDCA 6GSSA 2GSQA 2MBTA 3MDKA 4POBA 4F0CA 1E2YA 2YANA 4N11A 4GSNA 1M2AA 2XC2A 1BJXA 4ZBBA 5HFIA 1F2EA 1K0OA 2NTOA 3APSA 2GS3A 1AUCA 2G2QA 5EPFA 4G19A 3L4NA 3ZMKA 5IQYA 4O32A 3KXOA 1KNGA 1A24A 5CRHA 3HA9A 1TK8B 7GSSA 2XPDA 4OCEA 2B7KA 2REMA 1ZL9A 2TRCP 1HYUA 2CZ2A 2E2GA 2VCQA 2FWFA 1QK8A 4ZL8A 1EV9A 1PMTA 3VPQA 4FO5A 4WKWA 1WWJA 5FT3A 1ST9A 4GXZA 1FOVA 2HZFA 3MAKA 4EUYA 2CA8A 4WF5A 2H1DA 1MDKA 3RPNA 1LJRA 4I2UA 2MBSA 2M72A 2C1YA 2C3TA 4NWYA 3PGTA 5IMFA 1GNEA 5GSSA 2R3XA 5F05A 2VCWA 3ZVJD 2WZ9A 2JZRA 2DIZA 4CDOA 2L4CA 2IFQA 1V40A 1B4QA 5C04A 1X9MB 2HFDA 4PQ1A 2RUEA 4IHUA 2FNOA 2H0IA 2FLSA 2L59A 3KCMA 4FYCA 2WULA 5CNWA 3IRAA 2VM1A 2CZ3A 1Z5YE 3ZFBA 1OE7A 3I9V2 1GULA 3FW2A 1GSEA 4IJIA 3VWUA 1AC1A 3HD5A 3R2QA 2FA4A 13GSA 1U3AA 2H01A 5CRWA 2IPAA 3UVHA 5ABRA 2GQMA 2X8CA 2V2GA 1YF1A 2H1BA 1ERWA 3TKPA 1F9MA 3WD6A 1GL8A 1R26A 2LJKA 1U87A 3H4KA 2C3QA 20GSA 1J0FA 3DVWA 11GSA 2JZSA 1X5DA 3LJRA 2H6ZA 3ME8A 3TOUA 2P5QA 2V6OA 3LORA 4WETA 5IM9A 2B3SA 3F63A 1GSYA 3IK7A 5D9WA 4OFTA 3TJFA 3TJKA 2CAIA 4O92A 5E59A 2LEGA 18GSA 3G7JA 1QFNA 3VI5A 5AGYA 1MDJA 3WGEA 3BBYA 1MEKA 4E8EA 3Q6OA 1DE1A 1A23A 4KE3A 5GSTA 3MSZA 4IKHA 4LL4B 1Z6MA 4Q5NA 3GL5A 3SBCA 5HQPA 3PR8A 2HNLA 1X5EA 1TK5B 2V6KA 1U3IA 1A8YA 3LG6A 3DMLA 1JZOA 4CW9A 3RAZA 3UL3A 5F0GA 2H66A 3TRQA 1YDKA 1AAZA 3GKNA 1ILOA 1G6YA 5ENUA 2YJ7A 2VL2C 1EP7A 2BTOT 1Q98A 3TJJA 2GSRA 1M99A 4HI7A 3GNJA 4GCIA 3O3TA 2YPMA 4JE1A 4XIHA 1R5AA 1WRYA 4L0UA 3DXBA 3ZFLA 2GDRA 3TJBA 1UA5A 4XS4B 3EMXA 4DVCA 3G7YA 2E2MA 3KH9A 3P2AA 4K1FA 4ML1A 4Q5RA 4XTSA 1A8LA 4RQRA 2HRNA 2ALBA 4N0VA 3FY7A 2CQ9A 3WGXA 3AY8A 3L9VA 4HZ4A 5G31A 1YJ6A 1SK1A 5F8BA 1PL2A 1ZGNA 5J9CA 2B7JA 3TDGA 2I4AA 4TR4A 2H0GA 5FWGA 1ZYEA 6GSTA 2LQQA 2IIYA 1GSFA 3GX0A 3RDWA 4HZ2A 1HNBA 3VWWA 4IVFA 2LQOA 1ZMAA 3F4TA 2DMMA 1VRSD 4LMVA 1TP9A 1NW2A 1EEMA 1JZDA 1GUKA 3LGCA 4TKYA 1V2AA 3N5OA 1VF4A 3VFIA 1K3YA 3HKRA 3M8NA 4KSMA 5EL8A 3TKQA 3EU4A 2YN1A 4YAVA 3ME7A 1RK4A 5G5FA 4ZXGA 3EURA 1K0DA 5H5SA 4I5QA 3KP8A 4ZB9A 5HR1A 4MLYA 3RPPA 3IC4A 4OD7A 5IMDA 1EEJA 5H5QA 4KSOA 1LU4A 1ACVA 3A2XA 3DD3A 4WF4A 1SD8A 2ZNMA 4MF7A 5IMCA 1TTZA 2M80A 2VLTA 1T3BA 3I6AA 1EOHA 5F07A 1SKSB 2OACA 3GUSA 5HR3A 4E8HA 4POMA 1K0BA 2X99A 3GSSA 5EVOA 2X8GA 2LNSA 3CSHA 5GAPD 4NXIA 1SJ6A 1SENA 5D73A 2WCIA 4RI7A 3TKSA 5KN1A
chains in the Genus database with same CATH superfamily
3KJYA 4RI6A 1WIKA 3ZYWA 2O89A 2M46A 2O87A 4HUAA 1O85A 1F3BA 1M0UA 1PN9A 4ZL9A 4K2XA 4X0XA 3F8UA 2VCVA 2JU5A 4AJ7A 4ICYA 3CTFA 2EC4A 3ZMLA 16GSA 3G9BA 4KNDA 5DAKA 19GSA 3KM6A 5ID2A 4TXOB 1K0NA 4K8MA 4GF0A 2IJYA 5IPGA 2K18A 2NPBA 1TJDA 2HI7A 4PUFC 1AIUA 2PVOC 4K2DA 3GH6A 1SK0A 2AJQB 2NDOA 1JLWA 3L0HA 1THXA 5GZZB 1YQ1A 1NM3A 4O5UA 2K8SA 4OO4A 1URMA 2LRTA 5CYYA 1F37A 2H72A 2UZ8A 4NAXA 4MF6A 3BD2A 4A5PA 2LRCA 1XXUA 4EL1A 1TRSA 2F51A 2VL3A 5AIVA 2FY6A 1JFUA 5FHIA 1PN0A 2PGTA 1O81A 5DCHA 4MK3A 2HZEA 5G1KA 2B1LA 3BCKA 4PQHA 1QXHA 1QQ2A 1WPIA 4FQUA 1R4WA 3PPUA 2C8UA 4MH3A 3GRXA 2VLUA 3CTGA 1GSDA 1THOA 2N5FA 5DALB 1R7HA 4N10A 3VLNA 4DSRA 1XWGA 4K6XA 5HFKA 5H5RA 4EXJA 1AQWA 1ERTA 4ECJA 2AAWA 3TKRA 1BYEA 4IN0A 3N9JA 1K3LA 5ECPB 4G0KA 3E9JB 4P3YB 2L5LA 2HLSA 4NV5A 2OKAA 2H8LA 4HJ2A 5D8IA 2OE3A 3U6VA 1FO5A 5J4UA 3M3MA 2VOCA 4MJBA 2WJUA 1FAAA 3FEUA 5ECSA 5LNKe 2IMIA 3UAPA 5DQSA 2FD3A 2IMFA 2GLRA 1FW1A 4G10A 5KOXA 2MYGA 3CSIA 4HSCX 1S3AA 9GSSA 3WGDA 1XW6A 2GT6A 5ECNB 2ZUPA 1OC9A 3MWHA 4IP6A 4KDXA 3Q18A 1PX7A 1V58A 1PFOA 3P7XA 4HU9A 1UN2A 4JRRA 3JCML 2E0QA 1PKZA 1OKTA 2AV4A 3MIXA 2H0HA 1Y25A 3IAM2 3HZ8A 4Z7XA 4L8EA 2X4AA 2R37A 3KIJA 2JZTA 4YQVA 3KMNA 1GWCA 2H73A 2YOIA 2P5RA 2H1GA 2VD1A 1TKDB 1TW9A 5IMZA 2AHEA 5B6NA 3F0IA 2DC5A 1A2JA 1AQVA 2CV4A 2R2JA 1EV4A 2C3NA 4PXOA 1NSWA 2HE3A 4NMUA 3EE2A 4G0IA 3UIWA 2LTKA 2A2SA 1PA3A 3FR9A 4ECBA 3H93A 1KEBA 2GGTA 5BRTA 4J57E 3GKMA 2IWTA 4OCFA 1R5PA 1HNCA 3WT1A 5A4VA 2WGRA 4GQFA 3ZLPA 4ZL7A 1ZZYA 1XW9A 3KGKA 2KP2A 6GSYA 4AF2A 4HEA2 1SL1B 2MMNA 4IP1A 4MABA 4V2MA 3KZQA 4ECCA 1JLVA 1XCCA 1N8JA 3L9UA 1GNWA 1GTAA 1OKDA 4KH7A 2WB9A 4PTSA 2D2ZA 3UBLA 5KN3A 2HXKA 1Z3EA 1ZCPA 4EIQA 4H86A 2CVKA 1SYRA 2IL3A 5G5EA 3D6IA 5KOWA 1ON4A 2DJKA 3CBUA 4MH2A 5ECMB 5LCZA 2K6VA 3W8JA 2HSYA 1PL1A 2KLXA 4NHZA 4ECIA 5IO0A 1GSUA 3IE3A 5IOXA 1OC3A 3L9SA 2R0GA 2CAQA 4TXVA 5JWQB 2CVDA 4WBJA 2CVBA 3ISOA 1QMVA 5CO3A 1X9SB 4BA7A 1HQOA 1O6JA 4JZQA 1XIYA 3GKKA 1IYIA 1WOUA 4BWSA 3E3EA 1PX6A 4PUAA 2PWJA 2R4VA 5A4UA 1ZYQB 3P8WA 1Z7RA 2L6DA 2YWIA 3FZAA 4Q5FA 2OE1A 2DBCA 2JL4A 1G7EA 1Y6EA 1G7OA 1WMJA 4IQAA 4G9HA 5IIZA 4BVYA 1U88A 1MTCA 4NV2A 1OC8A 2L4QA 4F2IA 2JADA 1YEXA 2CX4A 2QA1A 4GRFA 4BL7A 4G2EA 3FRCA 4OFNA 3J7Yk 10GSA 3GN3A 1ZOFA 3FK8A 4ZB8A 5LD0A 3WYWA 4HJMA 1HNAA 2A2RA 3Q74A 1YY7A 3D21A 2ES7A 5L71A 2H76A 1XPVA 3EINA 4K0NA 4LA1A 1W89A 1PRXA 6GSXA 3C73A 1Z7PA 1CQHA 2P0GA 4BPYA 5BMUA 4PQIA 3IAS2 4OO5A 5B8AA 3HJMA 3FZ9A 1M9BA 3KMOA 1GSSA 4ZB6A 3PH9A 2LS5A 3G7IA 3HJOA 3US3A 1GP1A 3LYKA 4CY6A 1F3AA 2RLIA 5JCGA 5JWOB 4USSA 3D0ZA 3KEBA 3TCOA 2H19A 2ON5A 4MJAA 3EVIA 1A2MA 5ECIB 3KTBA 3DGQA 4JEDA 3C7MA 1XOAA 2H71A 3M0FA 1MDIA 2VL9A 3IDVA 2OE0A 3OR5A 3W8SA 2VL2A 1GTUA 2KUCA 4YH2A 2XHFA 3NIVA 1AXDA 4OWYA 4CHSA 4POLA 8GSSA 2YNXA 4MPFA 1A0FA 3EWLA 3IXRA 1VF3A 4ML6A 3GL3A 1SKWB 1EGOA 1XBSA 1AW9A 2PERA 4WXTA 4QQ7A 1EOGA 3ZVJA 3CRTA 4ILFA 2R5GA 1UVZA 6GSUA 2X8HA 1B8XA 4DSSA 4FH8A 3ERFA 2EIOA 2RM5A 1M2BA 3FR3A 3QFBC 1X0RA 2MMOA 2OJLA 1A2LA 4QL9A 5DJMA 2DSAA 2LV3A 4KGIA 3RHCA 4D73A 5D93A 1YZXA 3HVSA 1TI3A 5J3RA 3DWVA 5ECQB 1MD3A 5EY6A 2FWGA 1GLPA 4O5RA 2IMKA 4KUNA 4MMMA 3FYGA 4PURA 1EZKA 4GWRA 3F3QA 1ERUA 2HT9A 2DJ3A 4DEJA 4EVMA 2H74A 4XRAA 3UJ1A 5IOWA 4LLRA 4WR4A 5D96A 3U5RE 1TRWA 3O6TA 4KCAA 3ZIJA 3QAWA 1BX9A 5DAKB 5G1LA 2G0FA 4V2NA 4IGJA 1X5CA 3KD0A 1TI1A 5ID2B 1SKRB 1B48A 2K8VA 3LSZA 2TIRA 3HXSA 4TR1B 2VM2A 3HCZA 2F3MA 2R0CA 3C71A 4XS1A 2JSYA 4I97A 1XWKA 5D9VA 3F3RA 3ERGA 5INYA 3QR6A 3ZTLA 2V1MA 3D4TA 4J56E 2R6KA 4ZBAA 2YCDA 1ZYNA 3TUEA 3DVXA 4TR3A 3UVTA 3QMXA 3UOMA 1TRVA 3QAGA 3F6FA 1UC7A 3FKFA 1J08A 2PMTA 2FCHA 4POKA 1JZWA 2IN3A 3DYRA 4IS0A 4TW5A 17GSA 5B6MA 4J2FA 4GTUA 2ON7A 4KDYA 4QL7A 2AYTA 2MZCA 2WS2A 2F8FA 3GYKA 4XHMA 5JCWA 1SK2A 2J9HA 4V1Ap 12GSA 2L6CA 1M7TA 1O8WA 4ACSA 2X64A 2OADA 1XW5A 2VCXA 2RUFA 1TK0B 5IMAA 2I3YA 2DJ1A 5IO2A 2V32A 1GTIA 4OMVA 4JU5A 1FOHA 1RQMA 1VF1A 2C0EA 4K7OA 4EO3A 1LBKA 5ELAA 3L78A 3HVXA 1I9DA 1OVNA 3HHVA 2TRXA 2DIYA 2V41A 3FHKA 5ECRB 2JSZA 3TRXA 2XBQA 4YKFA 3TB2A 2C0GA 5DBQA 1NHOA 1FVKA 4GSTA 4GLTA 1EP8A 1BQ7A 1DBYA 4O7HA 3ZREA 4MZWA 4XS6A 2HRFA 3EU3A 3GTUA 14GSA 3D5JA 3C1SA 3GV1A 5C00A 3VPTA 3W6GA 2MMAA 1IYHA 4IJ3A 3QD9A 3PINA 2E7PA 1GTBA 3J7Yb 3V1WA 2H1AA 4KF9A 2BMXA 1GLQA 2K9FA 1OC9B 1N2AA 4TRXA 4IQ1A 4EKZA 2RM6A 3NZNA 2LSTA 5DALA 5JWRB 1H4OA 3EC3A 3APOA 3H79A 3P90A 3C8EA 5KN0A 3LWAA 4Z2UA 3KTLA 4K9ZA 3LEFA 1H75A 5ECLB 1BG5A 2VIMA 3LXTA 1YKAA 2P31A 2PVQA 3QCPA 1YKCA 2KHPA 2GZPA 2GSTA 3GA4A 4MA9A 4AJ6A 2N5BA 1V98A 4PX1A 4K5RA 3SWLA 3LFLA 2I1UA 1Z9HA 2DJ2A 2ZCTA 2OA7A 4FIWA 2L57A 1A0RP 2C0FA 4I8BA 3QFAC 2VCTA 5CREA 4V2LA 3F6DA 2VCZA 3NOFA 2IFQB 5AISA 1OAZA 1GUMA 2HRAA 1WJKA 5A5KA 5CP1A 1TU7A 2FWEA 1T1VA 2B5EA 1BAYA 2BJXA 4RUVA 4L5LA 2QGVA 3LXZA 2OBIA 2IMDA 2LKUA 3O76A 4MP4A 4TR0A 4ULXA 5DVBA 1PQNA 3D22A 4L5OA 2NBSA 3ZZXA 2YP6A 2YWNA 4LL1B 3E0UA 3WT2A 3GKXA 1K3OA 3MYDA 4TN8A 2GZZA 5B8BA 3BCIA 4GSSA 1FB6A 2A4VA 2O8VB 4IBPA 1WP0A 4MJCA 5JCUA 4EE0A 1XG8A 3IC8A 3IBHA 1V9WA 1ML6A 1S3CA 4ISDA 4MZCA 2L5OA 2YV9A 2GZYA 2PU9C 2KP1A 3ZITA 2NVLA 3F4SA 3CQFA 3RBTA 1TDIA 1M3JA 4K7IA 4MF5A 2B6MA 3VWVA 3A3TA 5AIXA 4IW9A 2HYXA 1F6MC 5CAXA 1FVJA 4BIKA 3EMPA 2H75A 4AGSA 1USBA 5DCGA 3A2VA 1Q4JA 1PSQA 4ID0A 1DUGA 5KN2A 2LJRA 3MNGA 4NPBA 1XWCA 2LJAA 2H6XA 6GSWA 3KH7A 4FYUA 4TVEA 1U6TA 4K7NA 3QDNA 1ERVA 1K0AA 2MMZA 2DMLA 2VUPA 4OFMA 1OE8A 3UMAA 3VI7A 4JBBA 4BWQA 5G2ZA 3FZ4A 2AUVA 2LUSA 3HY2A 4L0WA 4MCUA 4ZILA 2VD0A 4EC0A 3I69A 3DKSA 2DJ0A 3VURA 5DDLA 5HFGA 1Z6NA 4MPGA 1SYXA 2PPTA 1SL2B 4F0BA 3IOSA 3GSTA 3UEMA 1PGTA 5D9TA 3GHAA 1BEDA 1GUHA 3KP9A 1QGVA 4I2TA 1SJZA 2DKIA 3A2WA 5HR2A 1MD4A 1TU8A 3BJ5A 3GIXA 2EIRA 3IHQA 2EIQA 3ZRDA 5COHA 4X1UA 2VAFA 1XZOA 1GH2A 3F9UA 1T7PB 2GQKA 2FA8A 2F9SA 4AJ8A 1JHBA 4N0ZA 3ED3A 1ZYPA 4PNFA 4XCSA 3GX8A 1ABAA 4YQMA 3HJPA 1DSBA 2GSSA 3S9FA 1M9AA 1O8XA 3IPZA 3A5WA 2GT5A 4KW6A 22GSA 3GFKA 5G30A 2HSHA 4KB3A 3FMWA 4WEYA 3DRNA 5ELGA 4LMWA 1V57A 2QKEA 