2LRCA

Structure of thioredoxin 2 from pseudomonas aeruginosa pao1 in its reduced form
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
108
structure length
108
Chain Sequence
MKTRYSAEAPARDELDRLAGPTLVEFGTDWCGHCQAAQPLLAEVFSDYPEVGHLKVEDGPGRRLGRSFQVKLWPTFVFLRDGREVARVVRPGSASVLEEAFESLVGEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable thioredoxin
publication title An unusual thioredoxin from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 30
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2lrcA00
2FWEA 1KTEA 2DSAA 3CXGA 3K8NA 3CTFA 5F07A 4TXOB 3EU4A 3SWLA 4WF4A 3KJYA 5LNKe 6GSVA 1T4ZA 2L57A 5D73A 3GRXA 2FWFA 3I6AA 2GVPA 4ZBDA 1T1VA 12GSA 3QPMA 4I8BA 1XWCA 1GH2A 3EMPA 4KCAA 4RI7A 2OJLA 2YOIA 1AC1A 1HNCA 1O73A 1DE2A 2IIYA 3P2AA 5HR2A 1XWKA 2IMIA 1GL8A 1PX6A 1ERWA 3H8QA 1BQ7A 2I1UA 4HDEA 4GSSA 2O85A 1TP9A 2PBJA 2LRCA 3DWVA 4F0CA 1K0MA 5CAXA 1F2EA 2VM1A 2X99A 3C8EA 4IQ1A 5HFGA 1ERTA 1XW6A 5D8IA 3TKPA 2O8VB 2LJRA 3CSIA 4K1FA 4OFMA 1U6TA 1XOAA 4CDOA 2KLXA 5HR1A 4WBJA 3NIVA 2B7KA 2YCDA 2K6VA 5DALA 2AAWA 3WGXA 3IV4A 5F0GA 3IXRA 1T8EB 4EDYA 1ABAA 2OE0A 3EU3A 3LJRA 2JADA 4WR5A 1A8LA 1A2MA 2IN3A 4YQUA 1PN9A 3GFKA 2O7KA 2JZRA 1ML6A 1AXDA 2IMDA 1H75A 2FY6A 2WRTA 1Y25A 4HI7A 2C80A 2IMFA 4ISDA 2VCTA 4HOJA 1WOUA 3TJBA 4ML1A 1MTCA 3ZIVA 1A2LA 2CAQA 5G5EA 2M72A 1VGLA 1A24A 4X43A 1R5PA 2PU9C 2H0GA 3MDKA 5ECQB 3IPZA 4TR1A 1A8YA 1USBA 5KEJA 5ECIB 2GGTA 4JEDA 2CVKA 2YPMA 4XS4A 1WJKA 1FVJA 3HZ4A 3IRAA 1EZKA 2AUVA 4XCSA 5IPHA 8GSSA 3HCZA 2V2GA 2ES7A 4X0XA 3DIEA 4JR6A 3L4NA 4TRXA 1GSSA 1A0RP 2DJ3A 3A5WA 3HKRA 1SENA 3M9KA 1G6YA 2BJXA 2FNOA 3QOUA 1N2AA 2R3XA 1ZL9A 4ZL8A 3KTBA 4ACSA 4KDUA 1VF3A 3C71A 1TU7A 1E2YA 6GSWA 4G2EA 4BPYA 2NVLA 4ZB9A 2C3TA 20GSA 2IWTA 3MWHA 5D96A 4BWQA 3WYWA 3UAPA 1TRSA 1W89A 4POMA 1X5DA 5DALB 4GSTA 2IL3A 5F06A 2RIIA 5IPGA 4GQFA 1R26A 5IMDA 2PUKC 1GRXA 1DUGA 4XRDA 4KW6A 2TRCP 3W8SA 3CRUA 4OD7A 3CRTA 1O85A 2AYTA 1GP1A 1G7OA 1XPVA 1WP0A 1F9MA 4FO5A 4HS1A 2XC2A 2NPBA 2YN1A 2WGRA 2H30A 1GTAA 1XIYA 4GRFA 4HEA2 1Z9HA 4AGSA 1SD8A 3GN3A 5EPFA 3EURA 4BL7A 3C1SA 3WGDA 3HYPA 5HQPA 1G6WA 2YANA 1OC9A 1U3IA 4L5LA 4KB3A 3LG6A 4TR1B 1SL1B 3TRPA 1ON4A 2VL9A 1ZCPA 3GTUB 3UVTA 3KP8A 1BJXA 1F3AA 2EIQA 2L5LA 2HRNA 2GDRA 1M2BA 1PD21 1FHEA 2CX3A 5B8BA 5GAPD 2KP2A 4K6XA 1XCCA 4RI6A 2HFDA 5HFIA 4HU9A 1XFLA 3VWUA 4F2IA 3VPQA 2AJQB 2LNTA 4FIWA 5G2ZA 4NHZA 1OKTA 2YZUA 1V57A 1DBYA 1SL2B 6GSXA 4QQ7A 3UL3A 1K0NA 3GKXA 4GLTA 2H01A 3TOUA 2L5OA 3W8JA 2AHEA 1SJIA 3DRNA 2ALBA 4LMVA 1EOHA 2BMXA 5HR3A 3GL3A 2YJ7A 1ZZYA 5ECNB 2V6OA 5D9VA 4IP6A 1TI3A 1UA5A 2H6ZA 1YKAA 5KN1A 2FLSA 1O7UA 4GF0A 4OO5A 5GSSA 4MZWA 1SU9A 4ZILA 3LYPA 2GT6A 3F63A 3GNJA 4MP4A 3RPPA 3LEFA 1EP8A 2LQQA 1M2AA 2VLUA 4LL4B 1H4OA 2B5XA 4JZQA 5JWQB 2PVQA 2GLRA 1TJDA 2LV3A 1YZXA 2RM5A 4V2LA 3DVXA 4EKZA 2J9HA 4PUFC 3CMIA 4AJ7A 2B1KA 2I9HA 3TKQA 4HZ2A 4NPBA 3ZZXA 3G9BA 4KDXA 3SBCA 1TRUA 1Z7PA 1QFNA 4EF0A 2NTOA 2JZTA 2MMZA 3LXTA 5JCUA 3ZVJD 3HDCA 1WPIA 2ZNMA 2QKEA 3A2XA 2YWOA 1ZYQB 4ZB6A 2CAIA 1TK8B 3M8NA 5G31A 4KCEA 3G7YA 2XHFA 4IP1A 4MZBA 3FRCA 4IW9A 1XWAA 1NSWA 5H5QA 4EL1A 2AV4A 4MF5A 2R2JA 2VD1A 2K9FA 2C0EA 4FYUA 3KCMA 1FG4A 5E59A 3FZAA 4N30A 2VM2A 4X1UA 5DCHA 4AF2A 1M9BA 2GTUA 3CSJA 2B6MA 1K0CA 1EEJA 2IMEA 1RQMA 4PNFA 3GL5A 4MH3A 2MMOA 3M3MA 4I2TA 1EGRA 2VL3A 1O6JA 2GSSA 1WWJA 5CREA 1I9DA 2DMLA 5G1LA 3P8WA 1BX9A 1SK1A 4N0ZA 4JE1A 2P31A 1GSDA 3WT2A 5DQSA 1AQXA 3LGCA 4O32A 2PGTA 3WT1A 3F6FA 5L71A 1EV4A 2V1MA 1AUCA 4GWRA 3L0HA 4K2DA 5JCWA 2LQOA 1R5AA 3C1RA 2C4JA 5DVBA 2REMA 1SJZA 3QR6A 1BEDA 1ERUA 2A4VA 3ME8A 1HYUA 4ECJA 4ULXA 1BAYA 2WS2A 2H1GA 2DC5A 3JCML 1Z6MA 5CP1A 4HUAA 4NXIA 3J7Yb 3GYKA 3TKSE 1GSUA 3L9UA 4MCUA 2G2QA 4CHSA 3FW2A 1B9XC 3KGKA 5B7CA 4FYCA 1VRSD 4KSMA 3FR6A 2M80A 6GSTA 2H8LA 4MK3A 2JZSA 2YWNA 3D22A 16GSA 1S3CA 4L8EA 5DJMA 2H70A 3TJFA 5IMVA 4KE3A 4IJIA 1UN2A 2JSZA 2IMKA 3ZIJA 2R37A 2FA8A 6GSUA 1JFUA 4PQHA 5ECLB 2L4QA 5C04A 3QAWA 2QC7A 5A4WA 1FOVA 2CV4A 4XS1A 1LU4A 2OA7A 3KEBA 3UIWA 2E2GA 4WXTA 2L6DA 1SYRA 3IR4A 4WF5A 5FT3A 2V6KA 3E9JB 4POBA 2WDUA 2MYGA 4I97A 1MDIA 3ED3A 3MNGA 3DD3A 2N5BA 1LBKA 1GNWA 1PSQA 4DVCA 4WBRD 1GULA 5GZZB 1Q4JA 5IMAA 4PURA 3RHBA 1GTIA 4GCIA 4Q5FA 3F9UA 3VWVA 4PXOA 1NW2A 3EINA 4K0NA 2TRXA 3Q18A 3H1NA 2YJHA 3VURA 2H6XA 1FAAA 3GURA 2LEGA 3M1GA 3RPNA 1XXUA 4MJEA 5D9WA 2HNLA 4XRAA 3UMAA 4DSQA 3F4SA 4WETA 3F6DA 4QL7A 4DSSB 4PQIA 4POLA 3I9V2 2GQMA 3G7JA 4K7IA 2CZ3A 3FZ5A 1JHBA 4POKA 4GXZA 1GSEA 3F4RA 4V2NA 3GTUA 2KHPA 1HNBA 1WMJA 2H75A 1UVZA 2HLSA 1EV9A 4GSNA 3EWLA 4ECIA 5IOXA 4XHMA 4ML6A 4TOPA 2QGVA 2ZUPA 1RK4A 3LFLA 4ID0A 4F9ZA 2GS3A 3A2VA 2H0IA 6GSYA 2I81A 2MZCA 2C3QA 3WGEA 4I6XA 1XOBA 4TVEA 2ZCTA 3KM6A 2E0QA 1J0FA 2YZHA 3RHCA 2LRTA 1GUKA 1TXXA 4Z7XA 3VWWA 3BD2A 4MABA 3APOA 3TKSA 2HRFA 5J3RA 1T4YA 4JU5A 4YQMA 4L0WA 1AAZA 2RLIA 4ZIJA 3D4MA 2VCVA 2VLTA 4HZ4A 1F3BA 2HYXA 5EY6A 2HI7A 1GSFA 4NMUA 4N10A 2YNXA 3NZNA 2PWJA 4EXJA 1GLPA 1TK5B 5JCGA 3TJJA 3L78A 2L6CA 3BJ5A 4EDZA 1K3OA 4MDCA 2GT5A 3RDWA 1U3AA 2WFCA 18GSA 3D6IA 2C0DA 3FZ4A 2H73A 2X8HA 1XW9A 3UBLA 2EC4A 4N11A 2KOKA 4J56E 2MBTA 2YWIA 2OBIA 4NV2A 2H19A 1GUMA 1WRYA 5ECKB 2DBCA 1K3LA 5IMFA 1TU8A 5LCZA 5IIZA 4MMMA 1OVNA 2IFQB 2DJ1A 1KEBA 2HSHA 1TTZA 1ZYEA 3A3TA 1B4QA 1NHOA 3BOAA 4OCFA 4MH2A 2JL4A 4Q5RA 2FCHA 4WKWA 1T3BA 1AQWA 3AY8A 4D73A 3CSHA 3QMXA 2F51A 2OBKA 5DCGA 2DMMA 3KMNA 4FYBA 1PL2A 1K0DA 3GIXA 2GZZA 5DQYA 3TKRA 3ZMKA 2X8CA 2DIYA 1TW9A 3QFAC 3F8UA 1E6BA 3D4TA 3FR3A 4IBPA 1GNEA 4V1Ag 2VOCA 3U5RE 1TI1A 2OACA 5ENUA 3H93A 5AIVA 4IN0A 2X64A 3IA1A 3U6VA 5ECHB 5G30A 3H4KA 3O76A 2F8AA 3KIJA 4MPGA 4K0GA 5F8BA 5D9XA 3PGTA 4F0BA 2PVOC 2A2SA 4MLYA 2LSTA 1YKCA 4ZXGA 2VAFA 2H74A 2RUFA 1S3DA 3ZVJA 2XBQA 1SD9A 2YV7A 2VLVA 5CRGA 5INYA 3LSZA 1XZOA 1OC3A 3IAS2 3MSZA 2H1AA 1EOGA 3HJMA 2LS5A 2XBIA 2JACA 4PQ1A 3TKSC 4OCEA 1Q98A 2H6YA 3FK8A 2HZEA 4OFTA 2LRNA 1OE8A 4G10A 4Q5NA 4ZBBA 4TXVA 3DXBA 5IO0A 3TOTA 3VI5A 4PX1A 3QDNA 4YAPA 1XWGA 1Z5YE 1X9MB 1GTUA 1VF4A 1FVKA 5DAKA 3TJGA 1TDIA 1RW1A 1FB0A 5ID2A 4BVYA 4DSRA 1PKWA 3L9SA 1QQ2A 3LQ7A 2JSYA 1SYXA 2DJ0A 3GA4A 1CQGA 4KSOA 3VLNA 4J57E 4OWYA 3HJOA 3N9JA 4LMWA 4EUYA 3IDVA 3QD9A 1VF1A 1XVWA 1PQNA 5AN1A 3LYKA 5JWRB 3I43A 3M0FA 4G9HA 4D73B 1W4VA 4YAVA 2BTOT 3R2QA 3ERGA 5H5SA 3ZFLA 4OO4A 5FHIA 1ERVA 9GSSA 2XPEA 4EVMA 2CQ9A 1YJ6A 5DJLA 3HZ8A 1ZOFA 2ON5A 4ILFA 2QSIA 4KAEA 2LJKA 2WZ9A 2VCWA 3VFIA 2P5RA 3RAZA 4RQRA 19GSA 4CW9A 1OAZA 2WB9A 2HZFA 5IM9A 4LLRA 2H1BA 5H5RA 3UEMA 17GSA 1IYIA 3LWAA 1ACVA 1PRXA 4XS6A 1XBSA 1V58A 1F6MC 2CVDA 2J23A 2B1LA 1U87A 3TB2A 3HHVA 1AIUA 2K8SA 4V2MA 3PR8A 4IQAA 1SJ6A 2VCQA 1UC7A 5AISA 3WD6A 4BVXA 3FKFA 5KN3A 4DSSA 5ECRB 1Z3EA 2HZEB 4MA9A 1V98A 4E8EA 1OC8A 2DLXA 2OE3A 4GTUA 2O89A 2VCZA 4XIHA 1BG5A 1SKSB 2HE3A 1NM3A 2O87A 3EC3A 4IHUA 2MBSA 5DAKB 2R6KA 5J4UA 2N5AA 5ID2B 4IELA 2PN8A 3IC4A 1EGOA 2R5GA 3Q74A 2OADA 2H76A 1AW9A 3ISOA 5IMCA 4QL9A 2H71A 2HT9A 2Z9SA 4HU7A 2A2RA 2ON7A 1EP7A 1YEXA 4LA1A 2YP6A 5HR0A 4IS0A 5ELAA 5J41A 4O7HA 5DDLA 5A4VA 1PKZA 2RUEA 2VL2A 1HD2A 5CO3A 3TRXA 5ECSA 1V2AA 2HSYA 4TKYA 1GUHA 1SK2A 4GQCA 2I4AA 3F0IA 2CZ2A 2V41A 5IMZA 1HNAA 2CT6A 2K18A 4OFNA 3P7XA 1QMVA 3DEXA 3KP9A 1S3AA 1THXA 2KUCA 3EVIA 5ABRA 3Q6OA 5A5KA 3ZITA 5A4UA 3P90A 4ZBAA 1X5EA 2WULA 2AB6A 5J5NA 3HD5A 2FA4A 3QFBC 4YH2A 4MZCA 2F3MA 4TR0A 2DJ2A 4F82A 3BCIA 1JLVA 1J08A 1EWXA 2GZPA 1K0OA 1URMA 3TGZA 3PH9A 3V1WA 1HQOA 4NHWA 4MJBA 1T00A 4NAXA 5COHA 5ECOB 2G0FA 1YQ1A 3O3TA 11GSA 4EC0A 1Y6EA 4KA0A 5CRWA 3GHAA 2IFQA 5LD0A 2F9SA 1BYEA 1FB6A 1N8JA 3N5OA 1A23A 1O8XA 2C8UA 5G5FA 4ZB8A 1B48A 1EEMA 2FWHA 1DE1A 1V9WA 2P0GA 2C3NA 3ZTLA 3S9FA 13GSA 1TK0B 4TR3A 2RM6A 2V32A 2DIZA 2IJYA 2EIOA 2C0GA 3TDGA 1PMTA 4KH7A 4EO3A 3CBUA 3FZ9A 4ECCA 1SL0B 1O8WA 2FGXA 4O92A 10GSA 1X9WB 3W6GA 3GX0A 4AJ8A 3ZLPA 3UARA 2OE1A 3IOSA 5J9BA 2LJAA 4N0VA 1GSQA 3HVXA 5AGYA 3ZREA 2CA8A 3VWXA 5D9TA 4V1Ap 3ZL5A 2MMNA 3GV1A 4TW5A 1LJRA 4LL1B 1PA3A 4PNGA 1GSYA 4WR4A 3TRQA 14GSA 2GQKA 4O5RA 1B9YC 3HVSA 2GQLA 3HA9A 3Q19A 4FH8A 1R4WA 1YF1A 3VI7A 5CYYA 1JLWA 3DMLA 5B6NA 2R4VA 3DVWA 4HQSA 2VUPA 3GX8A 4K9ZA 1MDJA 1SK0A 1A0FA 2EIRA 3GSTA 5CRDA 3UOMA 3NOFA 3DYRA 5ECMB 1YDKA 3L9VA 3GH9A 4JBBA 2VIMA 5G1KA 3D0ZA 2VL2C 4BWSA 1NHYA 3OR5A 4TN8A 1MDKA 1THOA 3F3QA 2KP1A 1OKDA 2PPTA 2M46A 4NWYA 2HXKA 1PGTA 4G19A 4H86A 5EL8A 3GUSA 1I5GA 2P5QA 4EE0A 2WJUA 4ECBA 2VO4A 3KZQA 1K3YA 2N5FA 3FEUA 5AIXA 1B4PA 22GSA 3IK7A 2NDOA 3ZMLA 3FR9A 1B8XA 5C00A 1OE7A 3VK9A 5ELGA 3TCOA 1JZRA 2H0HA 4HQZA 4BA7A 1ZMAA 5CNWA 1JZOA 1KBNA 3GH6A 5CRHA 5GAND 3MAKA 2NBSA 1CQHA 4IGJA 4MJCA 2B5YA 3O6TA 4AJ6A 1ZGNA 2CX4A 2FUG2 1YEPA 4K8MA 4IKHA 4HJMA 3KH7A 4XS4B 2H72A 4MF7A 4L0UA 1X9SB 7GSSA 3A2WA 4L5OA 1TOFA 4IJ3A 3GKNA 3LXZA 2H66A 5D93A 2LUSA 4PUAA 1WIKA 1YF0A 1JZDA 3CYNA 4I5QA 2PMTA 4KDYA 5FWGA 5B8AA 3APSA 2DJKA 4PGTA 4ZL7A 1QK8A 2GSTA 3KTLA 1VF2A 3TUEA 3EYTA 5KN0A 3GMFA 3IBHA 3ZYWA 3HJPA 1SKWB 2LNSA 2YWMA 2TIRA 2DJJA 3IK9A 1MD4A 5E4WA 4RUVA 3TJKA 1O81A 2E2MA 1PX7A 1M0UA 1QGVA 3CTGA 4K7OA 5DBQA 4J2FA 5JWOB 1MD3A 4OMVA 4Q5QA 3GKKA 3IAM2 5J9CA 3KXOA 4HJ2A 3APQA 3HY2A 2H1DA 3KH9A 1MEKA 1M99A 4KX4A 4WEYA 4NV5A 1GTBA 1TRVA 3VPTA 1YY7A 4KNDA 5IQYA 3BCKA 4MJAA 5ECPB 2C1YA 1X5CA 3QAVA 3US3A 3HXSA 3UJ1A 1AQVA 1GWCA 4KGIA 3GKMA 1XW5A 1TKDB 3C73A 1U88A 3DKSA 3E0UA 3UBKA 4TR4A 4MPFA 1A2JA 1G0TA 1F37A 4TXOA 2VD0A 1DSBA 3UVHA 1FW1A 2I3YA 2L59A 3G7IA 3FY7A 4KUNA 2VCXA 3IHQA 4XTSA 1K0AA 2B5EA 3ZRDA 2GSRA 5EVOA 2PERA 2GZYA 3KD0A 3ERFA 4JRRA 4P3YB 1M9AA 1QXHA 1OC9B 1QUWA 2JU5A 1XWBA 2XPDA 2B3SA 1ST9A 1C72A 3ZFBA 4IVFA 1SKRB 3D21A 1IYHA 3I69A 5HFKA 2LKUA 2B7JA 2FD3A 3E3EA 3KMOA 1WE0A 2X8GA 4ZL9A 5IOWA 2YV9A 4F03A 3HVVA 3ERWA 3M9JA 1ILOA 1KNGA 2LTKA 2CVBA 1M7TA 4JR4A 4DEJA 3F3RA 3FHKA 2FWGA 1XVQA 4E8HA 1OYJA 1J9BA 5IO2A 1PL1A 1T7PB 1G7EA 1Z6NA 2E7PA 5F05A 3ME7A 1TRWA 1R7HA 2L4CA 1GLQA 2WCIA 3QCPA 3PINA 4K7NA 1Z7RA 2F8FA 3EMXA 3J7Yk 2D2ZA 4YQVA 1V40A 2C0FA 2IPAA 3BBYA 3D5JA 3F4TA 2K8VA 3GSSA 4MF6A 4RQXA 5GSTA 2MMAA 6GSSA 3RBTA 2GSQA 3DGQA 3C7MA 2FHEA 1FO5A 1X0RA 3IE3A 3QAGA 3FYGA 2OKAA 3H79A 4I2UA 3LORA 3EE2A 5KN2A 1K0BA 1JZWA 5B6MA 1M2DA
