2LRDA

The solution structure of the monomeric acanthaporin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
61
structure length
61
Chain Sequence
b'AMGKCSVLKKVACAAAIAGAVAACGGIDLPCVLAALKAAEGCASCFCEDHCHGVCKDLHLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acanthaporin
publication title Structure and function of a unique pore-forming protein from a pathogenic acanthamoeba.
pubmed doi rcsb
source organism Acanthamoeba culbertsoni
molecule tags Antimicrobial protein
total genus 14
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2012-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1840 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2lrdA00
2LREA 2LRDA
chains in the Genus database with same CATH superfamily
3E3VA 4HV5A 3OS0A 3KETA 1Z21A 2MD5A 1MSEC 3FM5A 2ZFUA 3FXKA 3S3MA 3ZGKA 1VI0A 3R6SA 4XRMA 2DXIA 3VYTB 3O6BB 4MFDA 5EGOA 1XSVA 3DU5A 3A02A 2DFFA 1VQPI 2LY9A 3HM5A 3TP3A 4CICA 1BC7C 4G9YA 4XSZF 4XQFA 2DFEA 1BC8C 2Z16A 3BR2A 2K86A 2E7XA 1BN5A 1GHCA 2CQQA 4ZH4F 2XB5A 2VE9A 1ZR2A 5L3DA 3RKQA 2NVYJ 2BV6A 2W7NA 4S04A 3COAC 1BW5A 1T2KA 2XAUA 3K70D 2VQCA 1A35A 3U21A 1D8JA 4XRSG 1GVJA 1OCPA 3ZR8X 1HW2A 1ENHA 4XICA 5HLTA 2IW5A 2EQRA 3IL2A 5F1JA 3I59B 5TJJA 2OD5A 2HYFA 3NAUA 3GXOA 5GAEJ 1R4NB 3H35A 4XM3A 3SDGA 2B7EA 2XB0X 1S6LA 4ZYGA 4R1HA 3HDDA 2QWWA 3V8LA 4XR6A 4Y17A 2ZMEB 1TZLA 2VQLA 1KU7A 3D5SC 3P9IA 1LPQA 2IRFG 1MNDA 3VYRB 1QVTA 2RDPA 2X6YA 4KT6A 5CQEA 3OYJA 2LY1A 4D7NA 3FXQA 2E1OA 3AG1H 3RTRA 5CKTA 5LBQA 1WI9A 3K2AA 2GIZA 5AIQA 4ASNA 5EF6A 3G1LA 1YITI 3GCMA 1TC3C 2VE8A 2KRFA 4U0VA 3CC4I 3N05A 4RB1A 3J7YJ 1XSXA 1B1BA 3S2DJ 4V2GA 4EJUA 1D0ZA 4HNVA 3LWFA 4RAGA 1Y6IA 5GP9A 2HVRA 3GFMA 4Y7NJ 1ZLJA 3V8JA 1FSEA 5DM7F 4U7BA 1C0WA 3EUHC 5FO5A 1KQ8A 1JGSA 2KHMA 1W5TA 2A6HF 2GQQA 3JW4A 4KN7X 1TQPA 1N78A 2FBIA 2MC3A 1WKMA 4HSTA 4HYEA 5B5EC 3HGGA 5DTDA 5M5XJ 4A3KJ 4A3BJ 2NOGA 4LK0F 4MFEA 3F22A 2IGOA 1BR2A 1QZEA 