4NHWA 1KBNA 4KX4A 4GQCA 3QOUA 4WR5A 2C0DA 4X43A 3VK9A 2I81A 3LYPA 1TRUA 4XRDA 3CXGA 1FHEA 2OBKA 4O5QA 2YZUA 5F06A 1O7UA 5GAND 3EYTA 5CRDA 2KOKA 1CQGA 4I6XA 4HQZA 1TOFA 2LRNA 1SJIA 5A4WA 1SD9A 3ZL5A 4Z2RA 4F03A 1PD21 4MDCA 2YZHA 2RIIA 3TGZA 3APQA 5B7CA 3UARA 2LNTA 2H6YA 1K0MA 3TRPA 4DSSB 3QAVA 1EWXA 2Z9SA 4EF0A 1FG4A 2O85A 3UBKA 2FUG2 1J9BA 4F9ZA 1O73A 5ECKB 4ZIJA 1S3RA 4D73B 4XS4A 3HYPA 2FHEA 2PN8A 2QC7A 3A5IA 3IR4A 1OYJA 1SU9A 4EDYA 4PNGA 4JR6A 2N5AA 4IELA 4JR4A 2GTUA 2FWHA 4HQSA 1X9WB 2B5YA 1DE2A 3HZ4A 4RQXA 4FYBA 1E6BA 1WE0A 4N30A 1XVQA 4PGTA 2GVPA 1RW1A 3TKSC 1FB0A 3M9JA 4Z2TA 1XWBA 4KA0A 2B1KA 2FGXA 4BVXA 2VLVA 2C4JA 1YEPA 2XPEA 1T8EB 1GRXA 4F82A 4TOPA 1G0TA 3GURA 5ECOB 2DJJA 6GSVA 1B4PA 5E4WA 5J5NA 3ZIVA 1B9XC 3IV4A 2WRTA 5J9BA 1EGRA 5CRGA 1KTEA 4WBRD 2I9HA 1VGLA 3DEXA 3IHGA 3K8NA 3RHBA 1XWAA 3GMFA 5HR0A 4V1Ag 1AQXA 3FR6A 1M2DA 3GH9A 2H30A 4HDEA 4YQUA 1TXXA 1PKWA 1M3IA 3CMIA 2H70A 5DJLA 1B9YC 2J23A 1T4ZA 4HS1A 1SL0B 3Q19A 2QSIA 2O7KA 3M9KA 3CRUA 2YWOA 1HD2A 2IMEA 3I43A 5IPHA 5D9XA 1YF0A 5IMVA 2CX3A 4KDUA 1K0CA 4K0GA 5DQYA 4YAPA 3QPMA 2B5XA 2DKHA 1S3DA 1XVWA 3H1NA 3H8QA 1XFLA 1C72A 2HZEB 1G6WA 1GSQA 4KCEA 1W4VA 3CYNA 4TR1A 3VWXA 3LW9A 3TJGA 2C80A 5AN1A 2VO4A 4DSQA 2JACA 3HVVA 4HU7A 3C1RA 2WDUA 3TKSE 2DLXA 2WFCA 3M1GA 4MZBA 1NHYA 1I5GA 2XBIA 3D4MA 5KEJA 4TXOA 1QUWA 2AB6A 1JZRA 4CY8A 2GQLA 2CT6A 3GTUB 3DIEA 3FZ5A 1T00A 4MJEA 2PBJA 1T4YA 2YJHA 3BOAA 1VF2A 3CSJA 2YWMA 4EDZA 5ECHB 1XOBA 2PUKC 3TOTA 3F4RA 2A4HA 2YV7A 3IK9A 3ERWA 4G0LA 4KAEA 4Q5QA 5J41A 2F8AA 4EIPA 3LQ7A 3IA1A 4ZBDA 4HOJA 3HDCA 6GSSA 2GSQA 2MBTA 3MDKA 4POBA 4F0CA 1E2YA 2YANA 4N11A 2QA2A 4GSNA 1M2AA 2XC2A 1BJXA 4ZBBA 5HFIA 1F2EA 1K0OA 2NTOA 3APSA 2GS3A 1AUCA 2G2QA 5EPFA 4G19A 3L4NA 3ZMKA 5IQYA 4O32A 3KXOA 1KNGA 1A24A 5CRHA 3HA9A 1TK8B 7GSSA 2XPDA 4OCEA 2HSMA 2B7KA 2REMA 3HVNA 1ZL9A 2TRCP 1HYUA 2CZ2A 2E2GA 2VCQA 2FWFA 1QK8A 4ZL8A 1EV9A 1PMTA 3VPQA 3EPTA 4FO5A 4WKWA 1WWJA 5FT3A 1ST9A 4GXZA 2A2PA 1FOVA 2HZFA 3MAKA 4EUYA 2CA8A 4WF5A 4MNNA 2H1DA 1MDKA 3RPNA 1LJRA 4I2UA 2MBSA 2M72A 2C1YA 2C3TA 4NWYA 3PGTA 5IMFA 1GNEA 5GSSA 2R3XA 5F05A 2VCWA 3ZVJD 2WZ9A 2JZRA 2DIZA 4CDOA 2L4CA 2IFQA 2HRKA 1V40A 1B4QA 5C04A 1X9MB 2HFDA 4PQ1A 2RUEA 4IHUA 2FNOA 2H0IA 2FLSA 2L59A 3KCMA 4FYCA 2WULA 2R0PA 5CNWA 3IRAA 2VM1A 2CZ3A 1Z5YE 3ZFBA 1OE7A 3I9V2 1GULA 3FW2A 1GSEA 4IJIA 3VWUA 1AC1A 3HD5A 3R2QA 2FA4A 13GSA 4X4JA 1U3AA 2H01A 5CRWA 2IPAA 3UVHA 5ABRA 2GQMA 2X8CA 2V2GA 1YF1A 2H1BA 1ERWA 3TKPA 1F9MA 3WD6A 1GL8A 1R26A 2LJKA 1U87A 3H4KA 2C3QA 20GSA 1J0FA 3DVWA 11GSA 2JZSA 1X5DA 3LJRA 2H6ZA 3ME8A 3TOUA 2P5QA 2V6OA 3LORA 4WETA 4BVYB 5IM9A 2B3SA 3F63A 1GSYA 4BL7B 3IK7A 5D9WA 4OFTA 3TJFA 3TJKA 2CAIA 4O92A 5E59A 2LEGA 18GSA 3G7JA 1QFNA 3VI5A 5AGYA 1MDJA 3WGEA 3BBYA 1MEKA 4E8EA 3Q6OA 1DE1A 1A23A 4KE3A 5GSTA 3MSZA 4IKHA 4LL4B 1Z6MA 4Q5NA 3GL5A 3SBCA 5HQPA 3PR8A 2HNLA 1X5EA 1TK5B 2V6KA 1U3IA 1A8YA 2X49A 3LG6A 3DMLA 1JZOA 4CW9A 3RAZA 3UL3A 5F0GA 2H66A 3R3EA 3TRQA 1YDKA 1AAZA 3GKNA 1ILOA 1G6YA 5ENUA 2YJ7A 2VL2C 1EP7A 2BTOT 1Q98A 3TJJA 2GSRA 1M99A 4HI7A 3GNJA 4GCIA 3O3TA 2YPMA 4JE1A 4XIHA 1R5AA 1WRYA 4L0UA 3DXBA 3ZFLA 2GDRA 3TJBA 1UA5A 4XS4B 3EMXA 4DVCA 3G7YA 2E2MA 3KH9A 3P2AA 4K1FA 4ML1A 4Q5RA 4XTSA 1A8LA 4RQRA 2HRNA 2ALBA 4N0VA 3FY7A 2CQ9A 4YKGA 3WGXA 3AY8A 3L9VA 4HZ4A 5G31A 1YJ6A 1SK1A 5F8BA 1PL2A 1ZGNA 5J9CA 2B7JA 3TDGA 2I4AA 4TR4A 2H0GA 5FWGA 1ZYEA 6GSTA 2LQQA 2IIYA 4BVXB 1GSFA 3GX0A 3RDWA 4HZ2A 1HNBA 3VWWA 4IVFA 2LQOA 1ZMAA 3F4TA 2DMMA 4K5SA 1VRSD 4LMVA 1TP9A 1NW2A 1EEMA 1JZDA 1GUKA 3LGCA 4TKYA 1V2AA 3N5OA 1VF4A 3VFIA 1K3YA 3HKRA 3M8NA 4KSMA 5EL8A 3TKQA 3EU4A 2YN1A 4YAVA 3ME7A 1RK4A 5G5FA 4ZXGA 3EURA 1K0DA 5H5SA 4I5QA 3KP8A 4ZB9A 5HR1A 4MLYA 3RPPA 3IC4A 4OD7A 5IMDA 1EEJA 5H5QA 4KSOA 1LU4A 1ACVA 3A2XA 3DD3A 4WF4A 1SD8A 2ZNMA 4MF7A 5IMCA 1TTZA 2M80A 2VLTA 1T3BA 3I6AA 1EOHA 5F07A 1SKSB 2OACA 3GUSA 5HR3A 4E8HA 4POMA 1K0BA 2X99A 3GSSA 5EVOA 2X8GA 2LNSA 3CSHA 5GAPD 4NXIA 1SJ6A 1SENA 5D73A 2WCIA 4RI7A 3TKSA 5KN1A
chains in the Genus database with same CATH topology
3KJYA 4RI6A 1WIKA 3ZYWA 2O89A 2M46A 2O87A 4HUAA 1O85A 1F3BA 1M0UA 1PN9A 4ZL9A 4K2XA 4X0XA 3F8UA 2VCVA 2JU5A 4AJ7A 4ICYA 3CTFA 2EC4A 3ZMLA 16GSA 3G9BA 4KNDA 5DAKA 19GSA 3KM6A 5ID2A 4TXOB 1K0NA 4K8MA 4GF0A 2IJYA 5IPGA 2K18A 2NPBA 1TJDA 2HI7A 4PUFC 1AIUA 2PVOC 4K2DA 3GH6A 1SK0A 2AJQB 2NDOA 1JLWA 3L0HA 1THXA 5GZZB 1YQ1A 1NM3A 4O5UA 2K8SA 4OO4A 1URMA 2LRTA 5CYYA 1F37A 2H72A 2UZ8A 4NAXA 4MF6A 3BD2A 4A5PA 2LRCA 1XXUA 4EL1A 1TRSA 2F51A 2VL3A 5AIVA 2FY6A 1JFUA 5FHIA 1PN0A 2PGTA 1O81A 5DCHA 4MK3A 2HZEA 5G1KA 2B1LA 3BCKA 4PQHA 1QXHA 1QQ2A 1WPIA 4FQUA 1R4WA 3PPUA 2C8UA 4MH3A 3GRXA 2VLUA 3CTGA 1GSDA 1THOA 2N5FA 5DALB 1R7HA 4N10A 3VLNA 4DSRA 1XWGA 4K6XA 5HFKA 5H5RA 4EXJA 1AQWA 1ERTA 4ECJA 2AAWA 3TKRA 1BYEA 4IN0A 3N9JA 1K3LA 5ECPB 4G0KA 3E9JB 4P3YB 2L5LA 2HLSA 4NV5A 2OKAA 2H8LA 4HJ2A 5D8IA 2OE3A 3U6VA 1FO5A 5J4UA 3M3MA 2VOCA 4MJBA 2WJUA 1FAAA 3FEUA 5ECSA 5LNKe 2IMIA 3UAPA 5DQSA 2FD3A 2IMFA 2GLRA 1FW1A 4G10A 5KOXA 2MYGA 3CSIA 1S3AA 9GSSA 3WGDA 1XW6A 2GT6A 5ECNB 2ZUPA 1OC9A 3MWHA 4IP6A 4KDXA 3Q18A 1PX7A 1V58A 3P7XA 4HU9A 1UN2A 4JRRA 3JCML 2E0QA 1PKZA 1OKTA 2AV4A 3MIXA 2H0HA 1Y25A 3IAM2 3HZ8A 4Z7XA 4L8EA 2X4AA 2R37A 3KIJA 2JZTA 4YQVA 3KMNA 1GWCA 2H73A 2YOIA 2P5RA 2H1GA 2VD1A 1TKDB 1TW9A 5IMZA 2AHEA 5B6NA 3F0IA 2DC5A 1A2JA 1AQVA 2CV4A 2R2JA 1EV4A 2C3NA 4PXOA 1NSWA 2HE3A 4NMUA 3EE2A 4G0IA 3UIWA 2LTKA 2A2SA 1PA3A 3FR9A 4ECBA 3H93A 1KEBA 2GGTA 5BRTA 4J57E 3GKMA 2IWTA 4OCFA 1R5PA 1HNCA 3WT1A 5A4VA 2WGRA 4GQFA 3ZLPA 4ZL7A 1ZZYA 1XW9A 3KGKA 2KP2A 6GSYA 4AF2A 4HEA2 1SL1B 2MMNA 4IP1A 4MABA 4V2MA 3KZQA 4ECCA 1JLVA 1XCCA 1N8JA 3L9UA 1GNWA 1GTAA 1OKDA 4KH7A 2WB9A 4PTSA 2D2ZA 3UBLA 5KN3A 2HXKA 1Z3EA 1ZCPA 4EIQA 4H86A 2CVKA 1SYRA 2IL3A 5G5EA 3D6IA 5KOWA 1ON4A 2DJKA 3CBUA 4MH2A 5ECMB 5LCZA 2K6VA 3W8JA 2HSYA 1PL1A 2KLXA 4NHZA 4ECIA 5IO0A 1GSUA 3IE3A 5IOXA 1OC3A 3L9SA 2R0GA 2CAQA 4TXVA 5JWQB 2CVDA 4WBJA 2CVBA 3ISOA 1QMVA 5CO3A 1X9SB 4BA7A 1HQOA 1O6JA 4JZQA 1XIYA 3GKKA 1IYIA 1WOUA 4BWSA 3E3EA 1PX6A 4PUAA 2PWJA 2R4VA 5A4UA 1ZYQB 3P8WA 1Z7RA 2L6DA 2YWIA 3FZAA 4Q5FA 2OE1A 2DBCA 2JL4A 1G7EA 1Y6EA 1G7OA 1WMJA 4IQAA 4G9HA 5IIZA 4BVYA 1U88A 1MTCA 4NV2A 1OC8A 2L4QA 4F2IA 2JADA 1YEXA 2CX4A 2QA1A 4GRFA 4BL7A 4G2EA 3FRCA 4OFNA 3J7Yk 10GSA 3GN3A 1ZOFA 3FK8A 4ZB8A 5LD0A 3WYWA 4HJMA 1HNAA 2A2RA 3Q74A 1YY7A 3D21A 2ES7A 5L71A 2H76A 1XPVA 3EINA 4K0NA 4LA1A 1W89A 1PRXA 6GSXA 3C73A 1Z7PA 1CQHA 2P0GA 4BPYA 5BMUA 4PQIA 3IAS2 4OO5A 5B8AA 3HJMA 3FZ9A 1M9BA 3KMOA 1GSSA 4ZB6A 3PH9A 2LS5A 3G7IA 3HJOA 3US3A 1GP1A 3LYKA 4CY6A 1F3AA 2RLIA 5JCGA 5JWOB 4USSA 3D0ZA 3KEBA 3TCOA 2H19A 2ON5A 4MJAA 3EVIA 1A2MA 5ECIB 3KTBA 3DGQA 4JEDA 3C7MA 1XOAA 2H71A 3M0FA 1MDIA 2VL9A 3IDVA 2OE0A 3OR5A 3W8SA 2VL2A 1GTUA 2KUCA 4YH2A 2XHFA 3NIVA 1AXDA 4OWYA 4CHSA 4POLA 8GSSA 2YNXA 4MPFA 1A0FA 3EWLA 3IXRA 1VF3A 4ML6A 3GL3A 1SKWB 1EGOA 1XBSA 1AW9A 2PERA 4WXTA 4QQ7A 1EOGA 3ZVJA 3CRTA 4ILFA 2R5GA 1UVZA 6GSUA 2X8HA 1B8XA 4DSSA 4FH8A 3ERFA 2EIOA 2RM5A 1M2BA 3FR3A 3QFBC 1X0RA 2MMOA 2OJLA 1A2LA 4QL9A 5DJMA 2DSAA 2LV3A 4KGIA 3RHCA 4D73A 5D93A 1YZXA 3HVSA 1TI3A 5J3RA 3DWVA 5ECQB 1MD3A 5EY6A 2FWGA 1GLPA 4O5RA 2IMKA 4KUNA 4MMMA 3FYGA 4PURA 1EZKA 4GWRA 3F3QA 1ERUA 2HT9A 2DJ3A 4DEJA 4EVMA 2H74A 4XRAA 3UJ1A 5IOWA 4LLRA 4WR4A 5D96A 3U5RE 1TRWA 3O6TA 4KCAA 3ZIJA 3QAWA 1BX9A 5DAKB 5G1LA 2G0FA 4V2NA 4IGJA 1X5CA 3KD0A 1TI1A 5ID2B 1SKRB 1B48A 2K8VA 3LSZA 2TIRA 3HXSA 4TR1B 2VM2A 3HCZA 2F3MA 2R0CA 3C71A 4XS1A 2JSYA 4I97A 1XWKA 5D9VA 3F3RA 3ERGA 5INYA 3QR6A 3ZTLA 2V1MA 3D4TA 4J56E 2R6KA 4ZBAA 2YCDA 1ZYNA 3TUEA 3DVXA 4TR3A 3UVTA 3QMXA 3UOMA 1TRVA 3QAGA 3F6FA 1UC7A 3FKFA 1J08A 2PMTA 2FCHA 4POKA 1JZWA 2IN3A 3DYRA 4IS0A 4TW5A 17GSA 5B6MA 4J2FA 4GTUA 2ON7A 4KDYA 4QL7A 2AYTA 2MZCA 2WS2A 2F8FA 3GYKA 4XHMA 5JCWA 1SK2A 2J9HA 4V1Ap 12GSA 2L6CA 1M7TA 1O8WA 4ACSA 2X64A 2OADA 1XW5A 2VCXA 2RUFA 1TK0B 5IMAA 2I3YA 2DJ1A 5IO2A 2V32A 1GTIA 4OMVA 4JU5A 1FOHA 1RQMA 1VF1A 2C0EA 4K7OA 4EO3A 1LBKA 5ELAA 3L78A 3HVXA 1I9DA 1OVNA 3HHVA 2TRXA 2DIYA 2V41A 3FHKA 5ECRB 2JSZA 3TRXA 2XBQA 4YKFA 3TB2A 2C0GA 5DBQA 1NHOA 1FVKA 4GSTA 4GLTA 1EP8A 1BQ7A 1DBYA 4O7HA 3ZREA 4MZWA 4XS6A 2HRFA 3EU3A 3GTUA 14GSA 3D5JA 3C1SA 3GV1A 5C00A 3VPTA 3W6GA 2MMAA 1IYHA 4IJ3A 3QD9A 3PINA 2E7PA 1GTBA 3J7Yb 3V1WA 2H1AA 4KF9A 2BMXA 1GLQA 2K9FA 