chains in the Genus database with same CATH superfamily
2FWEA 1KTEA 2DSAA 3CXGA 3K8NA 3CTFA 5F07A 4TXOB 3EU4A 3SWLA 4WF4A 3KJYA 5LNKe 6GSVA 1T4ZA 2L57A 5D73A 3GRXA 2FWFA 3I6AA 2GVPA 4ZBDA 1T1VA 12GSA 3QPMA 4I8BA 1XWCA 1GH2A 3EMPA 4KCAA 4RI7A 2OJLA 2YOIA 1AC1A 1HNCA 1O73A 1DE2A 2IIYA 3P2AA 5HR2A 1XWKA 2IMIA 1GL8A 1PX6A 1ERWA 1XG8A 3H8QA 1BQ7A 2I1UA 4HDEA 4GSSA 2O85A 1TP9A 2PBJA 2LRCA 3DWVA 4F0CA 1K0MA 5CAXA 1F2EA 2VM1A 2X99A 3C8EA 4IQ1A 2DKIA 1ERTA 1XW6A 5D8IA 5HFGA 3TKPA 2O8VB 2LJRA 3CSIA 4K1FA 4OFMA 1U6TA 1XOAA 4CDOA 2KLXA 5HR1A 4WBJA 3NIVA 2B7KA 2YCDA 2K6VA 5DALA 2AAWA 3WGXA 3IV4A 5F0GA 3IXRA 1T8EB 4EDYA 1ABAA 2OE0A 3EU3A 3LJRA 2JADA 4WR5A 1A8LA 1A2MA 2IN3A 4YQUA 1PN9A 3GFKA 1M3IA 2O7KA 2JZRA 1ML6A 3IC8A 1AXDA 2IMDA 1H75A 2FY6A 2WRTA 1Y25A 4HI7A 2C80A 2IMFA 4ISDA 2VCTA 4HOJA 1WOUA 3TJBA 4ML1A 1MTCA 3ZIVA 1A2LA 2CAQA 5G5EA 2M72A 1VGLA 1A24A 4X43A 1R5PA 2PU9C 2H0GA 3MDKA 5ECQB 3IPZA 4TR1A 1A8YA 1USBA 5KEJA 5ECIB 2GGTA 4JEDA 2CVKA 2YPMA 4XS4A 1WJKA 1FVJA 3HZ4A 3IRAA 1EZKA 2AUVA 4XCSA 5IPHA 8GSSA 3HCZA 2V2GA 2ES7A 4X0XA 3DIEA 4JR6A 3L4NA 4TRXA 1GSSA 1A0RP 2DJ3A 3A5WA 3HKRA 3MYDA 1SENA 3M9KA 1G6YA 2BJXA 2FNOA 3QOUA 1N2AA 2QA2A 2R3XA 1ZL9A 4ZL8A 3KTBA 4ACSA 4KDUA 1VF3A 3C71A 2UZ8A 1TU7A 3MIXA 1E2YA 6GSWA 4G2EA 4BPYA 2NVLA 4ZB9A 2C3TA 20GSA 2IWTA 3MWHA 5D96A 4BWQA 3WYWA 3UAPA 1TRSA 1W89A 4POMA 1X5DA 5DALB 4GSTA 2IL3A 5F06A 2RIIA 5IPGA 4GQFA 1R26A 5IMDA 2PUKC 1GRXA 1DUGA 4XRDA 4KW6A 2TRCP 3W8SA 3CRUA 4OD7A 3CRTA 1O85A 2AYTA 1GP1A 1G7OA 1XPVA 1WP0A 1F9MA 4FO5A 4HS1A 2XC2A 2NPBA 2YN1A 2WGRA 2H30A 1GTAA 1XIYA 4GRFA 4HEA2 1Z9HA 4AGSA 1SD8A 3GN3A 5EPFA 3EURA 4BL7A 3C1SA 3WGDA 3HYPA 5HQPA 1G6WA 3A5IA 2YANA 1OC9A 1U3IA 4L5LA 4KB3A 3LG6A 4TR1B 1SL1B 3TRPA 1ON4A 2VL9A 1ZCPA 3GTUB 3UVTA 3KP8A 1BJXA 1F3AA 2EIQA 2L5LA 2HRNA 2GDRA 1M2BA 1PD21 1FHEA 2CX3A 5B8BA 5GAPD 2KP2A 4K6XA 1XCCA 4RI6A 2HFDA 5HFIA 4HU9A 1XFLA 3VWUA 4F2IA 3VPQA 2AJQB 2LNTA 4FIWA 5G2ZA 4NHZA 1OKTA 2YZUA 1V57A 1DBYA 1SL2B 6GSXA 4QQ7A 3UL3A 1K0NA 3GKXA 4GLTA 2H01A 3TOUA 2L5OA 3W8JA 2AHEA 1SJIA 3DRNA 2ALBA 4LMVA 1EOHA 2BMXA 5HR3A 3GL3A 2YJ7A 1ZZYA 5ECNB 2V6OA 5D9VA 4IP6A 1TI3A 1UA5A 2H6ZA 1YKAA 5KN1A 2FLSA 4CY8A 1O7UA 4GF0A 4OO5A 5GSSA 4MZWA 1SU9A 4ZILA 3LYPA 2GT6A 3F63A 3GNJA 4MP4A 3RPPA 3LEFA 1EP8A 2LQQA 1M2AA 2VLUA 4LL4B 1H4OA 2B5XA 4JZQA 5JWQB 4FQUA 1ZYNA 2PVQA 2GLRA 1TJDA 2LV3A 1YZXA 2RM5A 4V2LA 3DVXA 4EKZA 2J9HA 4PUFC 3CMIA 4AJ7A 2B1KA 2I9HA 3TKQA 4HZ2A 4NPBA 3R3EA 3ZZXA 3G9BA 4Z2RA 4KDXA 3SBCA 1TRUA 1Z7PA 1QFNA 4EF0A 2NTOA 2JZTA 2MMZA 3LXTA 5JCUA 3ZVJD 4BL7B 4O5UA 3HDCA 1WPIA 2ZNMA 2QKEA 3A2XA 2YWOA 1ZYQB 4ZB6A 2CAIA 1TK8B 3M8NA 5G31A 4KCEA 3G7YA 2XHFA 4IP1A 4MZBA 3FRCA 4IW9A 1XWAA 1NSWA 5H5QA 4EL1A 2AV4A 4USSA 4MF5A 2R2JA 2VD1A 2K9FA 2C0EA 4FYUA 3KCMA 1FG4A 5E59A 3FZAA 4N30A 2VM2A 4X1UA 5DCHA 4AF2A 1M9BA 2GTUA 3CSJA 2B6MA 1K0CA 1EEJA 2IMEA 1RQMA 4YKFA 4PNFA 3GL5A 4MH3A 2MMOA 3M3MA 4I2TA 1EGRA 2VL3A 1O6JA 2GSSA 1WWJA 3FMWA 5CREA 1I9DA 2DMLA 5G1LA 3P8WA 1BX9A 1SK1A 3LW9A 4YKGA 4N0ZA 4JE1A 2P31A 1GSDA 3WT2A 5DQSA 1AQXA 3LGCA 4O32A 2PGTA 3WT1A 3F6FA 5L71A 1EV4A 2V1MA 1AUCA 4GWRA 3L0HA 4K2DA 5JCWA 2LQOA 1R5AA 3C1RA 2C4JA 5DVBA 2REMA 1SJZA 3QR6A 5KOXA 1BEDA 1ERUA 2A4VA 3ME8A 1HYUA 4ECJA 4ULXA 1BAYA 2WS2A 2H1GA 2DC5A 3JCML 1Z6MA 5CP1A 4HUAA 4NXIA 3J7Yb 3GYKA 3TKSE 1GSUA 3L9UA 4MCUA 2G2QA 4CHSA 3FW2A 1B9XC 3KGKA 5B7CA 4FYCA 1VRSD 4KSMA 3FR6A 2M80A 6GSTA 2H8LA 4MK3A 2JZSA 2YWNA 3D22A 16GSA 1S3CA 4L8EA 5DJMA 2H70A 3TJFA 5IMVA 4KE3A 4IJIA 1UN2A 2JSZA 2IMKA 3ZIJA 2R37A 2FA8A 6GSUA 1JFUA 4PQHA 5ECLB 2L4QA 5C04A 3QAWA 2QC7A 5A4WA 1FOVA 2CV4A 4XS1A 1LU4A 2OA7A 3KEBA 3UIWA 2E2GA 4WXTA 2L6DA 1SYRA 3IR4A 4WF5A 5FT3A 2V6KA 3E9JB 4POBA 2WDUA 1FOHA 2MYGA 4I97A 1MDIA 3ED3A 3MNGA 3DD3A 2N5BA 1LBKA 1GNWA 1PSQA 4DVCA 4WBRD 1GULA 5GZZB 1Q4JA 5IMAA 4PURA 3RHBA 1GTIA 4GCIA 4Q5FA 3F9UA 3VWVA 4PXOA 1NW2A 3EINA 2QA1A 4K0NA 5BMUA 2HRKA 2TRXA 3Q18A 3H1NA 2YJHA 3VURA 2H6XA 1FAAA 3GURA 2LEGA 3M1GA 3RPNA 4BIKA 1XXUA 4MJEA 5D9WA 2HNLA 2R0CA 4XRAA 3UMAA 4DSQA 4BVXB 4A5PA 3F4SA 4WETA 3F6DA 4QL7A 4DSSB 4PQIA 4POLA 3I9V2 2GQMA 3G7JA 4K7IA 2CZ3A 3FZ5A 1JHBA 4POKA 4GXZA 1GSEA 3F4RA 4V2NA 3GTUA 2KHPA 1HNBA 1WMJA 2H75A 1UVZA 2HLSA 1EV9A 4GSNA 3EWLA 4ECIA 5IOXA 4XHMA 4ML6A 4TOPA 2QGVA 2ZUPA 1RK4A 3LFLA 4ID0A 4F9ZA 1PFOA 2GS3A 3A2VA 2H0IA 6GSYA 2I81A 2MZCA 2C3QA 3WGEA 4I6XA 1XOBA 4TVEA 2ZCTA 3KM6A 2E0QA 1J0FA 2YZHA 3RHCA 2LRTA 1GUKA 1TXXA 4Z7XA 3VWWA 3BD2A 4MABA 3APOA 3TKSA 2HRFA 5J3RA 1T4YA 4JU5A 4YQMA 4L0WA 1AAZA 2RLIA 4ZIJA 2A4HA 3D4MA 2VCVA 2VLTA 4HZ4A 1F3BA 2HYXA 5EY6A 2HI7A 1GSFA 5KOWA 4NMUA 4N10A 2YNXA 3NZNA 2PWJA 4EXJA 1GLPA 4G0KA 1TK5B 5JCGA 3TJJA 3L78A 2L6CA 3BJ5A 4EDZA 1K3OA 4MDCA 1M3JA 2GT5A 3RDWA 1U3AA 2WFCA 18GSA 3D6IA 2C0DA 3FZ4A 2H73A 2X8HA 1XW9A 3UBLA 2EC4A 4N11A 2KOKA 4Z2TA 4J56E 2MBTA 2YWIA 2OBIA 3CQFA 4NV2A 2H19A 1GUMA 1WRYA 5ECKB 2DBCA 1K3LA 5IMFA 1TU8A 5LCZA 4G0IA 5IIZA 4K5SA 4MMMA 1OVNA 2IFQB 2DJ1A 1KEBA 2HSHA 5BRTA 1TTZA 1ZYEA 3A3TA 3EPTA 1B4QA 1ZYPA 1NHOA 3BOAA 4OCFA 4MH2A 2JL4A 4Q5RA 2FCHA 4WKWA 1T3BA 1AQWA 3AY8A 4D73A 3CSHA 3QMXA 2F51A 2OBKA 5DCGA 2DMMA 3KMNA 4FYBA 1PL2A 1K0DA 3GIXA 2GZZA 5DQYA 3TKRA 3ZMKA 2X8CA 2DIYA 1TW9A 3QFAC 3F8UA 1E6BA 3D4TA 3FR3A 4IBPA 1GNEA 4V1Ag 2VOCA 3U5RE 1TI1A 2OACA 5ENUA 3H93A 5AIVA 2X4AA 4IN0A 2X64A 3IA1A 3U6VA 5ECHB 5G30A 3H4KA 3O76A 2F8AA 3KIJA 4MPGA 4K0GA 5F8BA 5D9XA 3PGTA 4F0BA 2PVOC 4HSCX 2A2SA 4MLYA 2LSTA 1YKCA 4ZXGA 2VAFA 2H74A 2RUFA 1S3DA 2X49A 3ZVJA 2XBQA 1SD9A 2YV7A 2VLVA 5CRGA 5INYA 3LSZA 1XZOA 1OC3A 3IAS2 3MSZA 2H1AA 1EOGA 3HJMA 2LS5A 2XBIA 2JACA 4PQ1A 3TKSC 4OCEA 1Q98A 2H6YA 3FK8A 2HZEA 4OFTA 2LRNA 1OE8A 4G10A 4Q5NA 4ZBBA 4TXVA 3DXBA 5IO0A 3TOTA 3VI5A 4PX1A 3QDNA 4YAPA 1XWGA 1Z5YE 1X9MB 1GTUA 1VF4A 1FVKA 3HVNA 5DAKA 1TDIA 3TJGA 1RW1A 1FB0A 5ID2A 4BVYA 4DSRA 1PKWA 3L9SA 1QQ2A 3LQ7A 2JSYA 1SYXA 2DJ0A 3GA4A 1CQGA 4KSOA 3VLNA 4J57E 4OWYA 3HJOA 4G0LA 3N9JA 4LMWA 4EUYA 3IDVA 3QD9A 1VF1A 1XVWA 1PQNA 5AN1A 3LYKA 5JWRB 3I43A 3M0FA 4G9HA 4D73B 1W4VA 4YAVA 2BTOT 3R2QA 3ERGA 5H5SA 3ZFLA 4OO4A 5FHIA 1ERVA 9GSSA 2XPEA 4EVMA 2CQ9A 1YJ6A 3IHGA 5DJLA 3HZ8A 1ZOFA 2ON5A 4ILFA 2QSIA 4KAEA 2LJKA 2WZ9A 2R0PA 2VCWA 3VFIA 2P5RA 3RAZA 4RQRA 1PN0A 19GSA 4CW9A 1OAZA 2WB9A 2HZFA 5IM9A 4LLRA 2H1BA 5H5RA 3UEMA 17GSA 1IYIA 3LWAA 1ACVA 4X4JA 1PRXA 4XS6A 1XBSA 1V58A 1F6MC 2CVDA 2J23A 2B1LA 1U87A 3TB2A 3HHVA 1AIUA 2K8SA 4V2MA 3PR8A 4IQAA 1SJ6A 2VCQA 1UC7A 5AISA 3WD6A 4BVXA 3FKFA 5KN3A 4DSSA 5ECRB 1Z3EA 2HZEB 4MA9A 1V98A 4E8EA 1OC8A 2DLXA 2OE3A 4GTUA 2O89A 2VCZA 4XIHA 1BG5A 1SKSB 2HE3A 1NM3A 2O87A 3EC3A 4IHUA 2MBSA 5DAKB 2R6KA 5J4UA 2N5AA 5ID2B 4BVYB 4IELA 2PN8A 3IC4A 1EGOA 2R5GA 3Q74A 2OADA 2H76A 1AW9A 3ISOA 5IMCA 4QL9A 2H71A 2HT9A 2Z9SA 4HU7A 2A2RA 2ON7A 1EP7A 1YEXA 4LA1A 2YP6A 5HR0A 2HSMA 4IS0A 5ELAA 5J41A 4O7HA 5DDLA 5A4VA 1PKZA 2RUEA 2VL2A 1HD2A 5CO3A 3TRXA 5ECSA 1V2AA 2HSYA 4KF9A 4TKYA 1GUHA 1SK2A 4GQCA 2I4AA 3F0IA 2CZ2A 2V41A 5IMZA 1HNAA 2CT6A 2K18A 2DKHA 4OFNA 3P7XA 1QMVA 3DEXA 3KP9A 1S3AA 1THXA 2KUCA 3EVIA 5ABRA 3Q6OA 5A5KA 3ZITA 5A4UA 3P90A 4ZBAA 1X5EA 2WULA 2AB6A 5J5NA 3HD5A 2FA4A 3QFBC 4YH2A 4MZCA 2F3MA 4TR0A 2DJ2A 4F82A 3BCIA 1JLVA 1J08A 1EWXA 2GZPA 1K0OA 1URMA 3TGZA 3PH9A 3V1WA 1HQOA 4NHWA 4MJBA 1T00A 4NAXA 5COHA 5ECOB 2G0FA 1YQ1A 3O3TA 11GSA 4EC0A 1Y6EA 4KA0A 5CRWA 3GHAA 2IFQA 5LD0A 2F9SA 1BYEA 1FB6A 1N8JA 3N5OA 1A23A 1O8XA 2C8UA 5G5FA 4ZB8A 1B48A 1EEMA 2FWHA 1DE1A 1V9WA 2P0GA 2C3NA 3ZTLA 3S9FA 13GSA 1TK0B 4TR3A 2RM6A 2V32A 2DIZA 2IJYA 2EIOA 2C0GA 3TDGA 1PMTA 4KH7A 4EO3A 3CBUA 3FZ9A 4ECCA 1SL0B 1O8WA 2FGXA 4O92A 10GSA 1X9WB 3W6GA 3GX0A 4AJ8A 3ZLPA 3UARA 2OE1A 3IOSA 5J9BA 2LJAA 4N0VA 1GSQA 3HVXA 5AGYA 3ZREA 2CA8A 3VWXA 5D9TA 4V1Ap 3ZL5A 4EIPA 2MMNA 3GV1A 4TW5A 1LJRA 4LL1B 1PA3A 4PNGA 1GSYA 4WR4A 3TRQA 14GSA 2GQKA 4O5RA 1B9YC 3HVSA 2GQLA 3HA9A 3Q19A 4FH8A 1R4WA 1YF1A 3VI7A 5CYYA 1JLWA 3DMLA 4ICYA 5B6NA 2R4VA 3DVWA 4HQSA 2VUPA 3GX8A 4K9ZA 1MDJA 1SK0A 1A0FA 2EIRA 3GSTA 5CRDA 3UOMA 3NOFA 3DYRA 5ECMB 1YDKA 3L9VA 3GH9A 4JBBA 2VIMA 5G1KA 3D0ZA 2VL2C 4BWSA 1NHYA 3OR5A 4TN8A 1MDKA 1THOA 2R0GA 3F3QA 2KP1A 1OKDA 2PPTA 2M46A 4NWYA 2HXKA 1PGTA 4G19A 4H86A 5EL8A 3GUSA 1I5GA 2P5QA 4EE0A 2WJUA 4ECBA 2VO4A 3KZQA 1K3YA 2N5FA 3FEUA 5AIXA 1B4PA 22GSA 3IK7A 2NDOA 3ZMLA 3FR9A 1B8XA 5C00A 1OE7A 3VK9A 5ELGA 3TCOA 1JZRA 2H0HA 4HQZA 4BA7A 1ZMAA 5CNWA 1JZOA 1KBNA 3GH6A 5CRHA 5GAND 3MAKA 2NBSA 1CQHA 4IGJA 1S3RA 4MJCA 2B5YA 3O6TA 4AJ6A 1ZGNA 2CX4A 2FUG2 1YEPA 4K8MA 4IKHA 4HJMA 3KH7A 4XS4B 2H72A 4MF7A 4L0UA 1X9SB 