2F5DA 4XOTA 2JA5J 4EEFG 2XSJC 1BIAA 3CCSI 3IRQA 2DMQA 2LY2A 3EDPA 3ABTA 5FRMA 1U2WA 3TO7A 3I64A 2ECCA 1S7OA 5LHHA 1W4MA 2DAOA 3I56I 2DDAA 3KEOA 3V7SA 5HLIA 3HPGA 2VODA 4CA0A 4EGYA 4RAFA 3BJAA 4EATA 4C2TA 3HRSA 2EIJH 2KDZA 4E7SA 5LHGA 5FKOA 2LREA 5LD2C 2GLOA 3M4OJ 3SXYA 4E7HA 2GM4A 1BBYA 2UZKA 2QKMB 3JCUC 1WVRA 3HJEA 2NS0A 2W82A 2Z1DA 4UB6C 4L9VA 2M3AA 4XKCA 3LSMA 1A31A 1ZQ3P 3HRUA 1U3EM 5D5UB 4HX4A 2XKOA 4M74A 2WB1N 4BS9A 5F64A 4LFUA 1FOKA 1NTCA 3H92A 4HG2A 1FBUA 2DTRA 2ZO4A 2FQ4A 2OC6A 3DV8A 3PIPF 2XDVA 3EQLF 2Y9ZA 3ZP5A 3CLOA 5FGMA 3IH4A 3RPUA 2PI0A 4Y13A 1BW6A 5LRSA 1TWGJ 3HOTA 3A01B 4C3HJ 5IT3A 2LF7A 5IPAA 2Y31A 4JK1X 3V8KA 1G4DA 2MD0A 2AXLA 4AVPA 3VB2A 2OJED 4UUSA 2CUEA 4FE4A 1O3TA 2Q8KA 5HDKA 1J2XA 2LNBA 1HA8A 1K79A 3K4CA 3ONQA 2E71A 4F3QA 5J1RA 1RKTA 5BS6A 2R7VA 2W85A 4XSXF 4KITB 4MIMA 1LE8A 1QBJA 3DTEA 3CMAI 2WADA 5M5YJ 4DJAA 2QSHX 1UMQA 1V55H 4UV9A 2X6OA 2B0LA 1F5TA 2FSWA 1FJLA 4LLNA 5E8GA 3K9TA 2JK3A 5H6RA 3PO3J 2K4JA 3N4MA 3L9FA 2X1DA 2CFXA 2LKSA 3PL8A 3CCUI 2VKVA 1LB2A 5DCFA 4YIRX 3NARA 5FLVA 2YR2A 2ZKZA 1U8RA 2IJLA 1P2FA 2WAFA 1HQCA 3F9KA 1D1CA 2VLAA 4UHTA 1OYIA 4B4CA 5BQTA 4HRIA 1K6YA 3QRFF 5L3GA 2NAZA 3RI4A 4TV7A 1VQ6I 4FQGA 5BOXA 3OS1A 4RA2A 2E19A 3CJNA 3IV5A 2E2HJ 1Z6RA 1ZN2A 4AD9A 5E3NA 1RI7A 2XAFA 1FTZA 2RGVA 1UZCA 3OYAA 4AC0A 3W6KB 5EZGA 3MWMA 1I3QJ 3WG7H 1TW2A 3L1PA 5DDGA 3OMYA 2OU2A 1RC9A 3WTXC 2DFIA 4XLFA 3S15J 1USSA 4WWCA 3FWEA 1WSUA 1JT6A 1P4AA 2FUG2 2W84A 1ETWA 4BDZA 2HXIA 3HL2A 3TBIA 2GXAA 5K1YA 1YOVB 4HF2A 4YRVA 5ICFA 2O9LA 3EUHA 3U1DA 3ZQ7A 1VTNC 4IRIA 2QSFX 1IW7F 4DQ2A 3FHNA 2ZFWA 1IXCA 2UWMA 3PFIA 1ETYA 2JA6J 1F43A 2LVSA 2R7QA 3BG7A 1AWCA 4YIFA 3RYPA 5J8FA 4F7ZA 4D1QA 3RZDJ 3WTZA 5LHIA 1AHDP 1XC5A 2L5QA 3ZCOA 5JR3A 3BCBA 3LA3A 2X0LA 1H9TA 1U8BA 1SVOA 1ZR4A 5F1RA 2L7MP 4M3EA 4CCMA 4CYCB 4DYCA 1HXDA 5LLQA 3W2WA 5FB2A 3J7ZI 2EB7A 2W4SA 4BHCA 3OSGA 3A1YA 1OR7C 2EV0A 1ZAOA 1VQ9I 3GYHX 4CO8A 