1OC9B 1N2AA 4TRXA 4IQ1A 4EKZA 2RM6A 3NZNA 2LSTA 5DALA 5JWRB 1H4OA 3EC3A 3APOA 3H79A 3P90A 3C8EA 5KN0A 3LWAA 4Z2UA 3KTLA 4K9ZA 3LEFA 1H75A 5ECLB 1BG5A 2VIMA 3LXTA 1YKAA 2P31A 2PVQA 3QCPA 1YKCA 2KHPA 2GZPA 2GSTA 3GA4A 4MA9A 4AJ6A 2N5BA 1V98A 4PX1A 4K5RA 3SWLA 3LFLA 2I1UA 1Z9HA 2DJ2A 2ZCTA 2OA7A 4FIWA 2L57A 1A0RP 2C0FA 4I8BA 3QFAC 2VCTA 5CREA 4V2LA 3F6DA 2VCZA 3NOFA 2IFQB 5AISA 1OAZA 1GUMA 2HRAA 1WJKA 5A5KA 5CP1A 1TU7A 2FWEA 1T1VA 2B5EA 1BAYA 2BJXA 4RUVA 4L5LA 2QGVA 3LXZA 2OBIA 2IMDA 2LKUA 3O76A 4MP4A 4TR0A 4ULXA 5DVBA 1PQNA 3D22A 4L5OA 2NBSA 3ZZXA 2YP6A 2YWNA 4LL1B 3E0UA 3WT2A 3GKXA 1K3OA 3MYDA 4TN8A 2GZZA 5B8BA 3BCIA 4GSSA 1FB6A 2A4VA 2O8VB 4IBPA 1WP0A 4MJCA 5JCUA 4EE0A 3IC8A 3IBHA 1V9WA 1ML6A 1S3CA 4ISDA 4MZCA 2L5OA 2YV9A 2GZYA 2PU9C 2KP1A 3ZITA 2NVLA 3F4SA 3RBTA 1TDIA 4K7IA 4MF5A 2B6MA 3VWVA 3A3TA 5AIXA 4IW9A 2HYXA 1F6MC 5CAXA 1FVJA 3EMPA 2H75A 4AGSA 1USBA 5DCGA 3A2VA 1Q4JA 1PSQA 4ID0A 1DUGA 5KN2A 2LJRA 3MNGA 4NPBA 1XWCA 2LJAA 2H6XA 6GSWA 3KH7A 4FYUA 4TVEA 1U6TA 4K7NA 3QDNA 1ERVA 1K0AA 2MMZA 2DMLA 2VUPA 4OFMA 1OE8A 3UMAA 3VI7A 4JBBA 4BWQA 5G2ZA 3FZ4A 2AUVA 2LUSA 3HY2A 4L0WA 4MCUA 4ZILA 2VD0A 4EC0A 3I69A 3DKSA 2DJ0A 3VURA 5DDLA 5HFGA 1Z6NA 4MPGA 1SYXA 2PPTA 1SL2B 4F0BA 3IOSA 3GSTA 3UEMA 1PGTA 5D9TA 3GHAA 1BEDA 1GUHA 3KP9A 1QGVA 4I2TA 1SJZA 2DKIA 3A2WA 5HR2A 1MD4A 1TU8A 3BJ5A 3GIXA 2EIRA 3IHQA 2EIQA 3ZRDA 5COHA 4X1UA 2VAFA 1XZOA 1GH2A 3F9UA 1T7PB 2GQKA 2FA8A 2F9SA 4AJ8A 1JHBA 4N0ZA 3ED3A 1ZYPA 4PNFA 4XCSA 3GX8A 1ABAA 4YQMA 3HJPA 1DSBA 2GSSA 3S9FA 1M9AA 1O8XA 3IPZA 3A5WA 2GT5A 4KW6A 22GSA 3GFKA 5G30A 2HSHA 4KB3A 3FMWA 4WEYA 3DRNA 5ELGA 4LMWA 1V57A 2QKEA 4NHWA 1KBNA 4KX4A 4GQCA 3QOUA 4WR5A 2C0DA 4X43A 3VK9A 2I81A 3LYPA 1TRUA 4XRDA 3CXGA 1FHEA 2OBKA 4O5QA 2YZUA 5F06A 1O7UA 5GAND 3EYTA 5CRDA 2KOKA 1CQGA 4I6XA 4HQZA 1TOFA 2LRNA 1SJIA 5A4WA 1SD9A 3ZL5A 4Z2RA 4F03A 1PD21 4MDCA 2YZHA 2RIIA 3TGZA 3APQA 5B7CA 3UARA 2LNTA 2H6YA 1K0MA 3TRPA 4DSSB 3QAVA 1EWXA 2Z9SA 4EF0A 1FG4A 2O85A 3UBKA 2FUG2 1J9BA 4F9ZA 1O73A 5ECKB 4ZIJA 4D73B 4XS4A 3HYPA 2FHEA 2PN8A 2QC7A 3A5IA 3IR4A 1OYJA 1SU9A 4EDYA 4PNGA 4JR6A 2N5AA 4IELA 4JR4A 2GTUA 2FWHA 4HQSA 1X9WB 2B5YA 1DE2A 3HZ4A 4RQXA 4FYBA 1E6BA 1WE0A 4N30A 1XVQA 4PGTA 2GVPA 1RW1A 3TKSC 1FB0A 3M9JA 4Z2TA 1XWBA 4KA0A 2B1KA 2FGXA 4BVXA 2VLVA 2C4JA 1YEPA 2XPEA 1T8EB 1GRXA 4F82A 4TOPA 1G0TA 3GURA 5ECOB 2DJJA 6GSVA 1B4PA 5E4WA 5J5NA 3ZIVA 1B9XC 3IV4A 2WRTA 5J9BA 1EGRA 5CRGA 1KTEA 4WBRD 2I9HA 1VGLA 3DEXA 3IHGA 3K8NA 3RHBA 1XWAA 3GMFA 5HR0A 4V1Ag 1AQXA 3FR6A 1M2DA 3GH9A 2H30A 4HDEA 4YQUA 1TXXA 1PKWA 3CMIA 2H70A 5DJLA 1B9YC 2J23A 1T4ZA 4HS1A 1SL0B 3Q19A 2QSIA 2O7KA 3M9KA 3CRUA 2YWOA 1HD2A 2IMEA 3I43A 5IPHA 5D9XA 1YF0A 5IMVA 2CX3A 4KDUA 1K0CA 4K0GA 5DQYA 4YAPA 3QPMA 2B5XA 2DKHA 1S3DA 1XVWA 3H1NA 3H8QA 1XFLA 1C72A 2HZEB 1G6WA 1GSQA 4KCEA 1W4VA 3CYNA 4TR1A 3VWXA 3LW9A 3TJGA 2C80A 5AN1A 2VO4A 4DSQA 2JACA 3HVVA 4HU7A 3C1RA 2WDUA 3TKSE 2DLXA 2WFCA 3M1GA 4MZBA 1NHYA 1I5GA 2XBIA 3D4MA 5KEJA 4TXOA 1QUWA 2AB6A 1JZRA 4CY8A 2GQLA 2CT6A 3GTUB 3DIEA 3FZ5A 1T00A 4MJEA 2PBJA 1T4YA 2YJHA 3BOAA 1VF2A 3CSJA 2YWMA 4EDZA 5ECHB 1XOBA 2PUKC 3TOTA 3F4RA 2A4HA 2YV7A 3IK9A 3ERWA 4G0LA 4KAEA 4Q5QA 5J41A 2F8AA 4EIPA 3LQ7A 3IA1A 4ZBDA 4HOJA 3HDCA 6GSSA 2GSQA 2MBTA 3MDKA 4POBA 4F0CA 1E2YA 2YANA 4N11A 2QA2A 4GSNA 1M2AA 2XC2A 1BJXA 4ZBBA 5HFIA 1F2EA 1K0OA 2NTOA 3APSA 2GS3A 1AUCA 2G2QA 5EPFA 4G19A 3L4NA 3ZMKA 5IQYA 4O32A 3KXOA 1KNGA 1A24A 5CRHA 3HA9A 1TK8B 7GSSA 2XPDA 4OCEA 2HSMA 2B7KA 2REMA 1ZL9A 2TRCP 1HYUA 2CZ2A 2E2GA 2VCQA 2FWFA 1QK8A 4ZL8A 1EV9A 1PMTA 3VPQA 3EPTA 4FO5A 4WKWA 1WWJA 5FT3A 1ST9A 4GXZA 2A2PA 1FOVA 2HZFA 3MAKA 4EUYA 2CA8A 4WF5A 4MNNA 2H1DA 1MDKA 3RPNA 1LJRA 4I2UA 2MBSA 2M72A 2C1YA 2C3TA 4NWYA 3PGTA 5IMFA 1GNEA 5GSSA 2R3XA 5F05A 2VCWA 3ZVJD 2WZ9A 2JZRA 2DIZA 4CDOA 2L4CA 2IFQA 2HRKA 1V40A 1B4QA 5C04A 1X9MB 2HFDA 4PQ1A 2RUEA 4IHUA 2FNOA 2H0IA 2FLSA 2L59A 3KCMA 4FYCA 2WULA 2R0PA 5CNWA 3IRAA 2VM1A 2CZ3A 1Z5YE 3ZFBA 1OE7A 3I9V2 1GULA 3FW2A 1GSEA 4IJIA 3VWUA 1AC1A 3HD5A 3R2QA 2FA4A 13GSA 4X4JA 1U3AA 2H01A 5CRWA 2IPAA 3UVHA 5ABRA 2GQMA 2X8CA 2V2GA 1YF1A 2H1BA 1ERWA 3TKPA 1F9MA 3WD6A 1GL8A 1R26A 2LJKA 1U87A 3H4KA 2C3QA 20GSA 1J0FA 3DVWA 11GSA 2JZSA 1X5DA 3LJRA 2H6ZA 3ME8A 3TOUA 2P5QA 2V6OA 3LORA 4WETA 4BVYB 5IM9A 2B3SA 3F63A 1GSYA 4BL7B 3IK7A 5D9WA 4OFTA 3TJFA 3TJKA 2CAIA 4O92A 5E59A 2LEGA 18GSA 3G7JA 1QFNA 3VI5A 5AGYA 1MDJA 3WGEA 3BBYA 1MEKA 4E8EA 3Q6OA 1DE1A 1A23A 4KE3A 5GSTA 3MSZA 4IKHA 4LL4B 1Z6MA 4Q5NA 3GL5A 3SBCA 5HQPA 3PR8A 2HNLA 1X5EA 1TK5B 2V6KA 1U3IA 1A8YA 2X49A 3LG6A 3DMLA 1JZOA 4CW9A 3RAZA 3UL3A 5F0GA 2H66A 3R3EA 3TRQA 1YDKA 1AAZA 3GKNA 1ILOA 1G6YA 5ENUA 2YJ7A 2VL2C 1EP7A 2BTOT 1Q98A 3TJJA 2GSRA 1M99A 4HI7A 3GNJA 4GCIA 3O3TA 2YPMA 4JE1A 4XIHA 1R5AA 1WRYA 4L0UA 3DXBA 3ZFLA 2GDRA 3TJBA 1UA5A 4XS4B 3EMXA 4DVCA 3G7YA 2E2MA 3KH9A 3P2AA 4K1FA 4ML1A 4Q5RA 4XTSA 1A8LA 4RQRA 2HRNA 2ALBA 4N0VA 3FY7A 2CQ9A 4YKGA 3WGXA 3AY8A 3L9VA 4HZ4A 5G31A 1YJ6A 1SK1A 5F8BA 1PL2A 1ZGNA 5J9CA 2B7JA 3TDGA 2I4AA 4TR4A 2H0GA 5FWGA 1ZYEA 6GSTA 2LQQA 2IIYA 4BVXB 1GSFA 3GX0A 3RDWA 4HZ2A 1HNBA 3VWWA 4IVFA 2LQOA 1ZMAA 3F4TA 2DMMA 4K5SA 1VRSD 4LMVA 1TP9A 1NW2A 1EEMA 1JZDA 1GUKA 3LGCA 4TKYA 1V2AA 3N5OA 1VF4A 3VFIA 1K3YA 3HKRA 3M8NA 4KSMA 5EL8A 3TKQA 3EU4A 2YN1A 4YAVA 3ME7A 1RK4A 5G5FA 4ZXGA 3EURA 1K0DA 5H5SA 4I5QA 3KP8A 4ZB9A 5HR1A 4MLYA 3RPPA 3IC4A 4OD7A 5IMDA 1EEJA 5H5QA 4KSOA 1LU4A 1ACVA 3A2XA 3DD3A 4WF4A 1SD8A 2ZNMA 4MF7A 5IMCA 1TTZA 2M80A 2VLTA 1T3BA 3I6AA 1EOHA 5F07A 1SKSB 2OACA 3GUSA 5HR3A 4E8HA 4POMA 1K0BA 2X99A 3GSSA 5EVOA 2X8GA 2LNSA 3CSHA 5GAPD 4NXIA 1SJ6A 1SENA 5D73A 2WCIA 4RI7A 3TKSA 5KN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KJY A;  4RI6 A;  1WIK A;  3ZYW A;  2O89 A;  2M46 A;  2O87 A;  4HUA A;  1O85 A;  1F3B A;  1M0U A;  1PN9 A;  4ZL9 A;  4X0X A;  3F8U A;  2VCV A;  2JU5 A;  4AJ7 A;  3CTF A;  2EC4 A;  3ZML A;  16GS A;  3G9B A;  4KND A;  5DAK A;  19GS A;  3KM6 A;  5ID2 A;  4TXO B;  1K0N A;  4K8M A;  4GF0 A;  2IJY A;  5IPG A;  2K18 A;  2NPB A;  1TJD A;  2HI7 A;  4PUF C;  1AIU A;  2PVO C;  4K2D A;  3GH6 A;  1SK0 A;  2AJQ B;  2NDO A;  1JLW A;  3L0H A;  1THX A;  5GZZ B;  1YQ1 A;  1NM3 A;  2K8S A;  4OO4 A;  1URM A;  2LRT A;  5CYY A;  1F37 A;  2H72 A;  4NAX A;  4MF6 A;  3BD2 A;  2LRC A;  1XXU A;  4EL1 A;  1TRS A;  2F51 A;  2VL3 A;  5AIV A;  2FY6 A;  1JFU A;  5FHI A;  2PGT A;  1O81 A;  5DCH A;  4MK3 A;  2HZE A;  5G1K A;  2B1L A;  3BCK A;  4PQH A;  1QXH A;  1QQ2 A;  1WPI A;  1R4W A;  2C8U A;  4MH3 A;  3GRX A;  2VLU A;  3CTG A;  1GSD A;  1THO A;  2N5F A;  5DAL B;  1R7H A;  4N10 A;  3VLN A;  4DSR A;  1XWG A;  4K6X A;  5HFK A;  5H5R A;  4EXJ A;  1AQW A;  1ERT A;  4ECJ A;  2AAW A;  3TKR A;  1BYE A;  4IN0 A;  3N9J A;  1K3L A;  5ECP B;  3E9J B;  4P3Y B;  2L5L A;  2HLS A;  4NV5 A;  2OKA A;  2H8L A;  4HJ2 A;  5D8I A;  2OE3 A;  3U6V A;  1FO5 A;  5J4U A;  3M3M A;  2VOC A;  4MJB A;  2WJU A;  1FAA A;  3FEU A;  5ECS A;  5LNK e;  2IMI A;  3UAP A;  5DQS A;  2FD3 A;  2IMF A;  2GLR A;  1FW1 A;  4G10 A;  2MYG A;  3CSI A;  1S3A A;  9GSS A;  3WGD A;  1XW6 A;  2GT6 A;  5ECN B;  2ZUP A;  1OC9 A;  3MWH A;  4IP6 A;  4KDX A;  3Q18 A;  1PX7 A;  1V58 A;  3P7X A;  4HU9 A;  1UN2 A;  4JRR A;  3JCM L;  2E0Q A;  1PKZ A;  1OKT A;  2AV4 A;  2H0H A;  1Y25 A;  3IAM 2;  3HZ8 A;  4Z7X A;  4L8E A;  2R37 A;  3KIJ A;  2JZT A;  4YQV A;  3KMN A;  1GWC A;  2H73 A;  2YOI A;  2P5R A;  2H1G A;  2VD1 A;  1TKD B;  1TW9 A;  5IMZ A;  2AHE A;  5B6N A;  3F0I A;  2DC5 A;  1A2J A;  1AQV A;  2CV4 A;  2R2J A;  1EV4 A;  2C3N A;  4PXO A;  1NSW A;  2HE3 A;  4NMU A;  3EE2 A;  3UIW A;  2LTK A;  2A2S A;  1PA3 A;  3FR9 A;  4ECB A;  3H93 A;  1KEB A;  2GGT A;  4J57 E;  3GKM A;  2IWT A;  4OCF A;  1R5P A;  1HNC A;  3WT1 A;  5A4V A;  2WGR A;  4GQF A;  3ZLP A;  4ZL7 A;  1ZZY A;  1XW9 A;  3KGK A;  2KP2 A;  6GSY A;  4AF2 A;  4HEA 2;  1SL1 B;  2MMN A;  4IP1 A;  4MAB A;  4V2M A;  3KZQ A;  4ECC A;  1JLV A;  1XCC A;  1N8J A;  3L9U A;  1GNW A;  1GTA A;  1OKD A;  4KH7 A;  2WB9 A;  2D2Z A;  3UBL A;  5KN3 A;  2HXK A;  1Z3E A;  1ZCP A;  4H86 A;  2CVK A;  1SYR A;  2IL3 A;  5G5E A;  3D6I A;  1ON4 A;  2DJK A;  3CBU A;  4MH2 A;  5ECM B;  5LCZ A;  2K6V A;  3W8J A;  2HSY A;  1PL1 A;  2KLX A;  4NHZ A;  4ECI A;  5IO0 A;  1GSU A;  3IE3 A;  5IOX A;  1OC3 A;  3L9S A;  2CAQ A;  4TXV A;  5JWQ B;  2CVD A;  4WBJ A;  2CVB A;  3ISO A;  1QMV A;  5CO3 A;  1X9S B;  4BA7 A;  1HQO A;  1O6J A;  4JZQ A;  1XIY A;  3GKK A;  1IYI A;  1WOU A;  4BWS A;  3E3E A;  1PX6 A;  4PUA A;  2PWJ A;  2R4V A;  5A4U A;  1ZYQ B;  3P8W A;  1Z7R A;  2L6D A;  2YWI A;  3FZA A;  4Q5F A;  2OE1 A;  2DBC A;  2JL4 A;  1G7E A;  1Y6E A;  1G7O A;  1WMJ A;  4IQA A;  4G9H A;  5IIZ A;  4BVY A;  1U88 A;  1MTC A;  4NV2 A;  1OC8 A;  2L4Q A;  4F2I A;  2JAD A;  1YEX A;  2CX4 A;  4GRF A;  4BL7 A;  4G2E A;  3FRC A;  4OFN A;  3J7Y k;  10GS A;  3GN3 A;  1ZOF A;  3FK8 A;  4ZB8 A;  5LD0 A;  3WYW A;  4HJM A;  1HNA A;  2A2R A;  3Q74 A;  1YY7 A;  3D21 A;  2ES7 A;  5L71 A;  2H76 A;  1XPV A;  3EIN A;  4K0N A;  4LA1 A;  1W89 A;  1PRX A;  6GSX A;  3C73 A;  1Z7P A;  1CQH A;  2P0G A;  4BPY A;  4PQI A;  3IAS 2;  4OO5 A;  5B8A A;  3HJM A;  3FZ9 A;  1M9B A;  3KMO A;  1GSS A;  4ZB6 A;  3PH9 A;  2LS5 A;  3G7I A;  3HJO A;  3US3 A;  1GP1 A;  3LYK A;  1F3A A;  2RLI A;  5JCG A;  5JWO B;  3D0Z A;  3KEB A;  3TCO A;  2H19 A;  2ON5 A;  4MJA A;  3EVI A;  1A2M A;  5ECI B;  3KTB A;  3DGQ A;  4JED A;  3C7M A;  1XOA A;  2H71 A;  3M0F A;  1MDI A;  2VL9 A;  3IDV A;  2OE0 A;  3OR5 A;  3W8S A;  2VL2 A;  1GTU A;  2KUC A;  4YH2 A;  2XHF A;  3NIV A;  1AXD A;  4OWY A;  4CHS A;  4POL A;  8GSS A;  2YNX A;  4MPF A;  1A0F A;  3EWL A;  3IXR A;  1VF3 A;  4ML6 A;  3GL3 A;  1SKW B;  1EGO A;  1XBS A;  1AW9 A;  2PER A;  4WXT A;  4QQ7 A;  1EOG A;  3ZVJ A;  3CRT A;  4ILF A;  2R5G A;  1UVZ A;  6GSU A;  2X8H A;  1B8X A;  4DSS A;  4FH8 A;  3ERF A;  2EIO A;  2RM5 A;  1M2B A;  3FR3 A;  3QFB C;  1X0R A;  2MMO A;  2OJL A;  1A2L A;  4QL9 A;  5DJM A;  2DSA A;  2LV3 A;  4KGI A;  3RHC A;  4D73 A;  5D93 A;  1YZX A;  3HVS A;  1TI3 A;  5J3R A;  3DWV A;  5ECQ B;  1MD3 A;  5EY6 A;  2FWG A;  1GLP A;  4O5R A;  2IMK A;  4KUN A;  4MMM A;  3FYG A;  4PUR A;  1EZK A;  4GWR A;  3F3Q A;  1ERU A;  2HT9 A;  2DJ3 A;  4DEJ A;  4EVM A;  2H74 A;  4XRA A;  3UJ1 A;  5IOW A;  4LLR A;  4WR4 A;  5D96 A;  3U5R E;  1TRW A;  3O6T A;  4KCA A;  3ZIJ A;  3QAW A;  1BX9 A;  5DAK B;  5G1L A;  2G0F A;  4V2N A;  4IGJ A;  1X5C A;  3KD0 A;  1TI1 A;  5ID2 B;  1SKR B;  1B48 A;  2K8V A;  3LSZ A;  2TIR A;  3HXS A;  4TR1 B;  2VM2 A;  3HCZ A;  2F3M A;  3C71 A;  4XS1 A;  2JSY A;  4I97 A;  1XWK A;  5D9V A;  3F3R A;  3ERG A;  5INY A;  3QR6 A;  3ZTL A;  2V1M A;  3D4T A;  4J56 E;  2R6K A;  4ZBA A;  2YCD A;  3TUE A;  3DVX A;  4TR3 A;  3UVT A;  3QMX A;  3UOM A;  1TRV A;  3QAG A;  3F6F A;  1UC7 A;  3FKF A;  1J08 A;  2PMT A;  2FCH A;  4POK A;  1JZW A;  2IN3 A;  3DYR A;  4IS0 A;  4TW5 A;  17GS A;  5B6M A;  4J2F A;  4GTU A;  2ON7 A;  4KDY A;  4QL7 A;  2AYT A;  2MZC A;  2WS2 A;  2F8F A;  3GYK A;  4XHM A;  5JCW A;  1SK2 A;  2J9H A;  4V1A p;  12GS A;  2L6C A;  1M7T A;  1O8W A;  4ACS A;  2X64 A;  2OAD A;  1XW5 A;  2VCX A;  2RUF A;  1TK0 B;  5IMA A;  2I3Y A;  2DJ1 A;  5IO2 A;  2V32 A;  1GTI A;  4OMV A;  4JU5 A;  1RQM A;  1VF1 A;  2C0E A;  4K7O A;  4EO3 A;  1LBK A;  5ELA A;  3L78 A;  3HVX A;  1I9D A;  1OVN A;  3HHV A;  2TRX A;  2DIY A;  2V41 A;  3FHK A;  5ECR B;  2JSZ A;  3TRX A;  2XBQ A;  3TB2 A;  2C0G A;  5DBQ A;  1NHO A;  1FVK A;  4GST A;  4GLT A;  1EP8 A;  1BQ7 A;  1DBY A;  4O7H A;  3ZRE A;  4MZW A;  4XS6 A;  2HRF A;  3EU3 A;  3GTU A;  14GS A;  3D5J A;  3C1S A;  3GV1 A;  5C00 A;  3VPT A;  3W6G A;  2MMA A;  1IYH A;  4IJ3 A;  3QD9 A;  3PIN A;  2E7P A;  1GTB A;  3J7Y b;  3V1W A;  2H1A A;  2BMX A;  1GLQ A;  2K9F A;  1OC9 B;  1N2A A;  4TRX A;  4IQ1 A;  4EKZ A;  2RM6 A;  3NZN A;  2LST A;  5DAL A;  5JWR B;  1H4O A;  3EC3 A;  3APO A;  3H79 A;  3P90 A;  3C8E A;  5KN0 A;  3LWA A;  3KTL A;  4K9Z A;  3LEF A;  1H75 A;  5ECL B;  1BG5 A;  2VIM A;  3LXT A;  1YKA A;  2P31 A;  2PVQ A;  3QCP A;  1YKC A;  2KHP A;  2GZP A;  2GST A;  3GA4 A;  4MA9 A;  4AJ6 A;  2N5B A;  1V98 A;  4PX1 A;  3SWL A;  3LFL A;  2I1U A;  1Z9H A;  2DJ2 A;  2ZCT A;  2OA7 A;  4FIW A;  2L57 A;  1A0R P;  2C0F A;  4I8B A;  3QFA C;  2VCT A;  5CRE A;  4V2L A;  3F6D A;  2VCZ A;  3NOF A;  2IFQ B;  5AIS A;  1OAZ A;  1GUM A;  1WJK A;  5A5K A;  5CP1 A;  1TU7 A;  2FWE A;  1T1V A;  2B5E A;  1BAY A;  2BJX A;  4RUV A;  4L5L A;  2QGV A;  3LXZ A;  2OBI A;  2IMD A;  2LKU A;  3O76 A;  4MP4 A;  4TR0 A;  4ULX A;  5DVB A;  1PQN A;  3D22 A;  4L5O A;  2NBS A;  3ZZX A;  2YP6 A;  2YWN A;  4LL1 B;  3E0U A;  3WT2 A;  3GKX A;  1K3O A;  4TN8 A;  2GZZ A;  5B8B A;  3BCI A;  4GSS A;  1FB6 A;  2A4V A;  2O8V B;  4IBP A;  1WP0 A;  4MJC A;  5JCU A;  4EE0 A;  3IBH A;  1V9W A;  1ML6 A;  1S3C A;  4ISD A;  4MZC A;  2L5O A;  2YV9 A;  2GZY A;  2PU9 C;  2KP1 A;  3ZIT A;  2NVL A;  3F4S A;  3RBT A;  1TDI A;  4K7I A;  4MF5 A;  2B6M A;  3VWV A;  3A3T A;  5AIX A;  4IW9 A;  2HYX A;  1F6M C;  5CAX A;  1FVJ A;  3EMP A;  2H75 A;  4AGS A;  1USB A;  5DCG A;  3A2V A;  1Q4J A;  1PSQ A;  4ID0 A;  1DUG A;  5KN2 A;  2LJR A;  3MNG A;  4NPB A;  1XWC A;  2LJA A;  2H6X A;  6GSW A;  3KH7 A;  4FYU A;  4TVE A;  1U6T A;  4K7N A;  3QDN A;  1ERV A;  1K0A A;  2MMZ A;  2DML A;  2VUP A;  4OFM A;  1OE8 A;  3UMA A;  3VI7 A;  4JBB A;  4BWQ A;  5G2Z A;  3FZ4 A;  2AUV A;  2LUS A;  3HY2 A;  4L0W A;  4MCU A;  4ZIL A;  2VD0 A;  4EC0 A;  3I69 A;  3DKS A;  2DJ0 A;  3VUR A;  5DDL A;  5HFG A;  1Z6N A;  4MPG A;  1SYX A;  2PPT A;  1SL2 B;  4F0B A;  3IOS A;  3GST A;  3UEM A;  1PGT A;  5D9T A;  3GHA A;  1BED A;  1GUH A;  3KP9 A;  1QGV A;  4I2T A;  1SJZ A;  3A2W A;  5HR2 A;  1MD4 A;  1TU8 A;  3BJ5 A;  3GIX A;  2EIR A;  3IHQ A;  2EIQ A;  3ZRD A;  5COH A;  4X1U A;  2VAF A;  1XZO A;  1GH2 A;  3F9U A;  1T7P B;  2GQK A;  2FA8 A;  2F9S A;  4AJ8 A;  1JHB A;  4N0Z A;  3ED3 A;  4PNF A;  4XCS A;  3GX8 A;  1ABA A;  4YQM A;  3HJP A;  1DSB A;  2GSS A;  3S9F A;  1M9A A;  1O8X A;  3IPZ A;  3A5W A;  2GT5 A;  4KW6 A;  22GS A;  3GFK A;  5G30 A;  2HSH A;  4KB3 A;  4WEY A;  3DRN A;  5ELG A;  4LMW A;  1V57 A;  2QKE A;  4NHW A;  1KBN A;  4KX4 A;  4GQC A;  3QOU A;  4WR5 A;  2C0D A;  4X43 A;  3VK9 A;  2I81 A;  3LYP A;  1TRU A;  4XRD A;  3CXG A;  1FHE A;  2OBK A;  2YZU A;  5F06 A;  1O7U A;  5GAN D;  3EYT A;  5CRD A;  2KOK A;  1CQG A;  4I6X A;  4HQZ A;  1TOF A;  2LRN A;  1SJI A;  5A4W A;  1SD9 A;  3ZL5 A;  4F03 A;  1PD2 1;  4MDC A;  2YZH A;  2RII A;  3TGZ A;  3APQ A;  5B7C A;  3UAR A;  2LNT A;  2H6Y A;  1K0M A;  3TRP A;  4DSS B;  3QAV A;  1EWX A;  2Z9S A;  4EF0 A;  1FG4 A;  2O85 A;  3UBK A;  2FUG 2;  1J9B A;  4F9Z A;  1O73 A;  5ECK B;  4ZIJ A;  4D73 B;  4XS4 A;  3HYP A;  2FHE A;  2PN8 A;  2QC7 A;  3IR4 A;  1OYJ A;  1SU9 A;  4EDY A;  4PNG A;  4JR6 A;  2N5A A;  4IEL A;  4JR4 A;  2GTU A;  2FWH A;  4HQS A;  1X9W B;  2B5Y A;  1DE2 A;  3HZ4 A;  4RQX A;  4FYB A;  1E6B A;  1WE0 A;  4N30 A;  1XVQ A;  4PGT A;  2GVP A;  1RW1 A;  3TKS C;  1FB0 A;  3M9J A;  1XWB A;  4KA0 A;  2B1K A;  2FGX A;  4BVX A;  2VLV A;  2C4J A;  1YEP A;  2XPE A;  1T8E B;  1GRX A;  4F82 A;  4TOP A;  1G0T A;  3GUR A;  5ECO B;  2DJJ A;  6GSV A;  1B4P A;  5E4W A;  5J5N A;  3ZIV A;  1B9X C;  3IV4 A;  2WRT A;  5J9B A;  1EGR A;  5CRG A;  1KTE A;  4WBR D;  2I9H A;  1VGL A;  3DEX A;  3K8N A;  3RHB A;  1XWA A;  3GMF A;  5HR0 A;  4V1A g;  1AQX A;  3FR6 A;  1M2D A;  3GH9 A;  2H30 A;  4HDE A;  4YQU A;  1TXX A;  1PKW A;  3CMI A;  2H70 A;  5DJL A;  1B9Y C;  2J23 A;  1T4Z A;  4HS1 A;  1SL0 B;  3Q19 A;  2QSI A;  2O7K A;  3M9K A;  3CRU A;  2YWO A;  1HD2 A;  2IME A;  3I43 A;  5IPH A;  5D9X A;  1YF0 A;  5IMV A;  2CX3 A;  4KDU A;  1K0C A;  4K0G A;  5DQY A;  4YAP A;  3QPM A;  2B5X A;  1S3D A;  1XVW A;  3H1N A;  3H8Q A;  1XFL A;  1C72 A;  2HZE B;  1G6W A;  1GSQ A;  4KCE A;  1W4V A;  3CYN A;  4TR1 A;  3VWX A;  3TJG A;  2C80 A;  5AN1 A;  2VO4 A;  4DSQ A;  2JAC A;  3HVV A;  4HU7 A;  3C1R A;  2WDU A;  3TKS E;  2DLX A;  2WFC A;  3M1G A;  4MZB A;  1NHY A;  1I5G A;  2XBI A;  3D4M A;  5KEJ A;  4TXO A;  1QUW A;  2AB6 A;  1JZR A;  2GQL A;  2CT6 A;  3GTU B;  3DIE A;  3FZ5 A;  1T00 A;  4MJE A;  2PBJ A;  1T4Y A;  2YJH A;  3BOA A;  1VF2 A;  3CSJ A;  2YWM A;  4EDZ A;  5ECH B;  1XOB A;  2PUK C;  3TOT A;  3F4R A;  2YV7 A;  3IK9 A;  3ERW A;  4KAE A;  4Q5Q A;  5J41 A;  2F8A A;  3LQ7 A;  3IA1 A;  4ZBD A;  4HOJ A;  3HDC A;  6GSS A;  2GSQ A;  2MBT A;  3MDK A;  4POB A;  4F0C A;  1E2Y A;  2YAN A;  4N11 A;  4GSN A;  1M2A A;  2XC2 A;  1BJX A;  4ZBB