7GSSA 3A2WA 4L5OA 1TOFA 4IJ3A 3GKNA 3LXZA 2H66A 5D93A 2LUSA 4PUAA 4Z2UA 1WIKA 1YF0A 1JZDA 3CYNA 4I5QA 2PMTA 4KDYA 5FWGA 5B8AA 3APSA 2DJKA 4PGTA 4ZL7A 1QK8A 2GSTA 3KTLA 1VF2A 3TUEA 3EYTA 5KN0A 3GMFA 3IBHA 3ZYWA 3HJPA 1SKWB 2LNSA 2YWMA 2TIRA 2DJJA 3IK9A 1MD4A 5E4WA 4RUVA 3TJKA 1O81A 2HRAA 2A2PA 2E2MA 1PX7A 1M0UA 1QGVA 3CTGA 4K7OA 5DBQA 4J2FA 5JWOB 1MD3A 4OMVA 4Q5QA 4K2XA 3GKKA 3IAM2 5J9CA 3KXOA 4HJ2A 3APQA 3HY2A 2H1DA 3KH9A 1MEKA 1M99A 4KX4A 4WEYA 4NV5A 1GTBA 1TRVA 3VPTA 1YY7A 4KNDA 5IQYA 3BCKA 4MJAA 5ECPB 2C1YA 1X5CA 3QAVA 3US3A 3HXSA 3UJ1A 1AQVA 1GWCA 4KGIA 3GKMA 1XW5A 1TKDB 3C73A 1U88A 3DKSA 3E0UA 3UBKA 4TR4A 4MPFA 1A2JA 4PTSA 1G0TA 1F37A 4TXOA 2VD0A 1DSBA 3UVHA 1FW1A 2I3YA 2L59A 3G7IA 3FY7A 4KUNA 2VCXA 3IHQA 4XTSA 1K0AA 2B5EA 3ZRDA 2GSRA 5EVOA 2PERA 2GZYA 3KD0A 3ERFA 4JRRA 4P3YB 1M9AA 1QXHA 1OC9B 1QUWA 2JU5A 1XWBA 2XPDA 2B3SA 1ST9A 1C72A 3ZFBA 4IVFA 1SKRB 3D21A 1IYHA 3I69A 4K5RA 5HFKA 2LKUA 2B7JA 2FD3A 3E3EA 3KMOA 1WE0A 2X8GA 4ZL9A 5IOWA 2YV9A 4F03A 3HVVA 3ERWA 3M9JA 1ILOA 4O5QA 1KNGA 2LTKA 2CVBA 1M7TA 4JR4A 4DEJA 3F3RA 3PPUA 3FHKA 2FWGA 1XVQA 4E8HA 1OYJA 1J9BA 5IO2A 1PL1A 1T7PB 1G7EA 1Z6NA 2E7PA 5F05A 3ME7A 1TRWA 1R7HA 2L4CA 1GLQA 4CY6A 2WCIA 3QCPA 3PINA 4K7NA 1Z7RA 2F8FA 3EMXA 3J7Yk 2D2ZA 4YQVA 1V40A 2C0FA 2IPAA 3BBYA 3D5JA 3F4TA 2K8VA 3GSSA 4MF6A 4RQXA 5GSTA 2MMAA 6GSSA 3RBTA 2GSQA 3DGQA 3C7MA 2FHEA 4MNNA 1FO5A 1X0RA 3IE3A 3QAGA 3FYGA 2OKAA 3H79A 4I2UA 3LORA 4EIQA 3EE2A 5KN2A 1K0BA 1JZWA 5B6MA 1M2DA
chains in the Genus database with same CATH topology
2FWEA 1KTEA 2DSAA 3CXGA 3K8NA 3CTFA 5F07A 4TXOB 3EU4A 3SWLA 4WF4A 3KJYA 5LNKe 6GSVA 1T4ZA 2L57A 5D73A 3GRXA 2FWFA 3I6AA 2GVPA 4ZBDA 1T1VA 12GSA 3QPMA 4I8BA 1XWCA 1GH2A 3EMPA 4KCAA 4RI7A 2OJLA 2YOIA 1AC1A 1HNCA 1O73A 1DE2A 2IIYA 3P2AA 5HR2A 1XWKA 2IMIA 1GL8A 1PX6A 1ERWA 3H8QA 1BQ7A 2I1UA 4HDEA 4GSSA 2O85A 1TP9A 2PBJA 2LRCA 3DWVA 4F0CA 1K0MA 5CAXA 1F2EA 2VM1A 2X99A 3C8EA 4IQ1A 2DKIA 1ERTA 1XW6A 5D8IA 5HFGA 3TKPA 2O8VB 2LJRA 3CSIA 4K1FA 4OFMA 1U6TA 1XOAA 4CDOA 2KLXA 5HR1A 4WBJA 3NIVA 2B7KA 2YCDA 2K6VA 5DALA 2AAWA 3WGXA 3IV4A 5F0GA 3IXRA 1T8EB 4EDYA 1ABAA 2OE0A 3EU3A 3LJRA 2JADA 4WR5A 1A8LA 1A2MA 2IN3A 4YQUA 1PN9A 3GFKA 2O7KA 2JZRA 1ML6A 3IC8A 1AXDA 2IMDA 1H75A 2FY6A 2WRTA 1Y25A 4HI7A 2C80A 2IMFA 4ISDA 2VCTA 4HOJA 1WOUA 3TJBA 4ML1A 1MTCA 3ZIVA 1A2LA 2CAQA 5G5EA 2M72A 1VGLA 1A24A 4X43A 1R5PA 2PU9C 2H0GA 3MDKA 5ECQB 3IPZA 4TR1A 1A8YA 1USBA 5KEJA 5ECIB 2GGTA 4JEDA 2CVKA 2YPMA 4XS4A 1WJKA 1FVJA 3HZ4A 3IRAA 1EZKA 2AUVA 4XCSA 5IPHA 8GSSA 3HCZA 2V2GA 2ES7A 4X0XA 3DIEA 4JR6A 3L4NA 4TRXA 1GSSA 1A0RP 2DJ3A 3A5WA 3HKRA 3MYDA 1SENA 3M9KA 1G6YA 2BJXA 2FNOA 3QOUA 1N2AA 2QA2A 2R3XA 1ZL9A 4ZL8A 3KTBA 4ACSA 4KDUA 1VF3A 3C71A 2UZ8A 1TU7A 3MIXA 1E2YA 6GSWA 4G2EA 4BPYA 2NVLA 4ZB9A 2C3TA 20GSA 2IWTA 3MWHA 5D96A 4BWQA 3WYWA 3UAPA 1TRSA 1W89A 4POMA 1X5DA 5DALB 4GSTA 2IL3A 5F06A 2RIIA 5IPGA 4GQFA 1R26A 5IMDA 2PUKC 1GRXA 1DUGA 4XRDA 4KW6A 2TRCP 3W8SA 3CRUA 4OD7A 3CRTA 1O85A 2AYTA 1GP1A 1G7OA 1XPVA 1WP0A 1F9MA 4FO5A 4HS1A 2XC2A 2NPBA 2YN1A 2WGRA 2H30A 1GTAA 1XIYA 4GRFA 4HEA2 1Z9HA 4AGSA 1SD8A 3GN3A 5EPFA 3EURA 4BL7A 3C1SA 3WGDA 3HYPA 5HQPA 1G6WA 3A5IA 2YANA 1OC9A 1U3IA 4L5LA 4KB3A 3LG6A 4TR1B 1SL1B 3TRPA 1ON4A 2VL9A 1ZCPA 3GTUB 3UVTA 3KP8A 1BJXA 1F3AA 2EIQA 2L5LA 2HRNA 2GDRA 1M2BA 1PD21 1FHEA 2CX3A 5B8BA 5GAPD 2KP2A 4K6XA 1XCCA 4RI6A 2HFDA 5HFIA 4HU9A 1XFLA 3VWUA 4F2IA 3VPQA 2AJQB 2LNTA 4FIWA 5G2ZA 4NHZA 1OKTA 2YZUA 1V57A 1DBYA 1SL2B 6GSXA 4QQ7A 3UL3A 1K0NA 3GKXA 4GLTA 2H01A 3TOUA 2L5OA 3W8JA 2AHEA 1SJIA 3DRNA 2ALBA 4LMVA 1EOHA 2BMXA 5HR3A 3GL3A 2YJ7A 1ZZYA 5ECNB 2V6OA 5D9VA 4IP6A 1TI3A 1UA5A 2H6ZA 1YKAA 5KN1A 2FLSA 4CY8A 1O7UA 4GF0A 4OO5A 5GSSA 4MZWA 1SU9A 4ZILA 3LYPA 2GT6A 3F63A 3GNJA 4MP4A 3RPPA 3LEFA 1EP8A 2LQQA 1M2AA 2VLUA 4LL4B 1H4OA 2B5XA 4JZQA 5JWQB 4FQUA 1ZYNA 2PVQA 2GLRA 1TJDA 2LV3A 1YZXA 2RM5A 4V2LA 3DVXA 4EKZA 2J9HA 4PUFC 3CMIA 4AJ7A 2B1KA 2I9HA 3TKQA 4HZ2A 4NPBA 3R3EA 3ZZXA 3G9BA 4Z2RA 4KDXA 3SBCA 1TRUA 1Z7PA 1QFNA 4EF0A 2NTOA 2JZTA 2MMZA 3LXTA 5JCUA 3ZVJD 4BL7B 4O5UA 3HDCA 1WPIA 2ZNMA 2QKEA 3A2XA 2YWOA 1ZYQB 4ZB6A 2CAIA 1TK8B 3M8NA 5G31A 4KCEA 3G7YA 2XHFA 4IP1A 4MZBA 3FRCA 4IW9A 1XWAA 1NSWA 5H5QA 4EL1A 2AV4A 4USSA 4MF5A 2R2JA 2VD1A 2K9FA 2C0EA 4FYUA 3KCMA 1FG4A 5E59A 3FZAA 4N30A 2VM2A 4X1UA 5DCHA 4AF2A 1M9BA 2GTUA 3CSJA 2B6MA 1K0CA 1EEJA 2IMEA 1RQMA 4YKFA 4PNFA 3GL5A 4MH3A 2MMOA 3M3MA 4I2TA 1EGRA 2VL3A 1O6JA 2GSSA 1WWJA 3FMWA 5CREA 1I9DA 2DMLA 5G1LA 3P8WA 1BX9A 1SK1A 3LW9A 4YKGA 4N0ZA 4JE1A 2P31A 1GSDA 3WT2A 5DQSA 1AQXA 3LGCA 4O32A 2PGTA 3WT1A 3F6FA 5L71A 1EV4A 2V1MA 1AUCA 4GWRA 3L0HA 4K2DA 5JCWA 2LQOA 1R5AA 3C1RA 2C4JA 5DVBA 2REMA 1SJZA 3QR6A 5KOXA 1BEDA 1ERUA 2A4VA 3ME8A 1HYUA 4ECJA 4ULXA 1BAYA 2WS2A 2H1GA 2DC5A 3JCML 1Z6MA 5CP1A 4HUAA 4NXIA 3J7Yb 3GYKA 3TKSE 1GSUA 3L9UA 4MCUA 2G2QA 4CHSA 3FW2A 1B9XC 3KGKA 5B7CA 4FYCA 1VRSD 4KSMA 3FR6A 2M80A 6GSTA 2H8LA 4MK3A 2JZSA 2YWNA 3D22A 16GSA 1S3CA 4L8EA 5DJMA 2H70A 3TJFA 5IMVA 4KE3A 4IJIA 1UN2A 2JSZA 2IMKA 3ZIJA 2R37A 2FA8A 6GSUA 1JFUA 4PQHA 5ECLB 2L4QA 5C04A 3QAWA 2QC7A 5A4WA 1FOVA 2CV4A 4XS1A 1LU4A 2OA7A 3KEBA 3UIWA 2E2GA 4WXTA 2L6DA 1SYRA 3IR4A 4WF5A 5FT3A 2V6KA 3E9JB 4POBA 2WDUA 1FOHA 2MYGA 4I97A 1MDIA 3ED3A 3MNGA 3DD3A 2N5BA 1LBKA 1GNWA 1PSQA 4DVCA 4WBRD 1GULA 5GZZB 1Q4JA 5IMAA 4PURA 3RHBA 1GTIA 4GCIA 4Q5FA 3F9UA 3VWVA 4PXOA 1NW2A 3EINA 2QA1A 4K0NA 5BMUA 2HRKA 2TRXA 3Q18A 3H1NA 2YJHA 3VURA 2H6XA 1FAAA 3GURA 2LEGA 3M1GA 3RPNA 1XXUA 4MJEA 5D9WA 2HNLA 2R0CA 4XRAA 3UMAA 4DSQA 4BVXB 4A5PA 3F4SA 4WETA 3F6DA 4QL7A 4DSSB 4PQIA 4POLA 3I9V2 2GQMA 3G7JA 4K7IA 2CZ3A 3FZ5A 1JHBA 4POKA 4GXZA 1GSEA 3F4RA 4V2NA 3GTUA 2KHPA 1HNBA 1WMJA 2H75A 1UVZA 2HLSA 1EV9A 4GSNA 3EWLA 4ECIA 5IOXA 4XHMA 4ML6A 4TOPA 2QGVA 2ZUPA 1RK4A 3LFLA 4ID0A 4F9ZA 2GS3A 3A2VA 2H0IA 6GSYA 2I81A 2MZCA 2C3QA 3WGEA 4I6XA 1XOBA 4TVEA 2ZCTA 3KM6A 2E0QA 1J0FA 2YZHA 3RHCA 2LRTA 1GUKA 1TXXA 4Z7XA 3VWWA 3BD2A 4MABA 3APOA 3TKSA 2HRFA 5J3RA 1T4YA 4JU5A 4YQMA 4L0WA 1AAZA 2RLIA 4ZIJA 2A4HA 3D4MA 2VCVA 2VLTA 4HZ4A 1F3BA 2HYXA 5EY6A 2HI7A 1GSFA 5KOWA 4NMUA 4N10A 2YNXA 3NZNA 2PWJA 4EXJA 1GLPA 4G0KA 1TK5B 5JCGA 3TJJA 3L78A 2L6CA 3BJ5A 4EDZA 1K3OA 4MDCA 2GT5A 3RDWA 1U3AA 2WFCA 18GSA 3D6IA 2C0DA 3FZ4A 2H73A 2X8HA 1XW9A 3UBLA 2EC4A 4N11A 2KOKA 4Z2TA 4J56E 2MBTA 2YWIA 2OBIA 4NV2A 2H19A 1GUMA 1WRYA 5ECKB 2DBCA 1K3LA 5IMFA 1TU8A 5LCZA 4G0IA 5IIZA 4K5SA 4MMMA 1OVNA 2IFQB 2DJ1A 1KEBA 2HSHA 5BRTA 1TTZA 1ZYEA 3A3TA 3EPTA 1B4QA 1ZYPA 1NHOA 3BOAA 4OCFA 4MH2A 2JL4A 4Q5RA 2FCHA 4WKWA 1T3BA 1AQWA 3AY8A 4D73A 3CSHA 3QMXA 2F51A 2OBKA 5DCGA 2DMMA 3KMNA 4FYBA 1PL2A 1K0DA 3GIXA 2GZZA 5DQYA 3TKRA 3ZMKA 2X8CA 2DIYA 1TW9A 3QFAC 3F8UA 1E6BA 3D4TA 3FR3A 4IBPA 1GNEA 4V1Ag 2VOCA 3U5RE 1TI1A 2OACA 5ENUA 3H93A 5AIVA 2X4AA 4IN0A 2X64A 3IA1A 3U6VA 5ECHB 5G30A 3H4KA 3O76A 2F8AA 3KIJA 4MPGA 4K0GA 5F8BA 5D9XA 3PGTA 4F0BA 2PVOC 2A2SA 4MLYA 2LSTA 1YKCA 4ZXGA 2VAFA 2H74A 2RUFA 1S3DA 2X49A 3ZVJA 2XBQA 1SD9A 2YV7A 2VLVA 5CRGA 5INYA 3LSZA 1XZOA 1OC3A 3IAS2 3MSZA 2H1AA 1EOGA 3HJMA 2LS5A 2XBIA 2JACA 4PQ1A 3TKSC 4OCEA 1Q98A 2H6YA 3FK8A 2HZEA 4OFTA 2LRNA 1OE8A 4G10A 4Q5NA 4ZBBA 4TXVA 3DXBA 5IO0A 3TOTA 3VI5A 4PX1A 3QDNA 4YAPA 1XWGA 1Z5YE 1X9MB 1GTUA 1VF4A 1FVKA 5DAKA 3TJGA 1TDIA 1RW1A 1FB0A 5ID2A 4BVYA 4DSRA 1PKWA 3L9SA 1QQ2A 3LQ7A 2JSYA 1SYXA 2DJ0A 3GA4A 1CQGA 4KSOA 3VLNA 4J57E 4OWYA 3HJOA 4G0LA 3N9JA 4LMWA 4EUYA 3IDVA 3QD9A 1VF1A 1XVWA 1PQNA 5AN1A 3LYKA 5JWRB 3I43A 3M0FA 4G9HA 4D73B 1W4VA 4YAVA 2BTOT 3R2QA 3ERGA 5H5SA 3ZFLA 4OO4A 5FHIA 1ERVA 9GSSA 2XPEA 4EVMA 2CQ9A 1YJ6A 3IHGA 5DJLA 3HZ8A 1ZOFA 2ON5A 4ILFA 2QSIA 4KAEA 2LJKA 2WZ9A 2R0PA 2VCWA 3VFIA 2P5RA 3RAZA 4RQRA 1PN0A 19GSA 4CW9A 1OAZA 2WB9A 2HZFA 5IM9A 4LLRA 2H1BA 5H5RA 3UEMA 17GSA 1IYIA 3LWAA 1ACVA 4X4JA 1PRXA 4XS6A 1XBSA 1V58A 1F6MC 2CVDA 2J23A 2B1LA 1U87A 3TB2A 3HHVA 1AIUA 2K8SA 4V2MA 3PR8A 4IQAA 1SJ6A 2VCQA 1UC7A 5AISA 3WD6A 4BVXA 3FKFA 5KN3A 4DSSA 5ECRB 1Z3EA 2HZEB 4MA9A 1V98A 4E8EA 1OC8A 2DLXA 2OE3A 4GTUA 2O89A 2VCZA 4XIHA 1BG5A 1SKSB 2HE3A 1NM3A 2O87A 3EC3A 4IHUA 2MBSA 5DAKB 2R6KA 5J4UA 2N5AA 5ID2B 4BVYB 4IELA 2PN8A 3IC4A 1EGOA 2R5GA 3Q74A 2OADA 2H76A 1AW9A 3ISOA 5IMCA 4QL9A 2H71A 2HT9A 2Z9SA 4HU7A 2A2RA 2ON7A 1EP7A 1YEXA 4LA1A 2YP6A 5HR0A 2HSMA 4IS0A 5ELAA 5J41A 4O7HA 5DDLA 5A4VA 1PKZA 2RUEA 2VL2A 1HD2A 5CO3A 3TRXA 5ECSA 1V2AA 2HSYA 4KF9A 4TKYA 1GUHA 1SK2A 4GQCA 2I4AA 3F0IA 2CZ2A 2V41A 5IMZA 1HNAA 2CT6A 2K18A 2DKHA 4OFNA 3P7XA 1QMVA 3DEXA 3KP9A 1S3AA 1THXA 2KUCA 3EVIA 5ABRA 3Q6OA 5A5KA 3ZITA 5A4UA 3P90A 4ZBAA 1X5EA 2WULA 2AB6A 5J5NA 3HD5A 2FA4A 3QFBC 4YH2A 4MZCA 2F3MA 4TR0A 2DJ2A 4F82A 3BCIA 1JLVA 1J08A 1EWXA 2GZPA 1K0OA 1URMA 3TGZA 3PH9A 3V1WA 1HQOA 4NHWA 4MJBA 1T00A 4NAXA 5COHA 5ECOB 2G0FA 1YQ1A 3O3TA 11GSA 4EC0A 1Y6EA 4KA0A 5CRWA 3GHAA 2IFQA 5LD0A 2F9SA 1BYEA 1FB6A 1N8JA 3N5OA 1A23A 1O8XA 2C8UA 5G5FA 4ZB8A 1B48A 1EEMA 2FWHA 1DE1A 1V9WA 2P0GA 2C3NA 3ZTLA 3S9FA 13GSA 1TK0B 4TR3A 2RM6A 2V32A 2DIZA 2IJYA 2EIOA 2C0GA 3TDGA 1PMTA 4KH7A 4EO3A 3CBUA 3FZ9A 4ECCA 1SL0B 1O8WA 2FGXA 4O92A 10GSA 1X9WB 3W6GA 3GX0A 4AJ8A 3ZLPA 3UARA 2OE1A 3IOSA 5J9BA 2LJAA 4N0VA 1GSQA 3HVXA 5AGYA 3ZREA 2CA8A 3VWXA 5D9TA 4V1Ap 3ZL5A 4EIPA 2MMNA 3GV1A 4TW5A 1LJRA 4LL1B 1PA3A 4PNGA 1GSYA 4WR4A 3TRQA 14GSA 2GQKA 4O5RA 1B9YC 3HVSA 2GQLA 3HA9A 3Q19A 4FH8A 1R4WA 1YF1A 3VI7A 5CYYA 1JLWA 3DMLA 4ICYA 5B6NA 2R4VA 3DVWA 4HQSA 2VUPA 3GX8A 4K9ZA 1MDJA 1SK0A 1A0FA 2EIRA 3GSTA 5CRDA 3UOMA 3NOFA 3DYRA 5ECMB 1YDKA 3L9VA 3GH9A 4JBBA 2VIMA 5G1KA 3D0ZA 2VL2C 4BWSA 1NHYA 3OR5A 4TN8A 1MDKA 1THOA 2R0GA 3F3QA 2KP1A 1OKDA 2PPTA 2M46A 4NWYA 2HXKA 1PGTA 4G19A 4H86A 5EL8A 3GUSA 1I5GA 2P5QA 4EE0A 2WJUA 4ECBA 2VO4A 3KZQA 1K3YA 2N5FA 3FEUA 5AIXA 1B4PA 22GSA 3IK7A 2NDOA 3ZMLA 3FR9A 1B8XA 5C00A 1OE7A 3VK9A 5ELGA 3TCOA 1JZRA 2H0HA 4HQZA 4BA7A 1ZMAA 5CNWA 1JZOA 1KBNA 3GH6A 5CRHA 5GAND 3MAKA 2NBSA 1CQHA 4IGJA 4MJCA 2B5YA 3O6TA 4AJ6A 1ZGNA 2CX4A 2FUG2 1YEPA 4K8MA 4IKHA 4HJMA 3KH7A 4XS4B 2H72A 4MF7A 4L0UA 1X9SB 7GSSA 3A2WA 4L5OA 1TOFA 4IJ3A 3GKNA 3LXZA 2H66A 5D93A 2LUSA 4PUAA 4Z2UA 1WIKA 1YF0A 1JZDA 3CYNA 4I5QA 2PMTA 4KDYA 5FWGA 5B8AA 3APSA 2DJKA 4PGTA 4ZL7A 1QK8A 2GSTA 3KTLA 1VF2A 3TUEA 3EYTA 5KN0A 3GMFA 3IBHA 3ZYWA 3HJPA 1SKWB 2LNSA 2YWMA 2TIRA 2DJJA 3IK9A 1MD4A 5E4WA 4RUVA 3TJKA 1O81A 2HRAA 2A2PA 2E2MA 1PX7A 1M0UA 1QGVA 3CTGA 4K7OA 5DBQA 4J2FA 5JWOB 1MD3A 4OMVA 4Q5QA 4K2XA 3GKKA 3IAM2 5J9CA 3KXOA 4HJ2A 3APQA 3HY2A 2H1DA 3KH9A 1MEKA 1M99A 4KX4A 4WEYA 4NV5A 1GTBA 1TRVA 3VPTA 1YY7A 4KNDA 5IQYA 3BCKA 4MJAA 5ECPB 2C1YA 1X5CA 3QAVA 3US3A 3HXSA 3UJ1A 1AQVA 1GWCA 4KGIA 3GKMA 1XW5A 1TKDB 3C73A 1U88A 3DKSA 3E0UA 3UBKA 4TR4A 4MPFA 1A2JA 4PTSA 1G0TA 1F37A 4TXOA 2VD0A 1DSBA 3UVHA 1FW1A 2I3YA 2L59A 3G7IA 3FY7A 4KUNA 2VCXA 3IHQA 4XTSA 1K0AA 2B5EA 3ZRDA 2GSRA 5EVOA 2PERA 2GZYA 3KD0A 3ERFA 4JRRA 4P3YB 1M9AA 1QXHA 1OC9B 1QUWA 2JU5A 1XWBA 2XPDA 2B3SA 1ST9A 1C72A 3ZFBA 4IVFA 1SKRB 3D21A 1IYHA 3I69A 4K5RA 5HFKA 2LKUA 2B7JA 2FD3A 3E3EA 3KMOA 1WE0A 2X8GA 4ZL9A 5IOWA 2YV9A 4F03A 3HVVA 3ERWA 3M9JA 1ILOA 4O5QA 1KNGA 2LTKA 2CVBA 1M7TA 4JR4A 4DEJA 3F3RA 3PPUA 3FHKA 2FWGA 1XVQA 4E8HA 1OYJA 1J9BA 5IO2A 1PL1A 1T7PB 1G7EA 1Z6NA 2E7PA 5F05A 3ME7A 1TRWA 1R7HA 2L4CA 1GLQA 4CY6A 2WCIA 3QCPA 3PINA 4K7NA 1Z7RA 2F8FA 3EMXA 3J7Yk 2D2ZA 4YQVA 1V40A 2C0FA 2IPAA 3BBYA 3D5JA 3F4TA 2K8VA 3GSSA 4MF6A 4RQXA 5GSTA 2MMAA 6GSSA 3RBTA 2GSQA 3DGQA 3C7MA 2FHEA 4MNNA 1FO5A 1X0RA 3IE3A 3QAGA 3FYGA 2OKAA 3H79A 4I2UA 3LORA 4EIQA 3EE2A 5KN2A 1K0BA 1JZWA 5B6MA 1M2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FWE A;  1KTE A;  2DSA A;  3CXG A;  3K8N A;  3CTF A;  5F07 A;  4TXO B;  3EU4 A;  3SWL A;  4WF4 A;  3KJY A;  5LNK e;  6GSV A;  1T4Z A;  2L57 A;  5D73 A;  3GRX A;  2FWF A;  3I6A A;  2GVP A;  4ZBD A;  1T1V A;  12GS A;  3QPM A;  4I8B A;  1XWC A;  1GH2 A;  3EMP A;  4KCA A;  4RI7 A;  2OJL A;  2YOI A;  1AC1 A;  1HNC A;  1O73 A;  1DE2 A;  2IIY A;  3P2A A;  5HR2 A;  1XWK A;  2IMI A;  1GL8 A;  1PX6 A;  1ERW A;  3H8Q A;  1BQ7 A;  2I1U A;  4HDE A;  4GSS A;  2O85 A;  1TP9 A;  2PBJ A;  2LRC A;  3DWV A;  4F0C A;  1K0M A;  5CAX A;  1F2E A;  2VM1 A;  2X99 A;  3C8E A;  4IQ1 A;  5HFG A;  1ERT A;  1XW6 A;  5D8I A;  3TKP A;  2O8V B;  2LJR A;  3CSI A;  4K1F A;  4OFM A;  1U6T A;  1XOA A;  4CDO A;  2KLX A;  5HR1 A;  4WBJ A;  3NIV A;  2B7K A;  2YCD A;  2K6V A;  5DAL A;  2AAW A;  3WGX A;  3IV4 A;  5F0G A;  3IXR A;  1T8E B;  4EDY A;  1ABA A;  2OE0 A;  3EU3 A;  3LJR A;  2JAD A;  4WR5 A;  1A8L A;  1A2M A;  2IN3 A;  4YQU A;  1PN9 A;  3GFK A;  2O7K A;  2JZR A;  1ML6 A;  1AXD A;  2IMD A;  1H75 A;  2FY6 A;  2WRT A;  1Y25 A;  4HI7 A;  2C80 A;  2IMF A;  4ISD A;  2VCT A;  4HOJ A;  1WOU A;  3TJB A;  4ML1 A;  1MTC A;  3ZIV A;  1A2L A;  2CAQ A;  5G5E A;  2M72 A;  1VGL A;  1A24 A;  4X43 A;  1R5P A;  2PU9 C;  2H0G A;  3MDK A;  5ECQ B;  3IPZ A;  4TR1 A;  1A8Y A;  1USB A;  5KEJ A;  5ECI B;  2GGT A;  4JED A;  2CVK A;  2YPM A;  4XS4 A;  1WJK A;  1FVJ A;  3HZ4 A;  3IRA A;  1EZK A;  2AUV A;  4XCS A;  5IPH A;  8GSS A;  3HCZ A;  2V2G A;  2ES7 A;  4X0X A;  3DIE A;  4JR6 A;  3L4N A;  4TRX A;  1GSS A;  1A0R P;  2DJ3 A;  3A5W A;  3HKR A;  1SEN A;  3M9K A;  1G6Y A;  2BJX A;  2FNO A;  3QOU A;  1N2A A;  2R3X A;  1ZL9 A;  4ZL8 A;  3KTB A;  4ACS A;  4KDU A;  1VF3 A;  3C71 A;  1TU7 A;  1E2Y A;  6GSW A;  4G2E A;  4BPY A;  2NVL A;  4ZB9 A;  2C3T A;  20GS A;  2IWT A;  3MWH A;  5D96 A;  4BWQ A;  3WYW A;  3UAP A;  1TRS A;  1W89 A;  4POM A;  1X5D A;  5DAL B;  4GST A;  2IL3 A;  5F06 A;  2RII A;  5IPG A;  4GQF A;  1R26 A;  5IMD A;  2PUK C;  1GRX A;  1DUG A;  4XRD A;  4KW6 A;  2TRC P;  3W8S A;  3CRU A;  4OD7 A;  3CRT A;  1O85 A;  2AYT A;  1GP1 A;  1G7O A;  1XPV A;  1WP0 A;  1F9M A;  4FO5 A;  4HS1 A;  2XC2 A;  2NPB A;  2YN1 A;  2WGR A;  2H30 A;  1GTA A;  1XIY A;  4GRF A;  4HEA 2;  1Z9H A;  4AGS A;  1SD8 A;  3GN3 A;  5EPF A;  3EUR A;  4BL7 A;  3C1S A;  3WGD A;  3HYP A;  5HQP A;  1G6W A;  2YAN A;  1OC9 A;  1U3I A;  4L5L A;  4KB3 A;  3LG6 A;  4TR1 B;  1SL1 B;  3TRP A;  1ON4 A;  2VL9 A;  1ZCP A;  3GTU B;  3UVT A;  3KP8 A;  1BJX A;  1F3A A;  2EIQ A;  2L5L A;  2HRN A;  2GDR A;  1M2B A;  1PD2 1;  1FHE A;  2CX3 A;  5B8B A;  5GAP D;  2KP2 A;  4K6X A;  1XCC A;  4RI6 A;  2HFD A;  5HFI A;  4HU9 A;  1XFL A;  3VWU A;  4F2I A;  3VPQ A;  2AJQ B;  2LNT A;  4FIW A;  5G2Z A;  4NHZ A;  1OKT A;  2YZU A;  1V57 A;  1DBY A;  1SL2 B;  6GSX A;  4QQ7 A;  3UL3 A;  1K0N A;  3GKX A;  4GLT A;  2H01 A;  3TOU A;  2L5O A;  3W8J A;  2AHE A;  1SJI A;  3DRN A;  2ALB A;  4LMV A;  1EOH A;  2BMX A;  5HR3 A;  3GL3 A;  2YJ7 A;  1ZZY A;  5ECN B;  2V6O A;  5D9V A;  4IP6 A;  1TI3 A;  1UA5 A;  2H6Z A;  1YKA A;  5KN1 A;  2FLS A;  1O7U A;  4GF0 A;  4OO5 A;  5GSS A;  4MZW A;  1SU9 A;  4ZIL A;  3LYP A;  2GT6 A;  3F63 A;  3GNJ A;  4MP4 A;  3RPP A;  3LEF A;  1EP8 A;  2LQQ A;  1M2A A;  2VLU A;  4LL4 B;  1H4O A;  2B5X A;  4JZQ A;  5JWQ B;  2PVQ A;  2GLR A;  1TJD A;  2LV3 A;  1YZX A;  2RM5 A;  4V2L A;  3DVX A;  4EKZ A;  2J9H A;  4PUF C;  3CMI A;  4AJ7 A;  2B1K A;  2I9H A;  3TKQ A;  4HZ2 A;  4NPB A;  3ZZX A;  3G9B A;  4KDX A;  3SBC A;  1TRU A;  1Z7P A;  1QFN A;  4EF0 A;  2NTO A;  2JZT A;  2MMZ A;  3LXT A;  5JCU A;  3ZVJ D;  3HDC A;  1WPI A;  2ZNM A;  2QKE A;  3A2X A;  2YWO A;  1ZYQ B;  4ZB6 A;  2CAI A;  1TK8 B;  3M8N A;  5G31 A;  4KCE A;  3G7Y A;  2XHF A;  4IP1 A;  4MZB A;  3FRC A;  4IW9 A;  1XWA A;  1NSW A;  5H5Q A;  4EL1 A;  2AV4 A;  4MF5 A;  2R2J A;  2VD1 A;  2K9F A;  2C0E A;  4FYU A;  3KCM A;  1FG4 A;  5E59 A;  3FZA A;  4N30 A;  2VM2 A;  4X1U A;  5DCH A;  4AF2 A;  1M9B A;  2GTU A;  3CSJ A;  2B6M A;  1K0C A;  1EEJ A;  2IME A;  1RQM A;  4PNF A;  3GL5 A;  4MH3 A;  2MMO A;  3M3M A;  4I2T A;  1EGR A;  2VL3 A;  1O6J A;  2GSS A;  1WWJ A;  5CRE A;  1I9D A;  2DML A;  5G1L A;  3P8W A;  1BX9 A;  1SK1 A;  4N0Z A;  4JE1 A;  2P31 A;  1GSD A;  3WT2 A;  5DQS A;  1AQX A;  3LGC A;  4O32 A;  2PGT A;  3WT1 A;  3F6F A;  5L71 A;  1EV4 A;  2V1M A;  1AUC A;  4GWR A;  3L0H A;  4K2D A;  5JCW A;  2LQO A;  1R5A A;  3C1R A;  2C4J A;  5DVB A;  2REM A;  1SJZ A;  3QR6 A;  1BED A;  1ERU A;  2A4V A;  3ME8 A;  1HYU A;  4ECJ A;  4ULX A;  1BAY A;  2WS2 A;  2H1G A;  2DC5 A;  3JCM L;  1Z6M A;  5CP1 A;  4HUA A;  4NXI A;  3J7Y b;  3GYK A;  3TKS E;  1GSU A;  3L9U A;  4MCU A;  2G2Q A;  4CHS A;  3FW2 A;  1B9X C;  3KGK A;  5B7C A;  4FYC A;  1VRS D;  4KSM A;  3FR6 A;  2M80 A;  6GST A;  2H8L A;  4MK3 A;  2JZS A;  2YWN A;  3D22 A;  16GS A;  1S3C A;  4L8E A;  5DJM A;  2H70 A;  3TJF A;  5IMV A;  4KE3 A;  4IJI A;  1UN2 A;  2JSZ A;  2IMK A;  3ZIJ A;  2R37 A;  2FA8 A;  6GSU A;  1JFU A;  4PQH A;  5ECL B;  2L4Q A;  5C04 A;  3QAW A;  2QC7 A;  5A4W A;  1FOV A;  2CV4 A;  4XS1 A;  1LU4 A;  2OA7 A;  3KEB A;  3UIW A;  2E2G A;  4WXT A;  2L6D A;  1SYR A;  3IR4 A;  4WF5 A;  5FT3 A;  2V6K A;  3E9J B;  4POB A;  2WDU A;  2MYG A;  4I97 A;  1MDI A;  3ED3 A;  3MNG A;  3DD3 A;  2N5B A;  1LBK A;  1GNW A;  1PSQ A;  4DVC A;  4WBR D;  1GUL A;  5GZZ B;  1Q4J A;  5IMA A;  4PUR A;  3RHB A;  1GTI A;  4GCI A;  4Q5F A;  3F9U A;  3VWV A;  4PXO A;  1NW2 A;  3EIN A;  4K0N A;  2TRX A;  3Q18 A;  3H1N A;  2YJH A;  3VUR A;  2H6X A;  1FAA A;  3GUR A;  2LEG A;  3M1G A;  3RPN A;  1XXU A;  4MJE A;  5D9W A;  2HNL A;  4XRA A;  3UMA A;  4DSQ A;  3F4S A;  4WET A;  3F6D A;  4QL7 A;  4DSS B;  4PQI A;  4POL A;  3I9V 2;  2GQM A;  3G7J A;  4K7I A;  2CZ3 A;  3FZ5 A;  1JHB A;  4POK A;  4GXZ A;  1GSE A;  3F4R A;  4V2N A;  3GTU A;  2KHP A;  1HNB A;  1WMJ A;  2H75 A;  1UVZ A;  2HLS A;  1EV9 A;  4GSN A;  3EWL A;  4ECI A;  5IOX A;  4XHM A;  4ML6 A;  4TOP A;  2QGV A;  2ZUP A;  1RK4 A;  3LFL A;  4ID0 A;  4F9Z A;  2GS3 A;  3A2V A;  2H0I A;  6GSY A;  2I81 A;  2MZC A;  2C3Q A;  3WGE A;  4I6X A;  1XOB A;  4TVE A;  2ZCT A;  3KM6 A;  2E0Q A;  1J0F A;  2YZH A;  3RHC A;  2LRT A;  1GUK A;  1TXX A;  4Z7X A;  3VWW A;  3BD2 A;  4MAB A;  3APO A;  3TKS A;  2HRF A;  5J3R A;  1T4Y A;  4JU5 A;  4YQM A;  4L0W A;  1AAZ A;  2RLI A;  4ZIJ A;  3D4M A;  2VCV A;  2VLT A;  4HZ4 A;  1F3B A;  2HYX A;  5EY6 A;  2HI7 A;  1GSF A;  4NMU A;  4N10 A;  2YNX A;  3NZN A;  2PWJ A;  4EXJ A;  1GLP A;  1TK5 B;  5JCG A;  3TJJ A;  3L78 A;  2L6C A;  3BJ5 A;  4EDZ A;  1K3O A;  4MDC A;  2GT5 A;  3RDW A;  1U3A A;  2WFC A;  18GS A;  3D6I A;  2C0D A;  3FZ4 A;  2H73 A;  2X8H A;  1XW9 A;  3UBL A;  2EC4 A;  4N11 A;  2KOK A;  4J56 E;  2MBT A;  2YWI A;  2OBI A;  4NV2 A;  2H19 A;  1GUM A;  1WRY A;  5ECK B;  2DBC A;  1K3L A;  5IMF A;  1TU8 A;  5LCZ A;  5IIZ A;  4MMM A;  1OVN A;  2IFQ B;  2DJ1 A;  1KEB A;  2HSH A;  1TTZ A;  1ZYE A;  3A3T A;  1B4Q A;  1NHO A;  3BOA A;  4OCF A;  