A;  5HFI A;  1F2E A;  1K0O A;  2NTO A;  3APS A;  2GS3 A;  1AUC A;  2G2Q A;  5EPF A;  4G19 A;  3L4N A;  3ZMK A;  5IQY A;  4O32 A;  3KXO A;  1KNG A;  1A24 A;  5CRH A;  3HA9 A;  1TK8 B;  7GSS A;  2XPD A;  4OCE A;  2B7K A;  2REM A;  1ZL9 A;  2TRC P;  1HYU A;  2CZ2 A;  2E2G A;  2VCQ A;  2FWF A;  1QK8 A;  4ZL8 A;  1EV9 A;  1PMT A;  3VPQ A;  4FO5 A;  4WKW A;  1WWJ A;  5FT3 A;  1ST9 A;  4GXZ A;  1FOV A;  2HZF A;  3MAK A;  4EUY A;  2CA8 A;  4WF5 A;  2H1D A;  1MDK A;  3RPN A;  1LJR A;  4I2U A;  2MBS A;  2M72 A;  2C1Y A;  2C3T A;  4NWY A;  3PGT A;  5IMF A;  1GNE A;  5GSS A;  2R3X A;  5F05 A;  2VCW A;  3ZVJ D;  2WZ9 A;  2JZR A;  2DIZ A;  4CDO A;  2L4C A;  2IFQ A;  1V40 A;  1B4Q A;  5C04 A;  1X9M B;  2HFD A;  4PQ1 A;  2RUE A;  4IHU A;  2FNO A;  2H0I A;  2FLS A;  2L59 A;  3KCM A;  4FYC A;  2WUL A;  5CNW A;  3IRA A;  2VM1 A;  2CZ3 A;  1Z5Y E;  3ZFB A;  1OE7 A;  3I9V 2;  1GUL A;  3FW2 A;  1GSE A;  4IJI A;  3VWU A;  1AC1 A;  3HD5 A;  3R2Q A;  2FA4 A;  13GS A;  1U3A A;  2H01 A;  5CRW A;  2IPA A;  3UVH A;  5ABR A;  2GQM A;  2X8C A;  2V2G A;  1YF1 A;  2H1B A;  1ERW A;  3TKP A;  1F9M A;  3WD6 A;  1GL8 A;  1R26 A;  2LJK A;  1U87 A;  3H4K A;  2C3Q A;  20GS A;  1J0F A;  3DVW A;  11GS A;  2JZS A;  1X5D A;  3LJR A;  2H6Z A;  3ME8 A;  3TOU A;  2P5Q A;  2V6O A;  3LOR A;  4WET A;  5IM9 A;  2B3S A;  3F63 A;  1GSY A;  3IK7 A;  5D9W A;  4OFT A;  3TJF A;  3TJK A;  2CAI A;  4O92 A;  5E59 A;  2LEG A;  18GS A;  3G7J A;  1QFN A;  3VI5 A;  5AGY A;  1MDJ A;  3WGE A;  3BBY A;  1MEK A;  4E8E A;  3Q6O A;  1DE1 A;  1A23 A;  4KE3 A;  5GST A;  3MSZ A;  4IKH A;  4LL4 B;  1Z6M A;  4Q5N A;  3GL5 A;  3SBC A;  5HQP A;  3PR8 A;  2HNL A;  1X5E A;  1TK5 B;  2V6K A;  1U3I A;  1A8Y A;  3LG6 A;  3DML A;  1JZO A;  4CW9 A;  3RAZ A;  3UL3 A;  5F0G A;  2H66 A;  3TRQ A;  1YDK A;  1AAZ A;  3GKN A;  1ILO A;  1G6Y A;  5ENU A;  2YJ7 A;  2VL2 C;  1EP7 A;  2BTO T;  1Q98 A;  3TJJ A;  2GSR A;  1M99 A;  4HI7 A;  3GNJ A;  4GCI A;  3O3T A;  2YPM A;  4JE1 A;  4XIH A;  1R5A A;  1WRY A;  4L0U A;  3DXB A;  3ZFL A;  2GDR A;  3TJB A;  1UA5 A;  4XS4 B;  3EMX A;  4DVC A;  3G7Y A;  2E2M A;  3KH9 A;  3P2A A;  4K1F A;  4ML1 A;  4Q5R A;  4XTS A;  1A8L A;  4RQR A;  2HRN A;  2ALB A;  4N0V A;  3FY7 A;  2CQ9 A;  3WGX A;  3AY8 A;  3L9V A;  4HZ4 A;  5G31 A;  1YJ6 A;  1SK1 A;  5F8B A;  1PL2 A;  1ZGN A;  5J9C A;  2B7J A;  3TDG A;  2I4A A;  4TR4 A;  2H0G A;  5FWG A;  1ZYE A;  6GST A;  2LQQ A;  2IIY A;  1GSF A;  3GX0 A;  3RDW A;  4HZ2 A;  1HNB A;  3VWW A;  4IVF A;  2LQO A;  1ZMA A;  3F4T A;  2DMM A;  1VRS D;  4LMV A;  1TP9 A;  1NW2 A;  1EEM A;  1JZD A;  1GUK A;  3LGC A;  4TKY A;  1V2A A;  3N5O A;  1VF4 A;  3VFI A;  1K3Y A;  3HKR A;  3M8N A;  4KSM A;  5EL8 A;  3TKQ A;  3EU4 A;  2YN1 A;  4YAV A;  3ME7 A;  1RK4 A;  5G5F A;  4ZXG A;  3EUR A;  1K0D A;  5H5S A;  4I5Q A;  3KP8 A;  4ZB9 A;  5HR1 A;  4MLY A;  3RPP A;  3IC4 A;  4OD7 A;  5IMD A;  1EEJ A;  5H5Q A;  4KSO A;  1LU4 A;  1ACV A;  3A2X A;  3DD3 A;  4WF4 A;  1SD8 A;  2ZNM A;  4MF7 A;  5IMC A;  1TTZ A;  2M80 A;  2VLT A;  1T3B A;  3I6A A;  1EOH A;  5F07 A;  1SKS B;  2OAC A;  3GUS A;  5HR3 A;  4E8H A;  4POM A;  1K0B A;  2X99 A;  3GSS A;  5EVO A;  2X8G A;  2LNS A;  3CSH A;  5GAP D;  4NXI A;  1SJ6 A;  1SEN A;  5D73 A;  2WCI A;  4RI7 A;  3TKS A;  5KN1 A; 
#chains in the Genus database with same CATH topology
 3KJY A;  4RI6 A;  1WIK A;  3ZYW A;  2O89 A;  2M46 A;  2O87 A;  4HUA A;  1O85 A;  1F3B A;  1M0U A;  1PN9 A;  4ZL9 A;  4K2X A;  4X0X A;  3F8U A;  2VCV A;  2JU5 A;  4AJ7 A;  4ICY A;  3CTF A;  2EC4 A;  3ZML A;  16GS A;  3G9B A;  4KND A;  5DAK A;  19GS A;  3KM6 A;  5ID2 A;  4TXO B;  1K0N A;  4K8M A;  4GF0 A;  2IJY A;  5IPG A;  2K18 A;  2NPB A;  1TJD A;  2HI7 A;  4PUF C;  1AIU A;  2PVO C;  4K2D A;  3GH6 A;  1SK0 A;  2AJQ B;  2NDO A;  1JLW A;  3L0H A;  1THX A;  5GZZ B;  1YQ1 A;  1NM3 A;  4O5U A;  2K8S A;  4OO4 A;  1URM A;  2LRT A;  5CYY A;  1F37 A;  2H72 A;  2UZ8 A;  4NAX A;  4MF6 A;  3BD2 A;  4A5P A;  2LRC A;  1XXU A;  4EL1 A;  1TRS A;  2F51 A;  2VL3 A;  5AIV A;  2FY6 A;  1JFU A;  5FHI A;  1PN0 A;  2PGT A;  1O81 A;  5DCH A;  4MK3 A;  2HZE A;  5G1K A;  2B1L A;  3BCK A;  4PQH A;  1QXH A;  1QQ2 A;  1WPI A;  4FQU A;  1R4W A;  3PPU A;  2C8U A;  4MH3 A;  3GRX A;  2VLU A;  3CTG A;  1GSD A;  1THO A;  2N5F A;  5DAL B;  1R7H A;  4N10 A;  3VLN A;  4DSR A;  1XWG A;  4K6X A;  5HFK A;  5H5R A;  4EXJ A;  1AQW A;  1ERT A;  4ECJ A;  2AAW A;  3TKR A;  1BYE A;  4IN0 A;  3N9J A;  1K3L A;  5ECP B;  4G0K A;  3E9J B;  4P3Y B;  2L5L A;  2HLS A;  4NV5 A;  2OKA A;  2H8L A;  4HJ2 A;  5D8I A;  2OE3 A;  3U6V A;  1FO5 A;  5J4U A;  3M3M A;  2VOC A;  4MJB A;  2WJU A;  1FAA A;  3FEU A;  5ECS A;  5LNK e;  2IMI A;  3UAP A;  5DQS A;  2FD3 A;  2IMF A;  2GLR A;  1FW1 A;  4G10 A;  5KOX A;  2MYG A;  3CSI A;  4HSC X;  1S3A A;  9GSS A;  3WGD A;  1XW6 A;  2GT6 A;  5ECN B;  2ZUP A;  1OC9 A;  3MWH A;  4IP6 A;  4KDX A;  3Q18 A;  1PX7 A;  1V58 A;  1PFO A;  3P7X A;  4HU9 A;  1UN2 A;  4JRR A;  3JCM L;  2E0Q A;  1PKZ A;  1OKT A;  2AV4 A;  3MIX A;  2H0H A;  1Y25 A;  3IAM 2;  3HZ8 A;  4Z7X A;  4L8E A;  2X4A A;  2R37 A;  3KIJ A;  2JZT A;  4YQV A;  3KMN A;  1GWC A;  2H73 A;  2YOI A;  2P5R A;  2H1G A;  2VD1 A;  1TKD B;  1TW9 A;  5IMZ A;  2AHE A;  5B6N A;  3F0I A;  2DC5 A;  1A2J A;  1AQV A;  2CV4 A;  2R2J A;  1EV4 A;  2C3N A;  4PXO A;  1NSW A;  2HE3 A;  4NMU A;  3EE2 A;  4G0I A;  3UIW A;  2LTK A;  2A2S A;  1PA3 A;  3FR9 A;  4ECB A;  3H93 A;  1KEB A;  2GGT A;  5BRT A;  4J57 E;  3GKM A;  2IWT A;  4OCF A;  1R5P A;  1HNC A;  3WT1 A;  5A4V A;  2WGR A;  4GQF A;  3ZLP A;  4ZL7 A;  1ZZY A;  1XW9 A;  3KGK A;  2KP2 A;  6GSY A;  4AF2 A;  4HEA 2;  1SL1 B;  2MMN A;  4IP1 A;  4MAB A;  4V2M A;  3KZQ A;  4ECC A;  1JLV A;  1XCC A;  1N8J A;  3L9U A;  1GNW A;  1GTA A;  1OKD A;  4KH7 A;  2WB9 A;  4PTS A;  2D2Z A;  3UBL A;  5KN3 A;  2HXK A;  1Z3E A;  1ZCP A;  4EIQ A;  4H86 A;  2CVK A;  1SYR A;  2IL3 A;  5G5E A;  3D6I A;  5KOW A;  1ON4 A;  2DJK A;  3CBU A;  4MH2 A;  5ECM B;  5LCZ A;  2K6V A;  3W8J A;  2HSY A;  1PL1 A;  2KLX A;  4NHZ A;  4ECI A;  5IO0 A;  1GSU A;  3IE3 A;  5IOX A;  1OC3 A;  3L9S A;  2R0G A;  2CAQ A;  4TXV A;  5JWQ B;  2CVD A;  4WBJ A;  2CVB A;  3ISO A;  1QMV A;  5CO3 A;  1X9S B;  4BA7 A;  1HQO A;  1O6J A;  4JZQ A;  1XIY A;  3GKK A;  1IYI A;  1WOU A;  4BWS A;  3E3E A;  1PX6 A;  4PUA A;  2PWJ A;  2R4V A;  5A4U A;  1ZYQ B;  3P8W A;  1Z7R A;  2L6D A;  2YWI A;  3FZA A;  4Q5F A;  2OE1 A;  2DBC A;  2JL4 A;  1G7E A;  1Y6E A;  1G7O A;  1WMJ A;  4IQA A;  4G9H A;  5IIZ A;  4BVY A;  1U88 A;  1MTC A;  4NV2 A;  1OC8 A;  2L4Q A;  4F2I A;  2JAD A;  1YEX A;  2CX4 A;  2QA1 A;  4GRF A;  4BL7 A;  4G2E A;  3FRC A;  4OFN A;  3J7Y k;  10GS A;  3GN3 A;  1ZOF A;  3FK8 A;  4ZB8 A;  5LD0 A;  3WYW A;  4HJM A;  1HNA A;  2A2R A;  3Q74 A;  1YY7 A;  3D21 A;  2ES7 A;  5L71 A;  2H76 A;  1XPV A;  3EIN A;  4K0N A;  4LA1 A;  1W89 A;  1PRX A;  6GSX A;  3C73 A;  1Z7P A;  1CQH A;  2P0G A;  4BPY A;  5BMU A;  4PQI A;  3IAS 2;  4OO5 A;  5B8A A;  3HJM A;  3FZ9 A;  1M9B A;  3KMO A;  1GSS A;  4ZB6 A;  3PH9 A;  2LS5 A;  3G7I A;  3HJO A;  3US3 A;  1GP1 A;  3LYK A;  4CY6 A;  1F3A A;  2RLI A;  5JCG A;  5JWO B;  4USS A;  3D0Z A;  3KEB A;  3TCO A;  2H19 A;  2ON5 A;  4MJA A;  3EVI A;  1A2M A;  5ECI B;  3KTB A;  3DGQ A;  4JED A;  3C7M A;  1XOA A;  2H71 A;  3M0F A;  1MDI A;  2VL9 A;  3IDV A;  2OE0 A;  3OR5 A;  3W8S A;  2VL2 A;  1GTU A;  2KUC A;  4YH2 A;  2XHF A;  3NIV A;  1AXD A;  4OWY A;  4CHS A;  4POL A;  8GSS A;  2YNX A;  4MPF A;  1A0F A;  3EWL A;  3IXR A;  1VF3 A;  4ML6 A;  3GL3 A;  1SKW B;  1EGO A;  1XBS A;  1AW9 A;  2PER A;  4WXT A;  4QQ7 A;  1EOG A;  3ZVJ A;  3CRT A;  4ILF A;  2R5G A;  1UVZ A;  6GSU A;  2X8H A;  1B8X A;  4DSS A;  4FH8 A;  3ERF A;  2EIO A;  2RM5 A;  1M2B A;  3FR3 A;  3QFB C;  1X0R A;  2MMO A;  2OJL A;  1A2L A;  4QL9 A;  5DJM A;  2DSA A;  2LV3 A;  4KGI A;  3RHC A;  4D73 A;  5D93 A;  1YZX A;  3HVS A;  1TI3 A;  5J3R A;  3DWV A;  5ECQ B;  1MD3 A;  5EY6 A;  2FWG A;  1GLP A;  4O5R A;  2IMK A;  4KUN A;  4MMM A;  3FYG A;  4PUR A;  1EZK A;  4GWR A;  3F3Q A;  1ERU A;  2HT9 A;  2DJ3 A;  4DEJ A;  4EVM A;  2H74 A;  4XRA A;  3UJ1 A;  5IOW A;  4LLR A;  4WR4 A;  5D96 A;  3U5R E;  1TRW A;  3O6T A;  4KCA A;  3ZIJ A;  3QAW A;  1BX9 A;  5DAK B;  5G1L A;  2G0F A;  4V2N A;  4IGJ A;  1X5C A;  3KD0 A;  1TI1 A;  5ID2 B;  1SKR B;  1B48 A;  2K8V A;  3LSZ A;  2TIR A;  3HXS A;  4TR1 B;  2VM2 A;  3HCZ A;  2F3M A;  2R0C A;  3C71 A;  4XS1 A;  2JSY A;  4I97 A;  1XWK A;  5D9V A;  3F3R A;  3ERG A;  5INY A;  3QR6 A;  3ZTL A;  2V1M A;  3D4T A;  4J56 E;  2R6K A;  4ZBA A;  2YCD A;  1ZYN A;  3TUE A;  3DVX A;  4TR3 A;  3UVT A;  3QMX A;  3UOM A;  1TRV A;  3QAG A;  3F6F A;  1UC7 A;  3FKF A;  1J08 A;  2PMT A;  2FCH A;  4POK A;  1JZW A;  2IN3 A;  3DYR A;  4IS0 A;  4TW5 A;  17GS A;  5B6M A;  4J2F A;  4GTU A;  2ON7 A;  4KDY A;  4QL7 A;  2AYT A;  2MZC A;  2WS2 A;  2F8F A;  3GYK A;  4XHM A;  5JCW A;  1SK2 A;  2J9H A;  4V1A p;  12GS A;  2L6C A;  1M7T A;  1O8W A;  4ACS A;  2X64 A;  2OAD A;  1XW5 A;  2VCX A;  2RUF A;  1TK0 B;  5IMA A;  2I3Y A;  2DJ1 A;  5IO2 A;  2V32 A;  1GTI A;  4OMV A;  4JU5 A;  1FOH A;  1RQM A;  1VF1 A;  2C0E A;  4K7O A;  4EO3 A;  1LBK A;  5ELA A;  3L78 A;  3HVX A;  1I9D A;  1OVN A;  3HHV A;  2TRX A;  2DIY A;  2V41 A;  3FHK A;  5ECR B;  2JSZ A;  3TRX A;  2XBQ A;  4YKF A;  3TB2 A;  2C0G A;  5DBQ A;  1NHO A;  1FVK A;  4GST A;  4GLT A;  1EP8 A;  1BQ7 A;  1DBY A;  4O7H A;  3ZRE A;  4MZW A;  4XS6 A;  2HRF A;  3EU3 A;  3GTU A;  14GS A;  3D5J A;  3C1S A;  3GV1 A;  5C00 A;  3VPT A;  3W6G A;  2MMA A;  1IYH A;  4IJ3 A;  3QD9 A;  3PIN A;  2E7P A;  1GTB A;  3J7Y b;  3V1W A;  2H1A A;  4KF9 A;  2BMX A;  1GLQ A;  2K9F A;  1OC9 B;  1N2A A;  4TRX A;  4IQ1 A;  4EKZ A;  2RM6 A;  3NZN A;  2LST A;  5DAL A;  5JWR B;  1H4O A;  3EC3 A;  3APO A;  3H79 A;  3P90 A;  3C8E A;  5KN0 A;  3LWA A;  4Z2U A;  3KTL A;  4K9Z A;  3LEF A;  1H75 A;  5ECL B;  1BG5 A;  2VIM A;  3LXT A;  1YKA A;  2P31 A;  2PVQ A;  3QCP A;  1YKC A;  2KHP A;  2GZP A;  2GST A;  3GA4 A;  4MA9 A;  4AJ6 A;  2N5B A;  1V98 A;  4PX1 A;  4K5R A;  3SWL A;  3LFL A;  2I1U A;  1Z9H A;  2DJ2 A;  2ZCT A;  2OA7 A;  4FIW A;  2L57 A;  1A0R P;  2C0F A;  4I8B A;  3QFA C;  2VCT A;  5CRE A;  4V2L A;  3F6D A;  2VCZ A;  3NOF A;  2IFQ B;  5AIS A;  1OAZ A;  1GUM A;  2HRA A;  1WJK A;  5A5K A;  5CP1 A;  1TU7 A;  2FWE A;  1T1V A;  2B5E A;  1BAY A;  2BJX A;  4RUV A;  4L5L A;  2QGV A;  3LXZ A;  2OBI A;  2IMD A;  2LKU A;  3O76 A;  4MP4 A;  4TR0 A;  4ULX A;  5DVB A;  1PQN A;  3D22 A;  4L5O A;  2NBS A;  3ZZX A;  2YP6 A;  2YWN A;  4LL1 B;  3E0U A;  3WT2 A;  3GKX A;  1K3O A;  3MYD A;  4TN8 A;  2GZZ A;  5B8B A;  3BCI A;  4GSS A;  1FB6 A;  2A4V A;  2O8V B;  4IBP A;  1WP0 A;  4MJC A;  5JCU A;  4EE0 A;  1XG8 A;  3IC8 A;  3IBH A;  1V9W A;  1ML6 A;  1S3C A;  4ISD A;  4MZC A;  2L5O A;  2YV9 A;  2GZY A;  2PU9 C;  2KP1 A;  3ZIT A;  2NVL A;  3F4S A;  3CQF A;  3RBT A;  1TDI A;  1M3J A;  4K7I A;  4MF5 A;  2B6M A;  3VWV A;  3A3T A;  5AIX A;  4IW9 A;  2HYX A;  1F6M C;  5CAX A;  1FVJ A;  4BIK A;  3EMP A;  2H75 A;  4AGS A;  1USB A;  5DCG A;  3A2V A;  1Q4J A;  1PSQ A;  4ID0 A;  1DUG A;  5KN2 A;  2LJR A;  3MNG A;  4NPB A;  1XWC A;  2LJA A;  2H6X A;  6GSW A;  3KH7 A;  4FYU A;  4TVE A;  1U6T A;  4K7N A;  3QDN A;  1ERV A;  1K0A A;  2MMZ A;  2DML A;  2VUP A;  4OFM A;  1OE8 A;  3UMA A;  3VI7 A;  4JBB A;  4BWQ A;  5G2Z A;  3FZ4 A;  2AUV A;  2LUS A;  3HY2 A;  4L0W A;  4MCU A;  4ZIL A;  2VD0 A;  4EC0 A;  3I69 A;  3DKS A;  2DJ0 A;  3VUR A;  5DDL A;  5HFG A;  1Z6N A;  4MPG A;  1SYX A;  2PPT A;  1SL2 B;  4F0B A;  3IOS A;  3GST A;  3UEM A;  1PGT A;  5D9T A;  3GHA A;  1BED A;  1GUH A;  3KP9 A;  1QGV A;  4I2T A;  1SJZ A;  2DKI A;  3A2W A;  5HR2 A;  1MD4 A;  1TU8 A;  3BJ5 A;  3GIX A;  2EIR A;  3IHQ A;  2EIQ A;  3ZRD A;  5COH A;  4X1U A;  2VAF A;  1XZO A;  1GH2 A;  3F9U A;  1T7P B;  2GQK A;  2FA8 A;  2F9S A;  4AJ8 A;  1JHB A;  4N0Z A;  3ED3 A;  1ZYP A;  4PNF A;  4XCS A;  3GX8 A;  1ABA A;  4YQM A;  3HJP A;  1DSB A;  2GSS A;  3S9F A;  1M9A A;  1O8X A;  3IPZ A;  3A5W A;  2GT5 A;  4KW6 A;  22GS A;  3GFK A;  5G30 A;  2HSH A;  4KB3 A;  3FMW A;  4WEY A;  3DRN A;  5ELG A;  4LMW A;  1V57 A;  2QKE A;  4NHW A;  1KBN A;  4KX4 A;  4GQC A;  3QOU A;  4WR5 A;  2C0D A;  4X43 A;  3VK9 A;  2I81 A;  3LYP A;  1TRU A;  4XRD A;  3CXG A;  1FHE A;  2OBK A;  4O5Q A;  2YZU A;  5F06 A;  1O7U A;  5GAN D;  3EYT A;  5CRD A;  2KOK A;  1CQG A;  4I6X A;  4HQZ A;  1TOF A;  2LRN A;  1SJI A;  5A4W A;  1SD9 A;  3ZL5 A;  4Z2R A;  4F03 A;  1PD2 1;  4MDC A;  2YZH A;  2RII A;  3TGZ A;  3APQ A;  5B7C A;  3UAR A;  2LNT A;  2H6Y A;  1K0M A;  3TRP A;  4DSS B;  3QAV A;  1EWX A;  2Z9S A;  4EF0 A;  1FG4 A;  2O85 A;  3UBK A;  2FUG 2;  1J9B A;  4F9Z A;  1O73 A;  5ECK B;  4ZIJ A;  1S3R A;  4D73 B;  4XS4 A;  3HYP A;  2FHE A;  2PN8 A;  2QC7 A;  3A5I A;  3IR4 A;  1OYJ A;  1SU9 A;  4EDY A;  4PNG A;  4JR6 A;  2N5A A;  4IEL A;  4JR4 A;  2GTU A;  2FWH A;  4HQS A;  1X9W B;  2B5Y A;  1DE2 A;  3HZ4 A;  4RQX A;  4FYB A;  1E6B A;  1WE0 A;  4N30 A;  1XVQ A;  4PGT A;  2GVP A;  1RW1 A;  3TKS C;  1FB0 A;  3M9J A;  4Z2T A;  1XWB A;  4KA0 A;  2B1K A;  2FGX A;  4BVX A;  2VLV A;  2C4J A;  1YEP A;  2XPE A;  1T8E B;  1GRX A;  4F82 A;  4TOP A;  1G0T A;  3GUR A;  5ECO B;  2DJJ A;  6GSV A;  1B4P A;  5E4W A;  5J5N A;  3ZIV A;  1B9X C;  3IV4 A;  2WRT A;  5J9B A;  1EGR A;  5CRG A;  1KTE A;  4WBR D;  2I9H A;  1VGL A;  3DEX A;  3IHG A;  3K8N A;  3RHB A;  1XWA A;  3GMF A;  5HR0 A;  4V1A g;  1AQX A;  3FR6 A;  1M2D A;  3GH9 A;  2H30 A;  4HDE A;  4YQU A;  1TXX A;  1PKW A;  1M3I A;  3CMI A;  2H70 A;  5DJL A;  1B9Y C;  2J23 A;  1T4Z A;  4HS1 A;  1SL0 B;  3Q19 A;  2QSI A;  2O7K A;  3M9K A;  3CRU A;  2YWO A;  1HD2 A;  2IME A;  3I43 A;  5IPH A;  5D9X A;  1YF0 A;  5IMV A;  2CX3 A;  4KDU A;  1K0C A;  4K0G A;  5DQY A;  4YAP A;  3QPM A;  2B5X A;  2DKH A;  1S3D A;  1XVW A;  3H1N A;  3H8Q A;  1XFL A;  1C72 A;  2HZE B;  1G6W A;  1GSQ A;  4KCE A;  1W4V A;  3CYN A;  4TR1 A;  3VWX A;  3LW9 A;  3TJG A;  2C80 A;  5AN1 A;  2VO4 A;  4DSQ A;  2JAC A;  3HVV A;  4HU7 A;  3C1R A;  2WDU A;  3TKS E;  2DLX A;  2WFC A;  3M1G A;  4MZB A;  1NHY A;  1I5G A;  2XBI A;  3D4M A;  5KEJ A;  4TXO A;  1QUW A;  2AB6 A;  1JZR A;  4CY8 A;  2GQL A;  2CT6 A;  3GTU B;  3DIE A;  3FZ5 A;  1T00 A;  4MJE A;  2PBJ A;  1T4Y A;  2YJH A;  3BOA A;  1VF2 A;  3CSJ A;  2YWM A;  4EDZ A;  5ECH B;  1XOB A;  2PUK C;  3TOT A;  3F4R A;  2A4H A;  2YV7 A;  3IK9 A;  3ERW A;  4G0L A;  4KAE A;  4Q5Q A;  5J41 A;  2F8A A;  4EIP A;  3LQ7 A;  3IA1 A;  4ZBD A;  4HOJ A;  3HDC A;  6GSS A;  2GSQ A;  2MBT A;  3MDK A;  4POB A;  4F0C A;  1E2Y A;  2YAN A;  4N11 A;  2QA2 A;  4GSN A;  1M2A A;  2XC2 A;  1BJX A;  4ZBB A;  5HFI A;  1F2E A;  1K0O A;  2NTO A;  3APS A;  2GS3 A;  1AUC A;  2G2Q A;  5EPF A;  4G19 A;  3L4N A;  3ZMK A;  5IQY A;  4O32 A;  3KXO A;  1KNG A;  1A24 A;  5CRH A;  3HA9 A;  1TK8 B;  7GSS A;  2XPD A;  4OCE A;  2HSM A;  2B7K A;  2REM A;  3HVN A;  1ZL9 A;  2TRC P;  1HYU A;  2CZ2 A;  2E2G A;  2VCQ A;  2FWF A;  1QK8 A;  4ZL8 A;  1EV9 A;  1PMT A;  3VPQ A;  3EPT A;  4FO5 A;  4WKW A;  1WWJ A;  5FT3 A;  1ST9 A;  4GXZ A;  2A2P A;  1FOV A;  2HZF A;  3MAK A;  4EUY A;  2CA8 A;  4WF5 A;  4MNN A;  2H1D A;  1MDK A;  3RPN A;  1LJR A;  4I2U A;  2MBS A;  2M72 A;  2C1Y A;  2C3T A;  4NWY A;  3PGT A;  5IMF A;  1GNE A;  5GSS A;  2R3X A;  5F05 A;  2VCW A;  3ZVJ D;  2WZ9 A;  2JZR A;  2DIZ A;  4CDO A;  2L4C A;  2IFQ A;  2HRK A;  1V40 A;  1B4Q A;  5C04 A;  1X9M B;  2HFD A;  4PQ1 A;  2RUE A;  4IHU A;  2FNO A;  2H0I A;  2FLS A;  2L59 A;  3KCM A;  4FYC A;  2WUL A;  2R0P A;  5CNW A;  3IRA A;  2VM1 A;  2CZ3 A;  1Z5Y E;  3ZFB A;  1OE7 A;  3I9V 2;  1GUL A;  3FW2 A;  1GSE A;  4IJI A;  3VWU A;  1AC1 A;  3HD5 A;  3R2Q A;  2FA4 A;  13GS A;  4X4J A;  1U3A A;  2H01 A;  5CRW A;  2IPA A;  3UVH A;  5ABR A;  2GQM A;  2X8C A;  2V2G A;  1YF1 A;  2H1B A;  1ERW A;  3TKP A;  1F9M A;  3WD6 A;  1GL8 A;  1R26 A;  2LJK A;  1U87 A;  3H4K A;  2C3Q A;  20GS A;  1J0F A;  3DVW A;  11GS A;  2JZS A;  1X5D A;  3LJR A;  2H6Z A;  3ME8 A;  3TOU A;  2P5Q A;  2V6O A;  3LOR A;  4WET A;  4BVY B;  5IM9 A;  2B3S A;  3F63 A;  1GSY A;  4BL7 B;  3IK7 A;  5D9W A;  4OFT A;  3TJF A;  3TJK A;  2CAI A;  4O92 A;  5E59 A;  2LEG A;  18GS A;  3G7J A;  1QFN A;  3VI5 A;  5AGY A;  1MDJ A;  3WGE A;  3BBY A;  1MEK A;  4E8E A;  3Q6O A;  1DE1 A;  1A23 A;  4KE3 A;  5GST A;  3MSZ A;  4IKH A;  4LL4 B;  1Z6M A;  4Q5N A;  3GL5 A;  3SBC A;  5HQP A;  3PR8 A;  2HNL