4MH2 A;  2JL4 A;  4Q5R A;  2FCH A;  4WKW A;  1T3B A;  1AQW A;  3AY8 A;  4D73 A;  3CSH A;  3QMX A;  2F51 A;  2OBK A;  5DCG A;  2DMM A;  3KMN A;  4FYB A;  1PL2 A;  1K0D A;  3GIX A;  2GZZ A;  5DQY A;  3TKR A;  3ZMK A;  2X8C A;  2DIY A;  1TW9 A;  3QFA C;  3F8U A;  1E6B A;  3D4T A;  3FR3 A;  4IBP A;  1GNE A;  4V1A g;  2VOC A;  3U5R E;  1TI1 A;  2OAC A;  5ENU A;  3H93 A;  5AIV A;  4IN0 A;  2X64 A;  3IA1 A;  3U6V A;  5ECH B;  5G30 A;  3H4K A;  3O76 A;  2F8A A;  3KIJ A;  4MPG A;  4K0G A;  5F8B A;  5D9X A;  3PGT A;  4F0B A;  2PVO C;  2A2S A;  4MLY A;  2LST A;  1YKC A;  4ZXG A;  2VAF A;  2H74 A;  2RUF A;  1S3D A;  3ZVJ A;  2XBQ A;  1SD9 A;  2YV7 A;  2VLV A;  5CRG A;  5INY A;  3LSZ A;  1XZO A;  1OC3 A;  3IAS 2;  3MSZ A;  2H1A A;  1EOG A;  3HJM A;  2LS5 A;  2XBI A;  2JAC A;  4PQ1 A;  3TKS C;  4OCE A;  1Q98 A;  2H6Y A;  3FK8 A;  2HZE A;  4OFT A;  2LRN A;  1OE8 A;  4G10 A;  4Q5N A;  4ZBB A;  4TXV A;  3DXB A;  5IO0 A;  3TOT A;  3VI5 A;  4PX1 A;  3QDN A;  4YAP A;  1XWG A;  1Z5Y E;  1X9M B;  1GTU A;  1VF4 A;  1FVK A;  5DAK A;  3TJG A;  1TDI A;  1RW1 A;  1FB0 A;  5ID2 A;  4BVY A;  4DSR A;  1PKW A;  3L9S A;  1QQ2 A;  3LQ7 A;  2JSY A;  1SYX A;  2DJ0 A;  3GA4 A;  1CQG A;  4KSO A;  3VLN A;  4J57 E;  4OWY A;  3HJO A;  3N9J A;  4LMW A;  4EUY A;  3IDV A;  3QD9 A;  1VF1 A;  1XVW A;  1PQN A;  5AN1 A;  3LYK A;  5JWR B;  3I43 A;  3M0F A;  4G9H A;  4D73 B;  1W4V A;  4YAV A;  2BTO T;  3R2Q A;  3ERG A;  5H5S A;  3ZFL A;  4OO4 A;  5FHI A;  1ERV A;  9GSS A;  2XPE A;  4EVM A;  2CQ9 A;  1YJ6 A;  5DJL A;  3HZ8 A;  1ZOF A;  2ON5 A;  4ILF A;  2QSI A;  4KAE A;  2LJK A;  2WZ9 A;  2VCW A;  3VFI A;  2P5R A;  3RAZ A;  4RQR A;  19GS A;  4CW9 A;  1OAZ A;  2WB9 A;  2HZF A;  5IM9 A;  4LLR A;  2H1B A;  5H5R A;  3UEM A;  17GS A;  1IYI A;  3LWA A;  1ACV A;  1PRX A;  4XS6 A;  1XBS A;  1V58 A;  1F6M C;  2CVD A;  2J23 A;  2B1L A;  1U87 A;  3TB2 A;  3HHV A;  1AIU A;  2K8S A;  4V2M A;  3PR8 A;  4IQA A;  1SJ6 A;  2VCQ A;  1UC7 A;  5AIS A;  3WD6 A;  4BVX A;  3FKF A;  5KN3 A;  4DSS A;  5ECR B;  1Z3E A;  2HZE B;  4MA9 A;  1V98 A;  4E8E A;  1OC8 A;  2DLX A;  2OE3 A;  4GTU A;  2O89 A;  2VCZ A;  4XIH A;  1BG5 A;  1SKS B;  2HE3 A;  1NM3 A;  2O87 A;  3EC3 A;  4IHU A;  2MBS A;  5DAK B;  2R6K A;  5J4U A;  2N5A A;  5ID2 B;  4IEL A;  2PN8 A;  3IC4 A;  1EGO A;  2R5G A;  3Q74 A;  2OAD A;  2H76 A;  1AW9 A;  3ISO A;  5IMC A;  4QL9 A;  2H71 A;  2HT9 A;  2Z9S A;  4HU7 A;  2A2R A;  2ON7 A;  1EP7 A;  1YEX A;  4LA1 A;  2YP6 A;  5HR0 A;  4IS0 A;  5ELA A;  5J41 A;  4O7H A;  5DDL A;  5A4V A;  1PKZ A;  2RUE A;  2VL2 A;  1HD2 A;  5CO3 A;  3TRX A;  5ECS A;  1V2A A;  2HSY A;  4TKY A;  1GUH A;  1SK2 A;  4GQC A;  2I4A A;  3F0I A;  2CZ2 A;  2V41 A;  5IMZ A;  1HNA A;  2CT6 A;  2K18 A;  4OFN A;  3P7X A;  1QMV A;  3DEX A;  3KP9 A;  1S3A A;  1THX A;  2KUC A;  3EVI A;  5ABR A;  3Q6O A;  5A5K A;  3ZIT A;  5A4U A;  3P90 A;  4ZBA A;  1X5E A;  2WUL A;  2AB6 A;  5J5N A;  3HD5 A;  2FA4 A;  3QFB C;  4YH2 A;  4MZC A;  2F3M A;  4TR0 A;  2DJ2 A;  4F82 A;  3BCI A;  1JLV A;  1J08 A;  1EWX A;  2GZP A;  1K0O A;  1URM A;  3TGZ A;  3PH9 A;  3V1W A;  1HQO A;  4NHW A;  4MJB A;  1T00 A;  4NAX A;  5COH A;  5ECO B;  2G0F A;  1YQ1 A;  3O3T A;  11GS A;  4EC0 A;  1Y6E A;  4KA0 A;  5CRW A;  3GHA A;  2IFQ A;  5LD0 A;  2F9S A;  1BYE A;  1FB6 A;  1N8J A;  3N5O A;  1A23 A;  1O8X A;  2C8U A;  5G5F A;  4ZB8 A;  1B48 A;  1EEM A;  2FWH A;  1DE1 A;  1V9W A;  2P0G A;  2C3N A;  3ZTL A;  3S9F A;  13GS A;  1TK0 B;  4TR3 A;  2RM6 A;  2V32 A;  2DIZ A;  2IJY A;  2EIO A;  2C0G A;  3TDG A;  1PMT A;  4KH7 A;  4EO3 A;  3CBU A;  3FZ9 A;  4ECC A;  1SL0 B;  1O8W A;  2FGX A;  4O92 A;  10GS A;  1X9W B;  3W6G A;  3GX0 A;  4AJ8 A;  3ZLP A;  3UAR A;  2OE1 A;  3IOS A;  5J9B A;  2LJA A;  4N0V A;  1GSQ A;  3HVX A;  5AGY A;  3ZRE A;  2CA8 A;  3VWX A;  5D9T A;  4V1A p;  3ZL5 A;  2MMN A;  3GV1 A;  4TW5 A;  1LJR A;  4LL1 B;  1PA3 A;  4PNG A;  1GSY A;  4WR4 A;  3TRQ A;  14GS A;  2GQK A;  4O5R A;  1B9Y C;  3HVS A;  2GQL A;  3HA9 A;  3Q19 A;  4FH8 A;  1R4W A;  1YF1 A;  3VI7 A;  5CYY A;  1JLW A;  3DML A;  5B6N A;  2R4V A;  3DVW A;  4HQS A;  2VUP A;  3GX8 A;  4K9Z A;  1MDJ A;  1SK0 A;  1A0F A;  2EIR A;  3GST A;  5CRD A;  3UOM A;  3NOF A;  3DYR A;  5ECM B;  1YDK A;  3L9V A;  3GH9 A;  4JBB A;  2VIM A;  5G1K A;  3D0Z A;  2VL2 C;  4BWS A;  1NHY A;  3OR5 A;  4TN8 A;  1MDK A;  1THO A;  3F3Q A;  2KP1 A;  1OKD A;  2PPT A;  2M46 A;  4NWY A;  2HXK A;  1PGT A;  4G19 A;  4H86 A;  5EL8 A;  3GUS A;  1I5G A;  2P5Q A;  4EE0 A;  2WJU A;  4ECB A;  2VO4 A;  3KZQ A;  1K3Y A;  2N5F A;  3FEU A;  5AIX A;  1B4P A;  22GS A;  3IK7 A;  2NDO A;  3ZML A;  3FR9 A;  1B8X A;  5C00 A;  1OE7 A;  3VK9 A;  5ELG A;  3TCO A;  1JZR A;  2H0H A;  4HQZ A;  4BA7 A;  1ZMA A;  5CNW A;  1JZO A;  1KBN A;  3GH6 A;  5CRH A;  5GAN D;  3MAK A;  2NBS A;  1CQH A;  4IGJ A;  4MJC A;  2B5Y A;  3O6T A;  4AJ6 A;  1ZGN A;  2CX4 A;  2FUG 2;  1YEP A;  4K8M A;  4IKH A;  4HJM A;  3KH7 A;  4XS4 B;  2H72 A;  4MF7 A;  4L0U A;  1X9S B;  7GSS A;  3A2W A;  4L5O A;  1TOF A;  4IJ3 A;  3GKN A;  3LXZ A;  2H66 A;  5D93 A;  2LUS A;  4PUA A;  1WIK A;  1YF0 A;  1JZD A;  3CYN A;  4I5Q A;  2PMT A;  4KDY A;  5FWG A;  5B8A A;  3APS A;  2DJK A;  4PGT A;  4ZL7 A;  1QK8 A;  2GST A;  3KTL A;  1VF2 A;  3TUE A;  3EYT A;  5KN0 A;  3GMF A;  3IBH A;  3ZYW A;  3HJP A;  1SKW B;  2LNS A;  2YWM A;  2TIR A;  2DJJ A;  3IK9 A;  1MD4 A;  5E4W A;  4RUV A;  3TJK A;  1O81 A;  2E2M A;  1PX7 A;  1M0U A;  1QGV A;  3CTG A;  4K7O A;  5DBQ A;  4J2F A;  5JWO B;  1MD3 A;  4OMV A;  4Q5Q A;  3GKK A;  3IAM 2;  5J9C A;  3KXO A;  4HJ2 A;  3APQ A;  3HY2 A;  2H1D A;  3KH9 A;  1MEK A;  1M99 A;  4KX4 A;  4WEY A;  4NV5 A;  1GTB A;  1TRV A;  3VPT A;  1YY7 A;  4KND A;  5IQY A;  3BCK A;  4MJA A;  5ECP B;  2C1Y A;  1X5C A;  3QAV A;  3US3 A;  3HXS A;  3UJ1 A;  1AQV A;  1GWC A;  4KGI A;  3GKM A;  1XW5 A;  1TKD B;  3C73 A;  1U88 A;  3DKS A;  3E0U A;  3UBK A;  4TR4 A;  4MPF A;  1A2J A;  1G0T A;  1F37 A;  4TXO A;  2VD0 A;  1DSB A;  3UVH A;  1FW1 A;  2I3Y A;  2L59 A;  3G7I A;  3FY7 A;  4KUN A;  2VCX A;  3IHQ A;  4XTS A;  1K0A A;  2B5E A;  3ZRD A;  2GSR A;  5EVO A;  2PER A;  2GZY A;  3KD0 A;  3ERF A;  4JRR A;  4P3Y B;  1M9A A;  1QXH A;  1OC9 B;  1QUW A;  2JU5 A;  1XWB A;  2XPD A;  2B3S A;  1ST9 A;  1C72 A;  3ZFB A;  4IVF A;  1SKR B;  3D21 A;  1IYH A;  3I69 A;  5HFK A;  2LKU A;  2B7J A;  2FD3 A;  3E3E A;  3KMO A;  1WE0 A;  2X8G A;  4ZL9 A;  5IOW A;  2YV9 A;  4F03 A;  3HVV A;  3ERW A;  3M9J A;  1ILO A;  1KNG A;  2LTK A;  2CVB A;  1M7T A;  4JR4 A;  4DEJ A;  3F3R A;  3FHK A;  2FWG A;  1XVQ A;  4E8H A;  1OYJ A;  1J9B A;  5IO2 A;  1PL1 A;  1T7P B;  1G7E A;  1Z6N A;  2E7P A;  5F05 A;  3ME7 A;  1TRW A;  1R7H A;  2L4C A;  1GLQ A;  2WCI A;  3QCP A;  3PIN A;  4K7N A;  1Z7R A;  2F8F A;  3EMX A;  3J7Y k;  2D2Z A;  4YQV A;  1V40 A;  2C0F A;  2IPA A;  3BBY A;  3D5J A;  3F4T A;  2K8V A;  3GSS A;  4MF6 A;  4RQX A;  5GST A;  2MMA A;  6GSS A;  3RBT A;  2GSQ A;  3DGQ A;  3C7M A;  2FHE A;  1FO5 A;  1X0R A;  3IE3 A;  3QAG A;  3FYG A;  2OKA A;  3H79 A;  4I2U A;  3LOR A;  3EE2 A;  5KN2 A;  1K0B A;  1JZW A;  5B6M A;  1M2D A; 
#chains in the Genus database with same CATH topology
 2FWE A;  1KTE A;  2DSA A;  3CXG A;  3K8N A;  3CTF A;  5F07 A;  4TXO B;  3EU4 A;  3SWL A;  4WF4 A;  3KJY A;  5LNK e;  6GSV A;  1T4Z A;  2L57 A;  5D73 A;  3GRX A;  2FWF A;  3I6A A;  2GVP A;  4ZBD A;  1T1V A;  12GS A;  3QPM A;  4I8B A;  1XWC A;  1GH2 A;  3EMP A;  4KCA A;  4RI7 A;  2OJL A;  2YOI A;  1AC1 A;  1HNC A;  1O73 A;  1DE2 A;  2IIY A;  3P2A A;  5HR2 A;  1XWK A;  2IMI A;  1GL8 A;  1PX6 A;  1ERW A;  1XG8 A;  3H8Q A;  1BQ7 A;  2I1U A;  4HDE A;  4GSS A;  2O85 A;  1TP9 A;  2PBJ A;  2LRC A;  3DWV A;  4F0C A;  1K0M A;  5CAX A;  1F2E A;  2VM1 A;  2X99 A;  3C8E A;  4IQ1 A;  2DKI A;  1ERT A;  1XW6 A;  5D8I A;  5HFG A;  3TKP A;  2O8V B;  2LJR A;  3CSI A;  4K1F A;  4OFM A;  1U6T A;  1XOA A;  4CDO A;  2KLX A;  5HR1 A;  4WBJ A;  3NIV A;  2B7K A;  2YCD A;  2K6V A;  5DAL A;  2AAW A;  3WGX A;  3IV4 A;  5F0G A;  3IXR A;  1T8E B;  4EDY A;  1ABA A;  2OE0 A;  3EU3 A;  3LJR A;  2JAD A;  4WR5 A;  1A8L A;  1A2M A;  2IN3 A;  4YQU A;  1PN9 A;  3GFK A;  1M3I A;  2O7K A;  2JZR A;  1ML6 A;  3IC8 A;  1AXD A;  2IMD A;  1H75 A;  2FY6 A;  2WRT A;  1Y25 A;  4HI7 A;  2C80 A;  2IMF A;  4ISD A;  2VCT A;  4HOJ A;  1WOU A;  3TJB A;  4ML1 A;  1MTC A;  3ZIV A;  1A2L A;  2CAQ A;  5G5E A;  2M72 A;  1VGL A;  1A24 A;  4X43 A;  1R5P A;  2PU9 C;  2H0G A;  3MDK A;  5ECQ B;  3IPZ A;  4TR1 A;  1A8Y A;  1USB A;  5KEJ A;  5ECI B;  2GGT A;  4JED A;  2CVK A;  2YPM A;  4XS4 A;  1WJK A;  1FVJ A;  3HZ4 A;  3IRA A;  1EZK A;  2AUV A;  4XCS A;  5IPH A;  8GSS A;  3HCZ A;  2V2G A;  2ES7 A;  4X0X A;  3DIE A;  4JR6 A;  3L4N A;  4TRX A;  1GSS A;  1A0R P;  2DJ3 A;  3A5W A;  3HKR A;  3MYD A;  1SEN A;  3M9K A;  1G6Y A;  2BJX A;  2FNO A;  3QOU A;  1N2A A;  2QA2 A;  2R3X A;  1ZL9 A;  4ZL8 A;  3KTB A;  4ACS A;  4KDU A;  1VF3 A;  3C71 A;  2UZ8 A;  1TU7 A;  3MIX A;  1E2Y A;  6GSW A;  4G2E A;  4BPY A;  2NVL A;  4ZB9 A;  2C3T A;  20GS A;  2IWT A;  3MWH A;  5D96 A;  4BWQ A;  3WYW A;  3UAP A;  1TRS A;  1W89 A;  4POM A;  1X5D A;  5DAL B;  4GST A;  2IL3 A;  5F06 A;  2RII A;  5IPG A;  4GQF A;  1R26 A;  5IMD A;  2PUK C;  1GRX A;  1DUG A;  4XRD A;  4KW6 A;  2TRC P;  3W8S A;  3CRU A;  4OD7 A;  3CRT A;  1O85 A;  2AYT A;  1GP1 A;  1G7O A;  1XPV A;  1WP0 A;  1F9M A;  4FO5 A;  4HS1 A;  2XC2 A;  2NPB A;  2YN1 A;  2WGR A;  2H30 A;  1GTA A;  1XIY A;  4GRF A;  4HEA 2;  1Z9H A;  4AGS A;  1SD8 A;  3GN3 A;  5EPF A;  3EUR A;  4BL7 A;  3C1S A;  3WGD A;  3HYP A;  5HQP A;  1G6W A;  3A5I A;  2YAN A;  1OC9 A;  1U3I A;  4L5L A;  4KB3 A;  3LG6 A;  4TR1 B;  1SL1 B;  3TRP A;  1ON4 A;  2VL9 A;  1ZCP A;  3GTU B;  3UVT A;  3KP8 A;  1BJX A;  1F3A A;  2EIQ A;  2L5L A;  2HRN A;  2GDR A;  1M2B A;  1PD2 1;  1FHE A;  2CX3 A;  5B8B A;  5GAP D;  2KP2 A;  4K6X A;  1XCC A;  4RI6 A;  2HFD A;  5HFI A;  4HU9 A;  1XFL A;  3VWU A;  4F2I A;  3VPQ A;  2AJQ B;  2LNT A;  4FIW A;  5G2Z A;  4NHZ A;  1OKT A;  2YZU A;  1V57 A;  1DBY A;  1SL2 B;  6GSX A;  4QQ7 A;  3UL3 A;  1K0N A;  3GKX A;  4GLT A;  2H01 A;  3TOU A;  2L5O A;  3W8J A;  2AHE A;  1SJI A;  3DRN A;  2ALB A;  4LMV A;  1EOH A;  2BMX A;  5HR3 A;  3GL3 A;  2YJ7 A;  1ZZY A;  5ECN B;  2V6O A;  5D9V A;  4IP6 A;  1TI3 A;  1UA5 A;  2H6Z A;  1YKA A;  5KN1 A;  2FLS A;  4CY8 A;  1O7U A;  4GF0 A;  4OO5 A;  5GSS A;  4MZW A;  1SU9 A;  4ZIL A;  3LYP A;  2GT6 A;  3F63 A;  3GNJ A;  4MP4 A;  3RPP A;  3LEF A;  1EP8 A;  2LQQ A;  1M2A A;  2VLU A;  4LL4 B;  1H4O A;  2B5X A;  4JZQ A;  5JWQ B;  4FQU A;  1ZYN A;  2PVQ A;  2GLR A;  1TJD A;  2LV3 A;  1YZX A;  2RM5 A;  4V2L A;  3DVX A;  4EKZ A;  2J9H A;  4PUF C;  3CMI A;  4AJ7 A;  2B1K A;  2I9H A;  3TKQ A;  4HZ2 A;  4NPB A;  3R3E A;  3ZZX A;  3G9B A;  4Z2R A;  4KDX A;  3SBC A;  1TRU A;  1Z7P A;  1QFN A;  4EF0 A;  2NTO A;  2JZT A;  2MMZ A;  3LXT A;  5JCU A;  3ZVJ D;  4BL7 B;  4O5U A;  3HDC A;  1WPI A;  2ZNM A;  2QKE A;  3A2X A;  2YWO A;  1ZYQ B;  4ZB6 A;  2CAI A;  1TK8 B;  3M8N A;  5G31 A;  4KCE A;  3G7Y A;  2XHF A;  4IP1 A;  4MZB A;  3FRC A;  4IW9 A;  1XWA A;  1NSW A;  5H5Q A;  4EL1 A;  2AV4 A;  4USS A;  4MF5 A;  2R2J A;  2VD1 A;  2K9F A;  2C0E A;  4FYU A;  3KCM A;  1FG4 A;  5E59 A;  3FZA A;  4N30 A;  2VM2 A;  4X1U A;  5DCH A;  4AF2 A;  1M9B A;  2GTU A;  3CSJ A;  2B6M A;  1K0C A;  1EEJ A;  2IME A;  1RQM A;  4YKF A;  4PNF A;  3GL5 A;  4MH3 A;  2MMO A;  3M3M A;  4I2T A;  1EGR A;  2VL3 A;  1O6J A;  2GSS A;  1WWJ A;  3FMW A;  5CRE A;  1I9D A;  2DML A;  5G1L A;  3P8W A;  1BX9 A;  1SK1 A;  3LW9 A;  4YKG A;  4N0Z A;  4JE1 A;  2P31 A;  1GSD A;  3WT2 A;  5DQS A;  1AQX A;  3LGC A;  4O32 A;  2PGT A;  3WT1 A;  3F6F A;  5L71 A;  1EV4 A;  2V1M A;  1AUC A;  4GWR A;  3L0H A;  4K2D A;  5JCW A;  2LQO A;  1R5A A;  3C1R A;  2C4J A;  5DVB A;  2REM A;  1SJZ A;  3QR6 A;  5KOX A;  1BED A;  1ERU A;  2A4V A;  3ME8 A;  1HYU A;  4ECJ A;  4ULX A;  1BAY A;  2WS2 A;  2H1G A;  2DC5 A;  3JCM L;  1Z6M A;  5CP1 A;  4HUA A;  4NXI A;  3J7Y b;  3GYK A;  3TKS E;  1GSU A;  3L9U A;  4MCU A;  2G2Q A;  4CHS A;  3FW2 A;  1B9X C;  3KGK A;  5B7C A;  4FYC A;  1VRS D;  4KSM A;  3FR6 A;  2M80 A;  6GST A;  2H8L A;  4MK3 A;  2JZS A;  2YWN A;  3D22 A;  16GS A;  1S3C A;  4L8E A;  5DJM A;  2H70 A;  3TJF A;  5IMV A;  4KE3 A;  4IJI A;  1UN2 A;  2JSZ A;  2IMK A;  3ZIJ A;  2R37 A;  2FA8 A;  6GSU A;  1JFU A;  4PQH A;  5ECL B;  2L4Q A;  5C04 A;  3QAW A;  2QC7 A;  5A4W A;  1FOV A;  2CV4 A;  4XS1 A;  1LU4 A;  2OA7 A;  3KEB A;  3UIW A;  2E2G A;  4WXT A;  2L6D A;  1SYR A;  3IR4 A;  4WF5 A;  5FT3 A;  2V6K A;  3E9J B;  4POB A;  2WDU A;  1FOH A;  2MYG A;  4I97 A;  1MDI A;  3ED3 A;  3MNG A;  3DD3 A;  2N5B A;  1LBK A;  1GNW A;  1PSQ A;  4DVC A;  4WBR D;  1GUL A;  5GZZ B;  1Q4J A;  5IMA A;  4PUR A;  3RHB A;  1GTI A;  4GCI A;  4Q5F A;  3F9U A;  3VWV A;  4PXO A;  1NW2 A;  3EIN A;  2QA1 A;  4K0N A;  5BMU A;  2HRK A;  2TRX A;  3Q18 A;  3H1N A;  2YJH A;  3VUR A;  2H6X A;  1FAA A;  3GUR A;  2LEG A;  3M1G A;  3RPN A;  4BIK A;  1XXU A;  4MJE A;  5D9W A;  2HNL A;  2R0C A;  4XRA A;  3UMA A;  4DSQ A;  4BVX B;  4A5P A;  3F4S A;  4WET A;  3F6D A;  4QL7 A;  4DSS B;  4PQI A;  4POL A;  3I9V 2;  2GQM A;  3G7J A;  4K7I A;  2CZ3 A;  3FZ5 A;  1JHB A;  4POK A;  4GXZ A;  1GSE A;  3F4R A;  4V2N A;  3GTU A;  2KHP A;  1HNB A;  1WMJ A;  2H75 A;  1UVZ A;  2HLS A;  1EV9 A;  4GSN A;  3EWL A;  4ECI A;  5IOX A;  4XHM A;  4ML6 A;  4TOP A;  2QGV A;  2ZUP A;  1RK4 A;  3LFL A;  4ID0 A;  4F9Z A;  1PFO A;  2GS3 A;  3A2V A;  2H0I A;  6GSY A;  2I81 A;  2MZC A;  2C3Q A;  3WGE A;  4I6X A;  1XOB A;  4TVE A;  2ZCT A;  3KM6 A;  2E0Q A;  1J0F A;  2YZH A;  3RHC A;  2LRT A;  1GUK A;  1TXX A;  4Z7X A;  3VWW A;  3BD2 A;  4MAB A;  3APO A;  3TKS A;  2HRF A;  5J3R A;  1T4Y A;  4JU5 A;  4YQM A;  4L0W A;  1AAZ A;  2RLI A;  4ZIJ A;  2A4H A;  3D4M A;  2VCV A;  2VLT A;  4HZ4 A;  1F3B A;  2HYX A;  5EY6 A;  2HI7 A;  1GSF A;  5KOW A;  4NMU A;  4N10 A;  2YNX A;  3NZN A;  2PWJ A;  4EXJ A;  1GLP A;  4G0K A;  1TK5 B;  5JCG A;  3TJJ A;  3L78 A;  2L6C A;  3BJ5 A;  4EDZ A;  1K3O A;  4MDC A;  1M3J A;  2GT5 A;  3RDW A;  1U3A A;  2WFC A;  18GS A;  3D6I A;  2C0D A;  3FZ4 A;  2H73 A;  2X8H A;  1XW9 A;  3UBL A;  2EC4 A;  4N11 A;  2KOK A;  4Z2T A;  4J56 E;  2MBT A;  2YWI A;  2OBI A;  3CQF A;  4NV2 A;  2H19 A;  1GUM A;  1WRY A;  5ECK B;  2DBC A;  1K3L A;  5IMF A;  1TU8 A;  5LCZ A;  4G0I A;  5IIZ A;  4K5S A;  4MMM A;  1OVN A;  2IFQ B;  2DJ1 A;  1KEB A;  2HSH A;  5BRT A;  1TTZ A;  1ZYE A;  3A3T A;  3EPT A;  1B4Q A;  1ZYP A;  1NHO A;  3BOA A;  4OCF A;  4MH2 A;  2JL4 A;  4Q5R A;  2FCH A;  4WKW A;  1T3B A;  1AQW A;  3AY8 A;  4D73 A;  3CSH A;  3QMX A;  2F51 A;  2OBK A;  5DCG A;  2DMM A;  3KMN A;  4FYB A;  1PL2 A;  1K0D A;  3GIX A;  2GZZ A;  5DQY A;  3TKR A;  3ZMK A;  2X8C A;  2DIY A;  1TW9 A;  3QFA C;  3F8U A;  1E6B A;  3D4T A;  3FR3 A;  4IBP A;  1GNE A;  4V1A g;  2VOC A;  3U5R E;  1TI1 A;  2OAC A;  5ENU A;  3H93 A;  5AIV A;  2X4A A;  4IN0 A;  2X64 A;  3IA1 A;  3U6V A;  5ECH B;  5G30 A;  3H4K A;  3O76 A;  2F8A A;  3KIJ A;  4MPG A;  4K0G A;  5F8B A;  5D9X A;  3PGT A;  4F0B A;  2PVO C;  4HSC X;  2A2S A;  4MLY A;  2LST A;  1YKC A;  4ZXG A;  2VAF A;  2H74 A;  2RUF A;  1S3D A;  2X49 A;  3ZVJ A;  2XBQ A;  1SD9 A;  2YV7 A;  2VLV A;  5CRG A;  5INY A;  3LSZ A;  1XZO A;  1OC3 A;  3IAS 2;  3MSZ A;  2H1A A;  1EOG A;  3HJM A;  2LS5 A;  2XBI A;  2JAC A;  4PQ1 A;  3TKS C;  4OCE A;  1Q98 A;  2H6Y A;  3FK8 A;  2HZE A;  4OFT A;  2LRN A;  1OE8 A;  4G10 A;  4Q5N A;  4ZBB A;  4TXV A;  3DXB A;  5IO0 A;  3TOT A;  3VI5 A;  4PX1 A;  3QDN A;  4YAP A;  1XWG A;  1Z5Y E;  1X9M B;  1GTU A;  1VF4 A;  1FVK A;  3HVN A;  5DAK A;  1TDI A;  3TJG A;  1RW1 A;  1FB0 A;  5ID2 A;  4BVY A;  4DSR A;  1PKW A;  3L9S A;  1QQ2 A;  3LQ7 A;  2JSY A;  1SYX A;  2DJ0 A;  3GA4 A;  1CQG A;  4KSO A;  3VLN A;  4J57 E;  4OWY A;  3HJO A;  4G0L A;  3N9J A;  4LMW A;  4EUY A;  3IDV A;  3QD9 A;  1VF1 A;  1XVW A;  1PQN A;  5AN1 A;  3LYK A;  5JWR B;  3I43 A;  3M0F A;  4G9H A;  4D73 B;  1W4V A;  4YAV A;  2BTO T;  3R2Q A;  3ERG A;  5H5S A;  3ZFL A;  4OO4 A;  5FHI A;  1ERV A;  9GSS A;  2XPE A;  4EVM A;  2CQ9 A;  1YJ6 A;  3IHG A;  5DJL A;  3HZ8 A;  1ZOF A;  2ON5 A;  4ILF A;  2QSI A;  4KAE A;  2LJK A;  2WZ9 A;  2R0P A;  2VCW A;  3VFI A;  2P5R A;  3RAZ A;  4RQR A;  1PN0 A;  19GS A;  4CW9 A;  1OAZ A;  2WB9 A;  2HZF A;  5IM9 A;  4LLR A;  2H1B A;  5H5R A;  3UEM A;  17GS A;  1IYI A;  3LWA A;  1ACV A;  4X4J A;  1PRX A;  4XS6 A;  1XBS A;  1V58 A;  1F6M C;  2CVD A;  2J23 A;  2B1L A;  1U87 A;  3TB2 A;  3HHV A;  1AIU A;  2K8S A;  4V2M A;  3PR8 A;  4IQA A;  1SJ6 A;  2VCQ A;  1UC7 A;  5AIS A;  3WD6 A;  4BVX A;  3FKF A;  5KN3 A;  4DSS A;  5ECR B;  1Z3E A;  2HZE B;  4MA9 A;  1V98 A;  4E8E A;  1OC8 A;  2DLX A;  2OE3 A;  4GTU A;  2O89 A;  2VCZ A;  4XIH A;  1BG5 A;  1SKS B;  2HE3 A;  1NM3 A;  2O87 A;  3EC3 A;  4IHU A;  2MBS A;  5DAK B;  2R6K A;  5J4U A;  2N5A A;  5ID2 B;  4BVY B;  4IEL A;  2PN8 A;  3IC4 A;  1EGO A;  2R5G A;  3Q74 A;  2OAD A;  2H76 A;  1AW9 A;  3ISO A;  5IMC A;  4QL9 A;  2H71 A;  2HT9 A;  2Z9S A;  4HU7 A;  2A2R A;  2ON7 A;  1EP7 A;  1YEX A;  4LA1 A;  2YP6 A;  5HR0 A;  2HSM A;  4IS0 A;  5ELA A;  5J41 A;  4O7H A;  5DDL A;  5A4V A;  1PKZ A;  2RUE A;  2VL2 A;  1HD2 A;  5CO3 A;  3TRX A;  5ECS A;  1V2A A;  2HSY A;  4KF9 A;  4TKY A;  1GUH A;  1SK2 A;  4GQC A;  2I4A A;  3F0I A;  2CZ2 A;  2V41 A;  5IMZ A;  1HNA A;  2CT6 A;  2K18 A;  2DKH A;  4OFN A;  3P7X A;  1QMV A;  3DEX A;  3KP9 A;  1S3A A;  1THX A;  2KUC A;  3EVI A;  5ABR A;  3Q6O A;  5A5K A;  3ZIT A;  5A4U A;  3P90 A;  4ZBA A;  1X5E A;  2WUL A;  2AB6 A;  5J5N A;  3HD5 A;  2FA4 A;  3QFB C;  4YH2 A;  4MZC A;  2F3M A;  4TR0 A;  2DJ2 A;  4F82 A;  3BCI A;  1JLV A;  1J08 A;  1EWX A;  2GZP A;  1K0O A;  1URM A;  3TGZ A;  3PH9 A;  3V1W A;  1HQO A;  4NHW A;  4MJB A;  1T00 A;  4NAX A;  5COH A;  5ECO B;  2G0F A;  1YQ1 A;  3O3T A;  11GS A;  4EC0 A;  1Y6E A;  4KA0 A;  5CRW A;  3GHA A;  2IFQ A;  5LD0 A;  2F9S A;  1BYE A;  1FB6 A;  1N8J A;  3N5O A;  1A23 A;  1O8X A;  2C8U A;  5G5F A;  4ZB8 A;  1B48 A;  1EEM A;  2FWH A;  1DE1 A;  1V9W A;  2P0G A;  2C3N A;  3ZTL A;  3S9F A;  13GS A;  1TK0 B;  4TR3 A;  2RM6 A;  2V32 A;  2DIZ A;  2IJY A;  2EIO A;  2C0G A;  3TDG A;  1PMT A;  4KH7 A;  4EO3 A;  3CBU A;  3FZ9 A;  4ECC A;  1SL0 B;  1O8W A;  2FGX A;  4O92 A;  10GS A;  1X9W B;  3W6G A;  3GX0 