A;  1X5E A;  1TK5 B;  2V6K A;  1U3I A;  1A8Y A;  2X49 A;  3LG6 A;  3DML A;  1JZO A;  4CW9 A;  3RAZ A;  3UL3 A;  5F0G A;  2H66 A;  3R3E A;  3TRQ A;  1YDK A;  1AAZ A;  3GKN A;  1ILO A;  1G6Y A;  5ENU A;  2YJ7 A;  2VL2 C;  1EP7 A;  2BTO T;  1Q98 A;  3TJJ A;  2GSR A;  1M99 A;  4HI7 A;  3GNJ A;  4GCI A;  3O3T A;  2YPM A;  4JE1 A;  4XIH A;  1R5A A;  1WRY A;  4L0U A;  3DXB A;  3ZFL A;  2GDR A;  3TJB A;  1UA5 A;  4XS4 B;  3EMX A;  4DVC A;  3G7Y A;  2E2M A;  3KH9 A;  3P2A A;  4K1F A;  4ML1 A;  4Q5R A;  4XTS A;  1A8L A;  4RQR A;  2HRN A;  2ALB A;  4N0V A;  3FY7 A;  2CQ9 A;  4YKG A;  3WGX A;  3AY8 A;  3L9V A;  4HZ4 A;  5G31 A;  1YJ6 A;  1SK1 A;  5F8B A;  1PL2 A;  1ZGN A;  5J9C A;  2B7J A;  3TDG A;  2I4A A;  4TR4 A;  2H0G A;  5FWG A;  1ZYE A;  6GST A;  2LQQ A;  2IIY A;  4BVX B;  1GSF A;  3GX0 A;  3RDW A;  4HZ2 A;  1HNB A;  3VWW A;  4IVF A;  2LQO A;  1ZMA A;  3F4T A;  2DMM A;  4K5S A;  1VRS D;  4LMV A;  1TP9 A;  1NW2 A;  1EEM A;  1JZD A;  1GUK A;  3LGC A;  4TKY A;  1V2A A;  3N5O A;  1VF4 A;  3VFI A;  1K3Y A;  3HKR A;  3M8N A;  4KSM A;  5EL8 A;  3TKQ A;  3EU4 A;  2YN1 A;  4YAV A;  3ME7 A;  1RK4 A;  5G5F A;  4ZXG A;  3EUR A;  1K0D A;  5H5S A;  4I5Q A;  3KP8 A;  4ZB9 A;  5HR1 A;  4MLY A;  3RPP A;  3IC4 A;  4OD7 A;  5IMD A;  1EEJ A;  5H5Q A;  4KSO A;  1LU4 A;  1ACV A;  3A2X A;  3DD3 A;  4WF4 A;  1SD8 A;  2ZNM A;  4MF7 A;  5IMC A;  1TTZ A;  2M80 A;  2VLT A;  1T3B A;  3I6A A;  1EOH A;  5F07 A;  1SKS B;  2OAC A;  3GUS A;  5HR3 A;  4E8H A;  4POM A;  1K0B A;  2X99 A;  3GSS A;  5EVO A;  2X8G A;  2LNS A;  3CSH A;  5GAP D;  4NXI A;  1SJ6 A;  1SEN A;  5D73 A;  2WCI A;  4RI7 A;  3TKS A;  5KN1 A; 
#chains in the Genus database with same CATH homology
 3KJY A;  4RI6 A;  1WIK A;  3ZYW A;  2O89 A;  2M46 A;  2O87 A;  4HUA A;  1O85 A;  1F3B A;  1M0U A;  1PN9 A;  4ZL9 A;  4K2X A;  4X0X A;  3F8U A;  2VCV A;  2JU5 A;  4AJ7 A;  4ICY A;  3CTF A;  2EC4 A;  3ZML A;  16GS A;  3G9B A;  4KND A;  5DAK A;  19GS A;  3KM6 A;  5ID2 A;  4TXO B;  1K0N A;  4K8M A;  4GF0 A;  2IJY A;  5IPG A;  2K18 A;  2NPB A;  1TJD A;  2HI7 A;  4PUF C;  1AIU A;  2PVO C;  4K2D A;  3GH6 A;  1SK0 A;  2AJQ B;  2NDO A;  1JLW A;  3L0H A;  1THX A;  5GZZ B;  1YQ1 A;  1NM3 A;  4O5U A;  2K8S A;  4OO4 A;  1URM A;  2LRT A;  5CYY A;  1F37 A;  2H72 A;  2UZ8 A;  4NAX A;  4MF6 A;  3BD2 A;  4A5P A;  2LRC A;  1XXU A;  4EL1 A;  1TRS A;  2F51 A;  2VL3 A;  5AIV A;  2FY6 A;  1JFU A;  5FHI A;  1PN0 A;  2PGT A;  1O81 A;  5DCH A;  4MK3 A;  2HZE A;  5G1K A;  2B1L A;  3BCK A;  4PQH A;  1QXH A;  1QQ2 A;  1WPI A;  4FQU A;  1R4W A;  3PPU A;  2C8U A;  4MH3 A;  3GRX A;  2VLU A;  3CTG A;  1GSD A;  1THO A;  2N5F A;  5DAL B;  1R7H A;  4N10 A;  3VLN A;  4DSR A;  1XWG A;  4K6X A;  5HFK A;  5H5R A;  4EXJ A;  1AQW A;  1ERT A;  4ECJ A;  2AAW A;  3TKR A;  1BYE A;  4IN0 A;  3N9J A;  1K3L A;  5ECP B;  4G0K A;  3E9J B;  4P3Y B;  2L5L A;  2HLS A;  4NV5 A;  2OKA A;  2H8L A;  4HJ2 A;  5D8I A;  2OE3 A;  3U6V A;  1FO5 A;  5J4U A;  3M3M A;  2VOC A;  4MJB A;  2WJU A;  1FAA A;  3FEU A;  5ECS A;  5LNK e;  2IMI A;  3UAP A;  5DQS A;  2FD3 A;  2IMF A;  2GLR A;  1FW1 A;  4G10 A;  5KOX A;  2MYG A;  3CSI A;  1S3A A;  9GSS A;  3WGD A;  1XW6 A;  2GT6 A;  5ECN B;  2ZUP A;  1OC9 A;  3MWH A;  4IP6 A;  4KDX A;  3Q18 A;  1PX7 A;  1V58 A;  3P7X A;  4HU9 A;  1UN2 A;  4JRR A;  3JCM L;  2E0Q A;  1PKZ A;  1OKT A;  2AV4 A;  3MIX A;  2H0H A;  1Y25 A;  3IAM 2;  3HZ8 A;  4Z7X A;  4L8E A;  2X4A A;  2R37 A;  3KIJ A;  2JZT A;  4YQV A;  3KMN A;  1GWC A;  2H73 A;  2YOI A;  2P5R A;  2H1G A;  2VD1 A;  1TKD B;  1TW9 A;  5IMZ A;  2AHE A;  5B6N A;  3F0I A;  2DC5 A;  1A2J A;  1AQV A;  2CV4 A;  2R2J A;  1EV4 A;  2C3N A;  4PXO A;  1NSW A;  2HE3 A;  4NMU A;  3EE2 A;  4G0I A;  3UIW A;  2LTK A;  2A2S A;  1PA3 A;  3FR9 A;  4ECB A;  3H93 A;  1KEB A;  2GGT A;  5BRT A;  4J57 E;  3GKM A;  2IWT A;  4OCF A;  1R5P A;  1HNC A;  3WT1 A;  5A4V A;  2WGR A;  4GQF A;  3ZLP A;  4ZL7 A;  1ZZY A;  1XW9 A;  3KGK A;  2KP2 A;  6GSY A;  4AF2 A;  4HEA 2;  1SL1 B;  2MMN A;  4IP1 A;  4MAB A;  4V2M A;  3KZQ A;  4ECC A;  1JLV A;  1XCC A;  1N8J A;  3L9U A;  1GNW A;  1GTA A;  1OKD A;  4KH7 A;  2WB9 A;  4PTS A;  2D2Z A;  3UBL A;  5KN3 A;  2HXK A;  1Z3E A;  1ZCP A;  4EIQ A;  4H86 A;  2CVK A;  1SYR A;  2IL3 A;  5G5E A;  3D6I A;  5KOW A;  1ON4 A;  2DJK A;  3CBU A;  4MH2 A;  5ECM B;  5LCZ A;  2K6V A;  3W8J A;  2HSY A;  1PL1 A;  2KLX A;  4NHZ A;  4ECI A;  5IO0 A;  1GSU A;  3IE3 A;  5IOX A;  1OC3 A;  3L9S A;  2R0G A;  2CAQ A;  4TXV A;  5JWQ B;  2CVD A;  4WBJ A;  2CVB A;  3ISO A;  1QMV A;  5CO3 A;  1X9S B;  4BA7 A;  1HQO A;  1O6J A;  4JZQ A;  1XIY A;  3GKK A;  1IYI A;  1WOU A;  4BWS A;  3E3E A;  1PX6 A;  4PUA A;  2PWJ A;  2R4V A;  5A4U A;  1ZYQ B;  3P8W A;  1Z7R A;  2L6D A;  2YWI A;  3FZA A;  4Q5F A;  2OE1 A;  2DBC A;  2JL4 A;  1G7E A;  1Y6E A;  1G7O A;  1WMJ A;  4IQA A;  4G9H A;  5IIZ A;  4BVY A;  1U88 A;  1MTC A;  4NV2 A;  1OC8 A;  2L4Q A;  4F2I A;  2JAD A;  1YEX A;  2CX4 A;  2QA1 A;  4GRF A;  4BL7 A;  4G2E A;  3FRC A;  4OFN A;  3J7Y k;  10GS A;  3GN3 A;  1ZOF A;  3FK8 A;  4ZB8 A;  5LD0 A;  3WYW A;  4HJM A;  1HNA A;  2A2R A;  3Q74 A;  1YY7 A;  3D21 A;  2ES7 A;  5L71 A;  2H76 A;  1XPV A;  3EIN A;  4K0N A;  4LA1 A;  1W89 A;  1PRX A;  6GSX A;  3C73 A;  1Z7P A;  1CQH A;  2P0G A;  4BPY A;  5BMU A;  4PQI A;  3IAS 2;  4OO5 A;  5B8A A;  3HJM A;  3FZ9 A;  1M9B A;  3KMO A;  1GSS A;  4ZB6 A;  3PH9 A;  2LS5 A;  3G7I A;  3HJO A;  3US3 A;  1GP1 A;  3LYK A;  4CY6 A;  1F3A A;  2RLI A;  5JCG A;  5JWO B;  4USS A;  3D0Z A;  3KEB A;  3TCO A;  2H19 A;  2ON5 A;  4MJA A;  3EVI A;  1A2M A;  5ECI B;  3KTB A;  3DGQ A;  4JED A;  3C7M A;  1XOA A;  2H71 A;  3M0F A;  1MDI A;  2VL9 A;  3IDV A;  2OE0 A;  3OR5 A;  3W8S A;  2VL2 A;  1GTU A;  2KUC A;  4YH2 A;  2XHF A;  3NIV A;  1AXD A;  4OWY A;  4CHS A;  4POL A;  8GSS A;  2YNX A;  4MPF A;  1A0F A;  3EWL A;  3IXR A;  1VF3 A;  4ML6 A;  3GL3 A;  1SKW B;  1EGO A;  1XBS A;  1AW9 A;  2PER A;  4WXT A;  4QQ7 A;  1EOG A;  3ZVJ A;  3CRT A;  4ILF A;  2R5G A;  1UVZ A;  6GSU A;  2X8H A;  1B8X A;  4DSS A;  4FH8 A;  3ERF A;  2EIO A;  2RM5 A;  1M2B A;  3FR3 A;  3QFB C;  1X0R A;  2MMO A;  2OJL A;  1A2L A;  4QL9 A;  5DJM A;  2DSA A;  2LV3 A;  4KGI A;  3RHC A;  4D73 A;  5D93 A;  1YZX A;  3HVS A;  1TI3 A;  5J3R A;  3DWV A;  5ECQ B;  1MD3 A;  5EY6 A;  2FWG A;  1GLP A;  4O5R A;  2IMK A;  4KUN A;  4MMM A;  3FYG A;  4PUR A;  1EZK A;  4GWR A;  3F3Q A;  1ERU A;  2HT9 A;  2DJ3 A;  4DEJ A;  4EVM A;  2H74 A;  4XRA A;  3UJ1 A;  5IOW A;  4LLR A;  4WR4 A;  5D96 A;  3U5R E;  1TRW A;  3O6T A;  4KCA A;  3ZIJ A;  3QAW A;  1BX9 A;  5DAK B;  5G1L A;  2G0F A;  4V2N A;  4IGJ A;  1X5C A;  3KD0 A;  1TI1 A;  5ID2 B;  1SKR B;  1B48 A;  2K8V A;  3LSZ A;  2TIR A;  3HXS A;  4TR1 B;  2VM2 A;  3HCZ A;  2F3M A;  2R0C A;  3C71 A;  4XS1 A;  2JSY A;  4I97 A;  1XWK A;  5D9V A;  3F3R A;  3ERG A;  5INY A;  3QR6 A;  3ZTL A;  2V1M A;  3D4T A;  4J56 E;  2R6K A;  4ZBA A;  2YCD A;  1ZYN A;  3TUE A;  3DVX A;  4TR3 A;  3UVT A;  3QMX A;  3UOM A;  1TRV A;  3QAG A;  3F6F A;  1UC7 A;  3FKF A;  1J08 A;  2PMT A;  2FCH A;  4POK A;  1JZW A;  2IN3 A;  3DYR A;  4IS0 A;  4TW5 A;  17GS A;  5B6M A;  4J2F A;  4GTU A;  2ON7 A;  4KDY A;  4QL7 A;  2AYT A;  2MZC A;  2WS2 A;  2F8F A;  3GYK A;  4XHM A;  5JCW A;  1SK2 A;  2J9H A;  4V1A p;  12GS A;  2L6C A;  1M7T A;  1O8W A;  4ACS A;  2X64 A;  2OAD A;  1XW5 A;  2VCX A;  2RUF A;  1TK0 B;  5IMA A;  2I3Y A;  2DJ1 A;  5IO2 A;  2V32 A;  1GTI A;  4OMV A;  4JU5 A;  1FOH A;  1RQM A;  1VF1 A;  2C0E A;  4K7O A;  4EO3 A;  1LBK A;  5ELA A;  3L78 A;  3HVX A;  1I9D A;  1OVN A;  3HHV A;  2TRX A;  2DIY A;  2V41 A;  3FHK A;  5ECR B;  2JSZ A;  3TRX A;  2XBQ A;  4YKF A;  3TB2 A;  2C0G A;  5DBQ A;  1NHO A;  1FVK A;  4GST A;  4GLT A;  1EP8 A;  1BQ7 A;  1DBY A;  4O7H A;  3ZRE A;  4MZW A;  4XS6 A;  2HRF A;  3EU3 A;  3GTU A;  14GS A;  3D5J A;  3C1S A;  3GV1 A;  5C00 A;  3VPT A;  3W6G A;  2MMA A;  1IYH A;  4IJ3 A;  3QD9 A;  3PIN A;  2E7P A;  1GTB A;  3J7Y b;  3V1W A;  2H1A A;  4KF9 A;  2BMX A;  1GLQ A;  2K9F A;  1OC9 B;  1N2A A;  4TRX A;  4IQ1 A;  4EKZ A;  2RM6 A;  3NZN A;  2LST A;  5DAL A;  5JWR B;  1H4O A;  3EC3 A;  3APO A;  3H79 A;  3P90 A;  3C8E A;  5KN0 A;  3LWA A;  4Z2U A;  3KTL A;  4K9Z