A;  4AJ8 A;  3ZLP A;  3UAR A;  2OE1 A;  3IOS A;  5J9B A;  2LJA A;  4N0V A;  1GSQ A;  3HVX A;  5AGY A;  3ZRE A;  2CA8 A;  3VWX A;  5D9T A;  4V1A p;  3ZL5 A;  4EIP A;  2MMN A;  3GV1 A;  4TW5 A;  1LJR A;  4LL1 B;  1PA3 A;  4PNG A;  1GSY A;  4WR4 A;  3TRQ A;  14GS A;  2GQK A;  4O5R A;  1B9Y C;  3HVS A;  2GQL A;  3HA9 A;  3Q19 A;  4FH8 A;  1R4W A;  1YF1 A;  3VI7 A;  5CYY A;  1JLW A;  3DML A;  4ICY A;  5B6N A;  2R4V A;  3DVW A;  4HQS A;  2VUP A;  3GX8 A;  4K9Z A;  1MDJ A;  1SK0 A;  1A0F A;  2EIR A;  3GST A;  5CRD A;  3UOM A;  3NOF A;  3DYR A;  5ECM B;  1YDK A;  3L9V A;  3GH9 A;  4JBB A;  2VIM A;  5G1K A;  3D0Z A;  2VL2 C;  4BWS A;  1NHY A;  3OR5 A;  4TN8 A;  1MDK A;  1THO A;  2R0G A;  3F3Q A;  2KP1 A;  1OKD A;  2PPT A;  2M46 A;  4NWY A;  2HXK A;  1PGT A;  4G19 A;  4H86 A;  5EL8 A;  3GUS A;  1I5G A;  2P5Q A;  4EE0 A;  2WJU A;  4ECB A;  2VO4 A;  3KZQ A;  1K3Y A;  2N5F A;  3FEU A;  5AIX A;  1B4P A;  22GS A;  3IK7 A;  2NDO A;  3ZML A;  3FR9 A;  1B8X A;  5C00 A;  1OE7 A;  3VK9 A;  5ELG A;  3TCO A;  1JZR A;  2H0H A;  4HQZ A;  4BA7 A;  1ZMA A;  5CNW A;  1JZO A;  1KBN A;  3GH6 A;  5CRH A;  5GAN D;  3MAK A;  2NBS A;  1CQH A;  4IGJ A;  1S3R A;  4MJC A;  2B5Y A;  3O6T A;  4AJ6 A;  1ZGN A;  2CX4 A;  2FUG 2;  1YEP A;  4K8M A;  4IKH A;  4HJM A;  3KH7 A;  4XS4 B;  2H72 A;  4MF7 A;  4L0U A;  1X9S B;  7GSS A;  3A2W A;  4L5O A;  1TOF A;  4IJ3 A;  3GKN A;  3LXZ A;  2H66 A;  5D93 A;  2LUS A;  4PUA A;  4Z2U A;  1WIK A;  1YF0 A;  1JZD A;  3CYN A;  4I5Q A;  2PMT A;  4KDY A;  5FWG A;  5B8A A;  3APS A;  2DJK A;  4PGT A;  4ZL7 A;  1QK8 A;  2GST A;  3KTL A;  1VF2 A;  3TUE A;  3EYT A;  5KN0 A;  3GMF A;  3IBH A;  3ZYW A;  3HJP A;  1SKW B;  2LNS A;  2YWM A;  2TIR A;  2DJJ A;  3IK9 A;  1MD4 A;  5E4W A;  4RUV A;  3TJK A;  1O81 A;  2HRA A;  2A2P A;  2E2M A;  1PX7 A;  1M0U A;  1QGV A;  3CTG A;  4K7O A;  5DBQ A;  4J2F A;  5JWO B;  1MD3 A;  4OMV A;  4Q5Q A;  4K2X A;  3GKK A;  3IAM 2;  5J9C A;  3KXO A;  4HJ2 A;  3APQ A;  3HY2 A;  2H1D A;  3KH9 A;  1MEK A;  1M99 A;  4KX4 A;  4WEY A;  4NV5 A;  1GTB A;  1TRV A;  3VPT A;  1YY7 A;  4KND A;  5IQY A;  3BCK A;  4MJA A;  5ECP B;  2C1Y A;  1X5C A;  3QAV A;  3US3 A;  3HXS A;  3UJ1 A;  1AQV A;  1GWC A;  4KGI A;  3GKM A;  1XW5 A;  1TKD B;  3C73 A;  1U88 A;  3DKS A;  3E0U A;  3UBK A;  4TR4 A;  4MPF A;  1A2J A;  4PTS A;  1G0T A;  1F37 A;  4TXO A;  2VD0 A;  1DSB A;  3UVH A;  1FW1 A;  2I3Y A;  2L59 A;  3G7I A;  3FY7 A;  4KUN A;  2VCX A;  3IHQ A;  4XTS A;  1K0A A;  2B5E A;  3ZRD A;  2GSR A;  5EVO A;  2PER A;  2GZY A;  3KD0 A;  3ERF A;  4JRR A;  4P3Y B;  1M9A A;  1QXH A;  1OC9 B;  1QUW A;  2JU5 A;  1XWB A;  2XPD A;  2B3S A;  1ST9 A;  1C72 A;  3ZFB A;  4IVF A;  1SKR B;  3D21 A;  1IYH A;  3I69 A;  4K5R A;  5HFK A;  2LKU A;  2B7J A;  2FD3 A;  3E3E A;  3KMO A;  1WE0 A;  2X8G A;  4ZL9 A;  5IOW A;  2YV9 A;  4F03 A;  3HVV A;  3ERW A;  3M9J A;  1ILO A;  4O5Q A;  1KNG A;  2LTK A;  2CVB A;  1M7T A;  4JR4 A;  4DEJ A;  3F3R A;  3PPU A;  3FHK A;  2FWG A;  1XVQ A;  4E8H A;  1OYJ A;  1J9B A;  5IO2 A;  1PL1 A;  1T7P B;  1G7E A;  1Z6N A;  2E7P A;  5F05 A;  3ME7 A;  1TRW A;  1R7H A;  2L4C A;  1GLQ A;  4CY6 A;  2WCI A;  3QCP A;  3PIN A;  4K7N A;  1Z7R A;  2F8F A;  3EMX A;  3J7Y k;  2D2Z A;  4YQV A;  1V40 A;  2C0F A;  2IPA A;  3BBY A;  3D5J A;  3F4T A;  2K8V A;  3GSS A;  4MF6 A;  4RQX A;  5GST A;  2MMA A;  6GSS A;  3RBT A;  2GSQ A;  3DGQ A;  3C7M A;  2FHE A;  4MNN A;  1FO5 A;  1X0R A;  3IE3 A;  3QAG A;  3FYG A;  2OKA A;  3H79 A;  4I2U A;  3LOR A;  4EIQ A;  3EE2 A;  5KN2 A;  1K0B A;  1JZW A;  5B6M A;  1M2D A; 
#chains in the Genus database with same CATH homology
 2FWE A;  1KTE A;  2DSA A;  3CXG A;  3K8N A;  3CTF A;  5F07 A;  4TXO B;  3EU4 A;  3SWL A;  4WF4 A;  3KJY A;  5LNK e;  6GSV A;  1T4Z A;  2L57 A;  5D73 A;  3GRX A;  2FWF A;  3I6A A;  2GVP A;  4ZBD A;  1T1V A;  12GS A;  3QPM A;  4I8B A;  1XWC A;  1GH2 A;  3EMP A;  4KCA A;  4RI7 A;  2OJL A;  2YOI A;  1AC1 A;  1HNC A;  1O73 A;  1DE2 A;  2IIY A;  3P2A A;  5HR2 A;  1XWK A;  2IMI A;  1GL8 A;  1PX6 A;  1ERW A;  3H8Q A;  1BQ7 A;  2I1U A;  4HDE A;  4GSS A;  2O85 A;  1TP9 A;  2PBJ A;  2LRC A;  3DWV A;  4F0C A;  1K0M A;  5CAX A;  1F2E A;  2VM1 A;  2X99 A;  3C8E A;  4IQ1 A;  2DKI A;  1ERT A;  1XW6 A;  5D8I A;  5HFG A;  3TKP A;  2O8V B;  2LJR A;  3CSI A;  4K1F A;  4OFM A;  1U6T A;  1XOA A;  4CDO A;  2KLX A;  5HR1 A;  4WBJ A;  3NIV A;  2B7K A;  2YCD A;  2K6V A;  5DAL A;  2AAW A;  3WGX A;  3IV4 A;  5F0G A;  3IXR A;  1T8E B;  4EDY A;  1ABA A;  2OE0 A;  3EU3 A;  3LJR A;  2JAD A;  4WR5 A;  1A8L A;  1A2M A;  2IN3 A;  4YQU A;  1PN9 A;  3GFK A;  2O7K A;  2JZR A;  1ML6 A;  3IC8 A;  1AXD A;  2IMD A;  1H75 A;  2FY6 A;  2WRT A;  1Y25 A;  4HI7 A;  2C80 A;  2IMF A;  4ISD A;  2VCT A;  4HOJ A;  1WOU A;  3TJB A;  4ML1 A;  1MTC A;  3ZIV A;  1A2L A;  2CAQ A;  5G5E A;  2M72 A;  1VGL A;  1A24 A;  4X43 A;  1R5P A;  2PU9 C;  2H0G A;  3MDK A;  5ECQ B;  3IPZ A;  4TR1 A;  1A8Y A;  1USB A;  5KEJ A;  5ECI B;  2GGT A;  4JED A;  2CVK A;  2YPM A;  4XS4 A;  1WJK A;  1FVJ A;  3HZ4 A;  3IRA A;  1EZK A;  2AUV A;  4XCS A;  5IPH A;  8GSS A;  3HCZ A;  2V2G A;  2ES7 A;  4X0X A;  3DIE A;  4JR6 A;  3L4N A;  4TRX A;  1GSS A;  1A0R P;  2DJ3 A;  3A5W A;  3HKR A;  3MYD A;  1SEN A;  3M9K A;  1G6Y A;  2BJX A;  2FNO A;  3QOU A;  1N2A A;  2QA2 A;  2R3X A;  1ZL9 A;  4ZL8 A;  3KTB A;  4ACS A;  4KDU A;  1VF3 A;  3C71 A;  2UZ8 A;  1TU7 A;  3MIX A;  1E2Y A;  6GSW A;  4G2E A;  4BPY A;  2NVL A;  4ZB9 A;  2C3T A;  20GS A;  2IWT A;  3MWH A;  5D96 A;  4BWQ A;  3WYW A;  3UAP A;  1TRS A;  1W89 A;  4POM A;  1X5D A;  5DAL B;  4GST A;  2IL3 A;  5F06 A;  2RII A;  5IPG A;  4GQF A;  1R26 A;  5IMD A;  2PUK C;  1GRX A;  1DUG A;  4XRD A;  4KW6 A;  2TRC P;  3W8S A;  3CRU A;  4OD7 A;  3CRT A;  1O85 A;  2AYT A;  1GP1 A;  1G7O A;  1XPV A;  1WP0 A;  1F9M A;  4FO5 A;  4HS1 A;  2XC2 A;  2NPB A;  2YN1 A;  2WGR A;  2H30 A;  1GTA A;  1XIY A;  4GRF A;  4HEA 2;  1Z9H A;  4AGS A;  1SD8 A;  3GN3 A;  5EPF A;  3EUR A;  4BL7 A;  3C1S A;  3WGD A;  3HYP A;  5HQP A;  1G6W A;  3A5I A;  2YAN A;  1OC9 A;  1U3I A;  4L5L A;  4KB3 A;  3LG6 A;  4TR1 B;  1SL1 B;  3TRP A;  1ON4 A;  2VL9 A;  1ZCP A;  3GTU B;  3UVT A;  3KP8 A;  1BJX A;  1F3A A;  2EIQ A;  2L5L A;  2HRN A;  2GDR A;  1M2B A;  1PD2 1;  1FHE A;  2CX3 A;  5B8B A;  5GAP D;  2KP2 A;  4K6X A;  1XCC A;  4RI6 A;  2HFD A;  5HFI A;  4HU9 A;  1XFL A;  3VWU A;  4F2I A;  3VPQ A;  2AJQ B;  2LNT A;  4FIW A;  5G2Z A;  4NHZ A;  1OKT A;  2YZU A;  1V57 A;  1DBY A;  1SL2 B;  6GSX A;  4QQ7 A;  3UL3 A;  1K0N A;  3GKX A;  4GLT A;  2H01 A;  3TOU A;  2L5O A;  3W8J A;  2AHE A;  1SJI A;  3DRN A;  2ALB A;  4LMV A;  1EOH A;  2BMX A;  5HR3 A;  3GL3 A;  2YJ7 A;  1ZZY A;  5ECN B;  2V6O A;  5D9V A;  4IP6 A;  1TI3 A;  1UA5 A;  2H6Z A;  1YKA A;  5KN1 A;  2FLS A;  4CY8 A;  1O7U A;  4GF0 A;  4OO5 A;  5GSS A;  4MZW A;  1SU9 A;  4ZIL A;  3LYP A;  2GT6 A;  3F63 A;  3GNJ A;  4MP4 A;  3RPP A;  3LEF A;  1EP8 A;  2LQQ A;  1M2A A;  2VLU A;  4LL4 B;  1H4O A;  2B5X A;  4JZQ A;  5JWQ B;  4FQU A;  1ZYN A;  2PVQ A;  2GLR A;  1TJD A;  2LV3 A;  1YZX A;  2RM5 A;  4V2L A;  3DVX A;  4EKZ A;  2J9H A;  4PUF C;  3CMI A;  4AJ7 A;  2B1K A;  2I9H A;  3TKQ A;  4HZ2 A;  4NPB A;  3R3E A;  3ZZX A;  3G9B A;  4Z2R A;  4KDX A;  3SBC A;  1TRU A;  1Z7P A;  1QFN A;  4EF0 A;  2NTO A;  2JZT A;  2MMZ A;  3LXT A;  5JCU A;  3ZVJ D;  4BL7 B;  4O5U A;  3HDC A;  1WPI A;  2ZNM A;  2QKE A;  3A2X A;  2YWO A;  1ZYQ B;  4ZB6 A;  2CAI A;  1TK8 B;  3M8N A;  5G31 A;  4KCE A;  3G7Y A;  2XHF A;  4IP1 A;  4MZB A;  3FRC A;  4IW9 A;  1XWA A;  1NSW A;  5H5Q A;  4EL1 A;  2AV4 A;  4USS A;  4MF5 A;  2R2J A;  2VD1 A;  2K9F A;  2C0E A;  4FYU A;  3KCM A;  1FG4 A;  5E59 A;  3FZA A;  4N30 A;  2VM2 A;  4X1U A;  5DCH A;  4AF2 A;  1M9B A;  2GTU A;  3CSJ A;  2B6M A;  1K0C A;  1EEJ A;  2IME A;  1RQM A;  4YKF A;  4PNF A;  3GL5 A;  4MH3 A;  2MMO A;  3M3M A;  4I2T A;  1EGR A;  2VL3 A;  1O6J A;  2GSS A;  1WWJ A;  3FMW A;  5CRE A;  1I9D A;  2DML A;  5G1L A;  3P8W A;  1BX9 A;  1SK1 A;  3LW9 A;  4YKG A;  4N0Z A;  4JE1 A;  2P31 A;  1GSD A;  3WT2 A;  5DQS A;  1AQX A;  3LGC A;  4O32 A;  2PGT A;  3WT1 A;  3F6F A;  5L71 A;  1EV4 A;  2V1M A;  1AUC A;  4GWR A;  3L0H A;  4K2D A;  5JCW A;  2LQO A;  1R5A A;  3C1R A;  2C4J A;  5DVB A;  2REM A;  1SJZ A;  3QR6 A;  5KOX A;  1BED A;  1ERU A;  2A4V A;  3ME8 A;  1HYU A;  4ECJ A;  4ULX A;  1BAY A;  2WS2 A;  2H1G A;  2DC5 A;  3JCM L;  1Z6M A;  5CP1 A;  4HUA A;  4NXI A;  3J7Y b;  3GYK A;  3TKS E;  1GSU A;  3L9U A;  4MCU A;  2G2Q A;  4CHS A;  3FW2 A;  1B9X C;  3KGK A;  5B7C A;  4FYC A;  1VRS D;  4KSM A;  3FR6 A;  2M80 A;  6GST A;  2H8L A;  4MK3 A;  2JZS A;  2YWN A;  3D22 A;  16GS A;  1S3C A;  4L8E A;  5DJM A;  2H70 A;  3TJF A;  5IMV A;  4KE3 A;  4IJI A;  1UN2 A;  2JSZ A;  2IMK A;  3ZIJ A;  2R37 A;  2FA8 A;  6GSU A;  1JFU A;  4PQH A;  5ECL B;  2L4Q A;  5C04 A;  3QAW A;  2QC7 A;  5A4W A;  1FOV A;  2CV4 A;  4XS1 A;  1LU4 A;  2OA7 A;  3KEB A;  3UIW A;  2E2G A;  4WXT A;  2L6D A;  1SYR A;  3IR4 A;  4WF5 A;  5FT3 A;  2V6K A;  3E9J B;  4POB A;  2WDU A;  1FOH A;  2MYG A;  4I97 A;  1MDI A;  3ED3 A;  3MNG A;  3DD3 A;  2N5B A;  1LBK A;  1GNW A;  1PSQ A;  4DVC A;  4WBR D;  1GUL A;  5GZZ B;  1Q4J A;  5IMA A;  4PUR A;  3RHB A;  1GTI A;  4GCI A;  4Q5F A;  3F9U A;  3VWV A;  4PXO A;  1NW2 A;  3EIN A;  2QA1 A;  4K0N A;  5BMU A;  2HRK A;  2TRX A;  3Q18 A;  3H1N A;  2YJH A;  3VUR A;  2H6X A;  1FAA A;  3GUR A;  2LEG A;  3M1G A;  3RPN A;  1XXU A;  4MJE A;  5D9W A;  2HNL A;  2R0C A;  4XRA A;  3UMA A;  4DSQ A;  4BVX B;  4A5P A;  3F4S A;  4WET A;  3F6D A;  4QL7 A;  4DSS B;  4PQI A;  4POL A;  3I9V 2;  2GQM A;  3G7J A;  4K7I A;  2CZ3 A;  3FZ5 A;  1JHB A;  4POK A;  4GXZ A;  1GSE A;  3F4R A;  4V2N A;  3GTU A;  2KHP A;  1HNB A;  1WMJ A;  2H75 A;  1UVZ A;  2HLS A;  1EV9 A;  4GSN A;  3EWL A;  4ECI A;  5IOX A;  4XHM A;  4ML6 A;  4TOP A;  2QGV A;  2ZUP A;  1RK4 A;  3LFL A;  4ID0 A;  4F9Z A;  2GS3 A;  3A2V A;  2H0I A;  6GSY A;  2I81 A;  2MZC A;  2C3Q A;  3WGE A;  4I6X A;  1XOB A;  4TVE A;  2ZCT A;  3KM6 A;  2E0Q A;  1J0F A;  2YZH A;  3RHC A;  2LRT A;  1GUK A;  1TXX A;  4Z7X A;  3VWW A;  3BD2 A;  4MAB A;  3APO A;  3TKS A;  2HRF A;  5J3R A;  1T4Y A;  4JU5 A;  4YQM A;  4L0W A;  1AAZ A;  2RLI A;  4ZIJ A;  2A4H A;  3D4M A;  2VCV A;  2VLT A;  4HZ4 A;  1F3B A;  2HYX A;  5EY6 A;  2HI7 A;  1GSF A;  5KOW A;  4NMU A;  4N10 A;  2YNX A;  3NZN A;  2PWJ A;  4EXJ A;  1GLP A;  4G0K A;  1TK5 B;  5JCG A;  3TJJ A;  3L78 A;  2L6C A;  3BJ5 A;  4EDZ A;  1K3O A;  4MDC A;  2GT5 A;  3RDW A;  1U3A A;  2WFC A;  18GS A;  3D6I A;  2C0D A;  3FZ4 A;  2H73 A;  2X8H A;  1XW9 A;  3UBL A;  2EC4 A;  4N11 A;  2KOK A;  4Z2T A;  4J56 E;  2MBT A;  2YWI A;  2OBI A;  4NV2 A;  2H19 A;  1GUM A;  1WRY A;  5ECK B;  2DBC A;  1K3L A;  5IMF A;  1TU8 A;  5LCZ A;  4G0I A;  5IIZ A;  4K5S A;  4MMM A;  1OVN A;  2IFQ B;  2DJ1 A;  1KEB A;  2HSH A;  5BRT A;  1TTZ A;  1ZYE A;  3A3T A;  3EPT A;  1B4Q A;  1ZYP A;  1NHO A;  3BOA A;  4OCF A;  4MH2 A;  2JL4 A;  4Q5R A;  2FCH A;  4WKW A;  1T3B A;  1AQW A;  3AY8 A;  4D73 A;  3CSH A;  3QMX A;  2F51 A;  2OBK A;  5DCG A;  2DMM A;  3KMN A;  4FYB A;  1PL2 A;  1K0D A;  3GIX A;  2GZZ A;  5DQY A;  3TKR A;  3ZMK A;  2X8C A;  2DIY A;  1TW9 A;  3QFA C;  3F8U A;  1E6B A;  3D4T A;  3FR3 A;  4IBP A;  1GNE A;  4V1A g;  2VOC A;  3U5R E;  1TI1 A;  2OAC A;  5ENU A;  3H93 A;  5AIV A;  2X4A A;  4IN0 A;  2X64 A;  3IA1 A;  3U6V A;  5ECH B;  5G30 A;  3H4K A;  3O76 A;  2F8A A;  3KIJ A;  4MPG A;  4K0G A;  5F8B A;  5D9X A;  3PGT A;  4F0B A;  2PVO C;  2A2S A;  4MLY A;  2LST A;  1YKC A;  4ZXG A;  2VAF A;  2H74 A;  2RUF A;  1S3D A;  2X49 A;  3ZVJ A;  2XBQ A;  1SD9 A;  2YV7 A;  2VLV A;  5CRG A;  5INY A;  3LSZ A;  1XZO A;  1OC3 A;  3IAS 2;  3MSZ A;  2H1A A;  1EOG A;  3HJM A;  2LS5 A;  2XBI A;  2JAC A;  4PQ1 A;  3TKS C;  4OCE A;  1Q98 A;  2H6Y A;  3FK8 A;  2HZE A;  4OFT A;  2LRN A;  1OE8 A;  4G10 A;  4Q5N A;  4ZBB A;  4TXV A;  3DXB A;  5IO0 A;  3TOT A;  3VI5 A;  4PX1 A;  3QDN A;  4YAP A;  1XWG A;  1Z5Y E;  1X9M B;  1GTU A;  1VF4 A;  1FVK A;  5DAK A;  3TJG A;  1TDI A;  1RW1 A;  1FB0 A;  5ID2 A;  4BVY A;  4DSR A;  1PKW A;  3L9S A;  1QQ2 A;  3LQ7 A;  2JSY A;  1SYX A;  2DJ0 A;  3GA4 A;  1CQG A;  4KSO A;  3VLN A;  4J57 E;  4OWY A;  3HJO A;  4G0L A;  3N9J A;  4LMW A;  4EUY A;  3IDV A;  3QD9 A;  1VF1 A;  1XVW A;  1PQN A;  5AN1 A;  3LYK A;  5JWR B;  3I43 A;  3M0F A;  4G9H A;  4D73 B;  1W4V A;  4YAV A;  2BTO T;  3R2Q A;  3ERG A;  5H5S A;  3ZFL A;  4OO4 A;  5FHI A;  1ERV A;  9GSS A;  2XPE A;  4EVM A;  2CQ9 A;  1YJ6 A;  3IHG A;  5DJL A;  3HZ8 A;  1ZOF A;  2ON5 A;  4ILF A;  2QSI A;  4KAE A;  2LJK A;  2WZ9 A;  2R0P A;  2VCW A;  3VFI A;  2P5R A;  3RAZ A;  4RQR A;  1PN0 A;  19GS A;  4CW9 A;  1OAZ A;  2WB9 A;  2HZF A;  5IM9 A;  4LLR A;  2H1B A;  5H5R A;  3UEM A;  17GS A;  1IYI A;  3LWA A;  1ACV A;  4X4J A;  1PRX A;  4XS6 A;  1XBS A;  1V58 A;  1F6M C;  2CVD A;  2J23 A;  2B1L A;  1U87 A;  3TB2 A;  3HHV A;  1AIU A;  2K8S A;  4V2M A;  3PR8 A;  4IQA A;  1SJ6 A;  2VCQ A;  1UC7 A;  5AIS A;  3WD6 A;  4BVX A;  3FKF A;  5KN3 A;  4DSS A;  5ECR B;  1Z3E A;  2HZE B;  4MA9 A;  1V98 A;  4E8E A;  1OC8 A;  2DLX A;  2OE3 A;  4GTU A;  2O89 A;  2VCZ A;  4XIH A;  1BG5 A;  1SKS B;  2HE3 A;  1NM3 A;  2O87 A;  3EC3 A;  4IHU A;  2MBS A;  5DAK B;  2R6K A;  5J4U A;  2N5A A;  5ID2 B;  4BVY B;  4IEL A;  2PN8 A;  3IC4 A;  1EGO A;  2R5G A;  3Q74 A;  2OAD A;  2H76 A;  1AW9 A;  3ISO A;  5IMC A;  4QL9 A;  2H71 A;  2HT9 A;  2Z9S A;  4HU7 A;  2A2R A;  2ON7 A;  1EP7 A;  1YEX A;  4LA1 A;  2YP6 A;  5HR0 A;  2HSM A;  4IS0 A;  5ELA A;  5J41 A;  4O7H A;  5DDL A;  5A4V A;  1PKZ A;  2RUE A;  2VL2 A;  1HD2 A;  5CO3 A;  3TRX A;  5ECS A;  1V2A A;  2HSY A;  4KF9 A;  4TKY A;  1GUH A;  1SK2 A;  4GQC A;  2I4A A;  3F0I A;  2CZ2 A;  2V41 A;  5IMZ A;  1HNA A;  2CT6 A;  2K18 A;  2DKH A;  4OFN A;  3P7X A;  1QMV A;  3DEX A;  3KP9 A;  1S3A A;  1THX A;  2KUC A;  3EVI A;  5ABR A;  3Q6O A;  5A5K A;  3ZIT A;  5A4U A;  3P90 A;  4ZBA A;  1X5E A;  2WUL A;  2AB6 A;  5J5N A;  3HD5 A;  2FA4 A;  3QFB C;  4YH2 A;  4MZC A;  2F3M A;  4TR0 A;  2DJ2 A;  4F82 A;  3BCI A;  1JLV A;  1J08 A;  1EWX A;  2GZP A;  1K0O A;  1URM A;  3TGZ A;  3PH9 A;  3V1W A;  1HQO A;  4NHW A;  4MJB A;  1T00 A;  4NAX A;  5COH A;  5ECO B;  2G0F A;  1YQ1 A;  3O3T A;  11GS A;  4EC0 A;  1Y6E A;  4KA0 A;  5CRW A;  3GHA A;  2IFQ A;  5LD0 A;  2F9S A;  1BYE A;  1FB6 A;  1N8J A;  3N5O A;  1A23 A;  1O8X A;  2C8U A;  5G5F A;  4ZB8 A;  1B48 A;  1EEM A;  2FWH A;  1DE1 A;  1V9W A;  2P0G A;  2C3N A;  3ZTL A;  3S9F A;  13GS A;  1TK0 B;  4TR3 A;  2RM6 A;  2V32 A;  2DIZ A;  2IJY A;  2EIO A;  2C0G A;  3TDG A;  1PMT A;  4KH7 A;  4EO3 A;  3CBU A;  3FZ9 A;  4ECC A;  1SL0 B;  1O8W A;  2FGX A;  4O92 A;  10GS A;  1X9W B;  3W6G A;  3GX0 A;  4AJ8 A;  3ZLP A;  3UAR A;  2OE1 A;  3IOS A;  5J9B A;  2LJA A;  4N0V A;  1GSQ A;  3HVX A;  5AGY A;  3ZRE A;  2CA8 A;  3VWX A;  5D9T A;  4V1A p;  3ZL5 A;  4EIP A;  2MMN A;  3GV1 A;  4TW5 A;  1LJR A;  4LL1 B;  1PA3 A;  4PNG A;  1GSY A;  4WR4 A;  3TRQ A;  14GS A;  2GQK A;  4O5R A;  1B9Y C;  3HVS A;  2GQL A;  3HA9 A;  3Q19 A;  4FH8 A;  1R4W A;  1YF1 A;  3VI7 A;  5CYY A;  1JLW A;  3DML A;  4ICY A;  5B6N A;  2R4V A;  3DVW A;  4HQS A;  2VUP A;  3GX8 A;  4K9Z A;  1MDJ A;  1SK0 A;  1A0F A;  2EIR A;  3GST A;  5CRD A;  3UOM A;  3NOF A;  3DYR A;  5ECM B;  1YDK A;  3L9V A;  3GH9 A;  4JBB A;  2VIM A;  5G1K A;  3D0Z A;  2VL2 C;  4BWS A;  1NHY A;  3OR5 A;  4TN8 A;  1MDK A;  1THO A;  2R0G A;  3F3Q A;  2KP1 A;  1OKD A;  2PPT A;  2M46 A;  4NWY A;  2HXK A;  1PGT A;  4G19 A;  4H86 A;  5EL8 A;  3GUS A;  1I5G A;  2P5Q A;  4EE0 A;  2WJU A;  4ECB A;  2VO4 A;  3KZQ A;  1K3Y A;  2N5F A;  3FEU A;  5AIX A;  1B4P A;  22GS A;  3IK7 A;  2NDO A;  3ZML A;  3FR9 A;  1B8X A;  5C00 A;  1OE7 A;  3VK9 A;  5ELG A;  3TCO A;  1JZR A;  2H0H A;  4HQZ A;  4BA7 A;  1ZMA A;  5CNW A;  1JZO A;  1KBN A;  3GH6 A;  5CRH A;  5GAN D;  3MAK A;  2NBS A;  1CQH A;  4IGJ A;  4MJC A;  2B5Y A;  3O6T A;  4AJ6 A;  1ZGN A;  2CX4 A;  2FUG 2;  1YEP A;  4K8M A;  4IKH A;  4HJM A;  3KH7 A;  4XS4 B;  2H72 A;  4MF7 A;  4L0U A;  1X9S B;  7GSS A;  3A2W A;  4L5O A;  1TOF A;  4IJ3 A;  3GKN A;  3LXZ A;  2H66 A;  5D93 A;  2LUS A;  4PUA A;  4Z2U A;  1WIK A;  1YF0 A;  1JZD A;  3CYN A;  4I5Q A;  2PMT A;  4KDY A;  5FWG A;  5B8A A;  3APS A;  2DJK A;  4PGT A;  4ZL7 A;  1QK8 A;  2GST A;  3KTL A;  1VF2 A;  3TUE A;  3EYT A;  5KN0 A;  3GMF A;  3IBH A;  3ZYW A;  3HJP A;  1SKW B;  2LNS A;  2YWM A;  2TIR A;  2DJJ A;  3IK9 A;  1MD4 A;  5E4W A;  4RUV A;  3TJK A;  1O81 A;  2HRA A;  2A2P A;  2E2M A;  1PX7 A;  1M0U A;  1QGV A;  3CTG A;  4K7O A;  5DBQ A;  4J2F A;  5JWO B;  1MD3 A;  4OMV A;  4Q5Q A;  4K2X A;  3GKK A;  3IAM 2;  5J9C A;  3KXO A;  4HJ2 A;  3APQ A;  3HY2 A;  2H1D A;  3KH9 A;  1MEK A;  1M99 A;  4KX4 A;  4WEY A;  4NV5 A;  1GTB A;  1TRV A;  3VPT A;  1YY7 A;  4KND A;  5IQY A;  3BCK A;  4MJA A;  5ECP B;  2C1Y A;  1X5C A;  3QAV A;  3US3 A;  3HXS A;  3UJ1 A;  1AQV A;  1GWC A;  4KGI A;  3GKM A;  1XW5 A;  1TKD B;  3C73 A;  1U88 A;  3DKS A;  3E0U A;  3UBK A;  4TR4 A;  4MPF A;  1A2J A;  4PTS A;  1G0T A;  1F37 A;  4TXO A;  2VD0 A;  1DSB A;  3UVH A;  1FW1 A;  2I3Y A;  2L59 A;  3G7I A;  3FY7 A;  4KUN A;  2VCX A;  3IHQ A;  4XTS A;  1K0A A;  2B5E A;  3ZRD A;  2GSR A;  5EVO A;  2PER A;  2GZY A;  3KD0 A;  3ERF A;  4JRR A;  4P3Y B;  1M9A A;  1QXH A;  1OC9 B;  1QUW A;  2JU5 A;  1XWB A;  2XPD A;  2B3S A;  1ST9 A;  1C72 A;  3ZFB A;  4IVF A;  1SKR B;  3D21 A;  1IYH A;  3I69 A;  4K5R A;  5HFK A;  2LKU A;  2B7J A;  2FD3 A;  3E3E A;  3KMO A;  1WE0 A;  2X8G A;  4ZL9 A;  5IOW A;  2YV9 A;  4F03 A;  3HVV A;  3ERW A;  3M9J A;  1ILO A;  4O5Q A;  1KNG A;  2LTK A;  2CVB A;  1M7T A;  4JR4 A;  4DEJ A;  3F3R A;  3PPU A;  3FHK A;  2FWG A;  1XVQ A;  4E8H A;  1OYJ A;  1J9B A;  5IO2 A;  1PL1 A;  1T7P B;  1G7E A;  1Z6N A;  2E7P A;  5F05 A;  3ME7 A;  1TRW A;  1R7H A;  2L4C A;  1GLQ A;  4CY6 A;  2WCI A;  3QCP A;  3PIN A;  4K7N A;  1Z7R A;  2F8F A;  3EMX A;  3J7Y k;  2D2Z A;  4YQV A;  1V40 A;  2C0F A;  2IPA A;  3BBY A;  3D5J A;  3F4T A;  2K8V A;  3GSS A;  4MF6 A;  4RQX A;  5GST A;  2MMA A;  6GSS A;  3RBT A;  2GSQ A;  3DGQ A;  3C7M A;  2FHE A;  4MNN A;  1FO5 A;  1X0R A;  3IE3 A;  3QAG A;  3FYG A;  2OKA A;  3H79 A;  4I2U A;  3LOR A;  4EIQ A;  3EE2 A;  5KN2 A;  1K0B A;  1JZW A;  5B6M A;  1M2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...