A;  3LEF A;  1H75 A;  5ECL B;  1BG5 A;  2VIM A;  3LXT A;  1YKA A;  2P31 A;  2PVQ A;  3QCP A;  1YKC A;  2KHP A;  2GZP A;  2GST A;  3GA4 A;  4MA9 A;  4AJ6 A;  2N5B A;  1V98 A;  4PX1 A;  4K5R A;  3SWL A;  3LFL A;  2I1U A;  1Z9H A;  2DJ2 A;  2ZCT A;  2OA7 A;  4FIW A;  2L57 A;  1A0R P;  2C0F A;  4I8B A;  3QFA C;  2VCT A;  5CRE A;  4V2L A;  3F6D A;  2VCZ A;  3NOF A;  2IFQ B;  5AIS A;  1OAZ A;  1GUM A;  2HRA A;  1WJK A;  5A5K A;  5CP1 A;  1TU7 A;  2FWE A;  1T1V A;  2B5E A;  1BAY A;  2BJX A;  4RUV A;  4L5L A;  2QGV A;  3LXZ A;  2OBI A;  2IMD A;  2LKU A;  3O76 A;  4MP4 A;  4TR0 A;  4ULX A;  5DVB A;  1PQN A;  3D22 A;  4L5O A;  2NBS A;  3ZZX A;  2YP6 A;  2YWN A;  4LL1 B;  3E0U A;  3WT2 A;  3GKX A;  1K3O A;  3MYD A;  4TN8 A;  2GZZ A;  5B8B A;  3BCI A;  4GSS A;  1FB6 A;  2A4V A;  2O8V B;  4IBP A;  1WP0 A;  4MJC A;  5JCU A;  4EE0 A;  3IC8 A;  3IBH A;  1V9W A;  1ML6 A;  1S3C A;  4ISD A;  4MZC A;  2L5O A;  2YV9 A;  2GZY A;  2PU9 C;  2KP1 A;  3ZIT A;  2NVL A;  3F4S A;  3RBT A;  1TDI A;  4K7I A;  4MF5 A;  2B6M A;  3VWV A;  3A3T A;  5AIX A;  4IW9 A;  2HYX A;  1F6M C;  5CAX A;  1FVJ A;  3EMP A;  2H75 A;  4AGS A;  1USB A;  5DCG A;  3A2V A;  1Q4J A;  1PSQ A;  4ID0 A;  1DUG A;  5KN2 A;  2LJR A;  3MNG A;  4NPB A;  1XWC A;  2LJA A;  2H6X A;  6GSW A;  3KH7 A;  4FYU A;  4TVE A;  1U6T A;  4K7N A;  3QDN A;  1ERV A;  1K0A A;  2MMZ A;  2DML A;  2VUP A;  4OFM A;  1OE8 A;  3UMA A;  3VI7 A;  4JBB A;  4BWQ A;  5G2Z A;  3FZ4 A;  2AUV A;  2LUS A;  3HY2 A;  4L0W A;  4MCU A;  4ZIL A;  2VD0 A;  4EC0 A;  3I69 A;  3DKS A;  2DJ0 A;  3VUR A;  5DDL A;  5HFG A;  1Z6N A;  4MPG A;  1SYX A;  2PPT A;  1SL2 B;  4F0B A;  3IOS A;  3GST A;  3UEM A;  1PGT A;  5D9T A;  3GHA A;  1BED A;  1GUH A;  3KP9 A;  1QGV A;  4I2T A;  1SJZ A;  2DKI A;  3A2W A;  5HR2 A;  1MD4 A;  1TU8 A;  3BJ5 A;  3GIX A;  2EIR A;  3IHQ A;  2EIQ A;  3ZRD A;  5COH A;  4X1U A;  2VAF A;  1XZO A;  1GH2 A;  3F9U A;  1T7P B;  2GQK A;  2FA8 A;  2F9S A;  4AJ8 A;  1JHB A;  4N0Z A;  3ED3 A;  1ZYP A;  4PNF A;  4XCS A;  3GX8 A;  1ABA A;  4YQM A;  3HJP A;  1DSB A;  2GSS A;  3S9F A;  1M9A A;  1O8X A;  3IPZ A;  3A5W A;  2GT5 A;  4KW6 A;  22GS A;  3GFK A;  5G30 A;  2HSH A;  4KB3 A;  3FMW A;  4WEY A;  3DRN A;  5ELG A;  4LMW A;  1V57 A;  2QKE A;  4NHW A;  1KBN A;  4KX4 A;  4GQC A;  3QOU A;  4WR5 A;  2C0D A;  4X43 A;  3VK9 A;  2I81 A;  3LYP A;  1TRU A;  4XRD A;  3CXG A;  1FHE A;  2OBK A;  4O5Q A;  2YZU A;  5F06 A;  1O7U A;  5GAN D;  3EYT A;  5CRD A;  2KOK A;  1CQG A;  4I6X A;  4HQZ A;  1TOF A;  2LRN A;  1SJI A;  5A4W A;  1SD9 A;  3ZL5 A;  4Z2R A;  4F03 A;  1PD2 1;  4MDC A;  2YZH A;  2RII A;  3TGZ A;  3APQ A;  5B7C A;  3UAR A;  2LNT A;  2H6Y A;  1K0M A;  3TRP A;  4DSS B;  3QAV A;  1EWX A;  2Z9S A;  4EF0 A;  1FG4 A;  2O85 A;  3UBK A;  2FUG 2;  1J9B A;  4F9Z A;  1O73 A;  5ECK B;  4ZIJ A;  4D73 B;  4XS4 A;  3HYP A;  2FHE A;  2PN8 A;  2QC7 A;  3A5I A;  3IR4 A;  1OYJ A;  1SU9 A;  4EDY A;  4PNG A;  4JR6 A;  2N5A A;  4IEL A;  4JR4 A;  2GTU A;  2FWH A;  4HQS A;  1X9W B;  2B5Y A;  1DE2 A;  3HZ4 A;  4RQX A;  4FYB A;  1E6B A;  1WE0 A;  4N30 A;  1XVQ A;  4PGT A;  2GVP A;  1RW1 A;  3TKS C;  1FB0 A;  3M9J A;  4Z2T A;  1XWB A;  4KA0 A;  2B1K A;  2FGX A;  4BVX A;  2VLV A;  2C4J A;  1YEP A;  2XPE A;  1T8E B;  1GRX A;  4F82 A;  4TOP A;  1G0T A;  3GUR A;  5ECO B;  2DJJ A;  6GSV A;  1B4P A;  5E4W A;  5J5N A;  3ZIV A;  1B9X C;  3IV4 A;  2WRT A;  5J9B A;  1EGR A;  5CRG A;  1KTE A;  4WBR D;  2I9H A;  1VGL A;  3DEX A;  3IHG A;  3K8N A;  3RHB A;  1XWA A;  3GMF A;  5HR0 A;  4V1A g;  1AQX A;  3FR6 A;  1M2D A;  3GH9 A;  2H30 A;  4HDE A;  4YQU A;  1TXX A;  1PKW A;  3CMI A;  2H70 A;  5DJL A;  1B9Y C;  2J23 A;  1T4Z A;  4HS1 A;  1SL0 B;  3Q19 A;  2QSI A;  2O7K A;  3M9K A;  3CRU A;  2YWO A;  1HD2 A;  2IME A;  3I43 A;  5IPH A;  5D9X A;  1YF0 A;  5IMV A;  2CX3 A;  4KDU A;  1K0C A;  4K0G A;  5DQY A;  4YAP A;  3QPM A;  2B5X A;  2DKH A;  1S3D A;  1XVW A;  3H1N A;  3H8Q A;  1XFL A;  1C72 A;  2HZE B;  1G6W A;  1GSQ A;  4KCE A;  1W4V A;  3CYN A;  4TR1 A;  3VWX A;  3LW9 A;  3TJG A;  2C80 A;  5AN1 A;  2VO4 A;  4DSQ A;  2JAC A;  3HVV A;  4HU7 A;  3C1R A;  2WDU A;  3TKS E;  2DLX A;  2WFC A;  3M1G A;  4MZB A;  1NHY A;  1I5G A;  2XBI A;  3D4M A;  5KEJ A;  4TXO A;  1QUW A;  2AB6 A;  1JZR A;  4CY8 A;  2GQL A;  2CT6 A;  3GTU B;  3DIE A;  3FZ5 A;  1T00 A;  4MJE A;  2PBJ A;  1T4Y A;  2YJH A;  3BOA A;  1VF2 A;  3CSJ A;  2YWM A;  4EDZ A;  5ECH B;  1XOB A;  2PUK C;  3TOT A;  3F4R A;  2A4H A;  2YV7 A;  3IK9 A;  3ERW A;  4G0L A;  4KAE A;  4Q5Q A;  5J41 A;  2F8A A;  4EIP A;  3LQ7 A;  3IA1 A;  4ZBD A;  4HOJ A;  3HDC A;  6GSS A;  2GSQ A;  2MBT A;  3MDK A;  4POB A;  4F0C A;  1E2Y A;  2YAN A;  4N11 A;  2QA2 A;  4GSN A;  1M2A A;  2XC2 A;  1BJX A;  4ZBB A;  5HFI A;  1F2E A;  1K0O A;  2NTO A;  3APS A;  2GS3 A;  1AUC A;  2G2Q A;  5EPF A;  4G19 A;  3L4N A;  3ZMK A;  5IQY A;  4O32 A;  3KXO A;  1KNG A;  1A24 A;  5CRH A;  3HA9 A;  1TK8 B;  7GSS A;  2XPD A;  4OCE A;  2HSM A;  2B7K A;  2REM A;  1ZL9 A;  2TRC P;  1HYU A;  2CZ2 A;  2E2G A;  2VCQ A;  2FWF A;  1QK8 A;  4ZL8 A;  1EV9 A;  1PMT A;  3VPQ A;  3EPT A;  4FO5 A;  4WKW A;  1WWJ A;  5FT3 A;  1ST9 A;  4GXZ A;  2A2P A;  1FOV A;  2HZF A;  3MAK A;  4EUY A;  2CA8 A;  4WF5 A;  4MNN A;  2H1D A;  1MDK A;  3RPN A;  1LJR A;  4I2U A;  2MBS A;  2M72 A;  2C1Y A;  2C3T A;  4NWY A;  3PGT A;  5IMF A;  1GNE A;  5GSS A;  2R3X A;  5F05 A;  2VCW A;  3ZVJ D;  2WZ9 A;  2JZR A;  2DIZ A;  4CDO A;  2L4C A;  2IFQ A;  2HRK A;  1V40 A;  1B4Q A;  5C04 A;  1X9M B;  2HFD A;  4PQ1 A;  2RUE A;  4IHU A;  2FNO A;  2H0I A;  2FLS A;  2L59 A;  3KCM A;  4FYC A;  2WUL A;  2R0P A;  5CNW A;  3IRA A;  2VM1 A;  2CZ3 A;  1Z5Y E;  3ZFB A;  1OE7 A;  3I9V 2;  1GUL A;  3FW2 A;  1GSE A;  4IJI A;  3VWU A;  1AC1 A;  3HD5 A;  3R2Q A;  2FA4 A;  13GS A;  4X4J A;  1U3A A;  2H01 A;  5CRW A;  2IPA A;  3UVH A;  5ABR A;  2GQM A;  2X8C A;  2V2G A;  1YF1 A;  2H1B A;  1ERW A;  3TKP A;  1F9M A;  3WD6 A;  1GL8 A;  1R26 A;  2LJK A;  1U87 A;  3H4K A;  2C3Q A;  20GS A;  1J0F A;  3DVW A;  11GS A;  2JZS A;  1X5D A;  3LJR A;  2H6Z A;  3ME8 A;  3TOU A;  2P5Q A;  2V6O A;  3LOR A;  4WET A;  4BVY B;  5IM9 A;  2B3S A;  3F63 A;  1GSY A;  4BL7 B;  3IK7 A;  5D9W A;  4OFT A;  3TJF A;  3TJK A;  2CAI A;  4O92 A;  5E59 A;  2LEG A;  18GS A;  3G7J A;  1QFN A;  3VI5 A;  5AGY A;  1MDJ A;  3WGE A;  3BBY A;  1MEK A;  4E8E A;  3Q6O A;  1DE1 A;  1A23 A;  4KE3 A;  5GST A;  3MSZ A;  4IKH A;  4LL4 B;  1Z6M A;  4Q5N A;  3GL5 A;  3SBC A;  5HQP A;  3PR8 A;  2HNL A;  1X5E A;  1TK5 B;  2V6K A;  1U3I A;  1A8Y A;  2X49 A;  3LG6 A;  3DML A;  1JZO A;  4CW9 A;  3RAZ A;  3UL3 A;  5F0G A;  2H66 A;  3R3E A;  3TRQ A;  1YDK A;  1AAZ A;  3GKN A;  1ILO A;  1G6Y A;  5ENU A;  2YJ7 A;  2VL2 C;  1EP7 A;  2BTO T;  1Q98 A;  3TJJ A;  2GSR A;  1M99 A;  4HI7 A;  3GNJ A;  4GCI A;  3O3T A;  2YPM A;  4JE1 A;  4XIH A;  1R5A A;  1WRY A;  4L0U A;  3DXB A;  3ZFL A;  2GDR A;  3TJB A;  1UA5 A;  4XS4 B;  3EMX A;  4DVC A;  3G7Y A;  2E2M A;  3KH9 A;  3P2A A;  4K1F A;  4ML1 A;  4Q5R A;  4XTS A;  1A8L A;  4RQR A;  2HRN A;  2ALB A;  4N0V A;  3FY7 A;  2CQ9 A;  4YKG A;  3WGX A;  3AY8 A;  3L9V A;  4HZ4 A;  5G31 A;  1YJ6 A;  1SK1 A;  5F8B A;  1PL2 A;  1ZGN A;  5J9C A;  2B7J A;  3TDG A;  2I4A A;  4TR4 A;  2H0G A;  5FWG A;  1ZYE A;  6GST A;  2LQQ A;  2IIY A;  4BVX B;  1GSF A;  3GX0 A;  3RDW A;  4HZ2 A;  1HNB A;  3VWW A;  4IVF A;  2LQO A;  1ZMA A;  3F4T A;  2DMM A;  4K5S A;  1VRS D;  4LMV A;  1TP9 A;  1NW2 A;  1EEM A;  1JZD A;  1GUK A;  3LGC A;  4TKY A;  1V2A A;  3N5O A;  1VF4 A;  3VFI A;  1K3Y A;  3HKR A;  3M8N A;  4KSM A;  5EL8 A;  3TKQ A;  3EU4 A;  2YN1 A;  4YAV A;  3ME7 A;  1RK4 A;  5G5F A;  4ZXG A;  3EUR A;  1K0D A;  5H5S A;  4I5Q A;  3KP8 A;  4ZB9 A;  5HR1 A;  4MLY A;  3RPP A;  3IC4 A;  4OD7 A;  5IMD A;  1EEJ A;  5H5Q A;  4KSO A;  1LU4 A;  1ACV A;  3A2X A;  3DD3 A;  4WF4 A;  1SD8 A;  2ZNM A;  4MF7 A;  5IMC A;  1TTZ A;  2M80 A;  2VLT A;  1T3B A;  3I6A A;  1EOH A;  5F07 A;  1SKS B;  2OAC A;  3GUS A;  5HR3 A;  4E8H A;  4POM A;  1K0B A;  2X99 A;  3GSS A;  5EVO A;  2X8G A;  2LNS A;  3CSH A;  5GAP D;  4NXI A;  1SJ6 A;  1SEN A;  5D73 A;  2WCI A;  4RI7 A;  3TKS A;  5KN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...