5KVRA 3WU1B 3NWTA 2B63J 3PM1A 2R0QC 2R5ZB 4MNUA 3QOPA 5L3BA 4L9TA 2CV1A 1IN8A 1YQAA 2FMYA 1R9TJ 2Y48A 3U9GA 3FXMA 1T39A 4X6AJ 1V5EA 3KP3A 1OCOH 2JSCA 3KP6A 1I3AA 4U88A 3F8CA 4MHGA 1EJ9A 2K9NA 1LDJA 1B72A 1YLFA 4KN4X 2PEXA 4I76A 3PSIA 1R1TA 2STTA 3QPHA 4QWQA 3TGNA 2H6BA 3RJPA 5BNGA 2VOPA 1IXRC 2F4OB 2V79A 3BC8A 2V4JC 3FIWA 1IV8A 2OQGA 2L9RA 3M1CA 2O0YA 2R7SA 3OR1C 2HKXA 2QUFA 3B6CA 1OFCX 2JMWA 5H6QA 5LEJA 1F9NA 1WH5A 4I09A 4J00A 3CJRB 1OYWA 2KZGA 5ERIA 5BPDA 1W7PA 5HNHA 3T1BA 2IAIA 3ERMA 3BJOA 4RS8A 4KFCA 4CXFA 1XD7A 1B8IB 1ETVA 3HOWJ 3JTGA 4V2FA 4LD5A 1ZRDA 2FEZA 5CLSA 2E1MB 4ZTJA 3BROA 3HHGA 4A3CJ 2R7WA 1SMTA 1FBQA 3L2CA 4ZYHA 2KIUA 3W6JB 4UUVA 2LFBA 2Z3YA 2R7ZJ 4RM3A 4ZDOA 4BEHB 5DUKA 3NQOA 1J0RA 2IVMA 4DYRA 3HUGB 2PJPA 3IC7A 3TQNA 2WC2A 2P5KA 1IF1A 2OTJI 3K4LA 1E3PA 2CV2A 2IGMA 2IS4A 1N77A 1Z77A 1A6IA 1FYLA 3CCYA 2OTLI 1Z7LA 2QQ8A 3JAMK 1N25A 2CG4A 3HZJA 3WTSC 4RGRA 1Z3XA 3HRMA 2P6TA 2VBXA 2R4GA 1ZTRA 3LSGA 1VNDA 1IC8A 4MEXF 1J9IA 2H6CA 4CYDA 3SQNA 2E7WA 2LH9A 2O5RA 4QPQA 4Z2YA 4A2UA 2W24A 3U2RA 1OKRA 1KYWA 4XKWA 1KZHA 2HOEA 4D9JA 4U7DA 3HOUJ 1CF7A 1GVDA 3BG9A 1PUFA 2ZJQF 2R5YA 3KYDB 4B3AA 1SVMA 2O3FA 3GTQJ 1U6GA 3LSIA 3JTHA 3I3LA 4XLHA 1FNNA 5M3FJ 1NG7A 2ETHA 2HQAA 1S7EA 4C9YA 3ZQIA 3AG4H 5IYDJ 1ZKGA 3KPHA 2BE5F 3GLLA 3K1NA 4L9NA 4A12A 1ZGJA 4YG2F 3SYTA 3I0TA 4XLNF 3MKYB 3I9V2 1U5TC 3IP4B 4HF1A 2H94A 3LFUA 5ILUA 1OR7A 1BR1A 3ASOH 2IP2A 2QQ9A 3ABKH 4ABZA 4FX4A 1YTYA 2YU9J 2VKDA 4A3MJ 3W6VA 2EZLA 1X4PA 1QHHD 2H8RA 2K40A 2XF5A 5DD8A 4KIFA 1R36A 3LAJA 2VUMJ 3ZQCA 2DK8A 1MBJA 3LA2A 3RQIA 1EH6A 4ZJZA 2JPBA 2Q0OA 1H8AC 2L2OA 2OV7A 2R7XA 1K4SA 2VBZA 4P5OA 3CCQI 3L00A 3ZRGA 1R22A 4A3LJ 2OQRA 1HKTA 5K7HA 2H09A 2CUJA 4BNCA 1MMSA 4EJTA 1HSJA 4LITA 4NB5A 3M7GA 4IX7A 3GTJJ 3WG9A 4M6VA 2QVOA 4I98B 1K7AA 2PBIA 4MTDA 4BY7J 1R1UA 4OMZA 2A3SA 1Y8QB 4PJ0C 5HOOA 2V6EA 2VXZA 2A07F 3J80K 3I59A 3D1NI 1QO0D 4I99C 1W7PD 2EFNA 5IOYA 3J7AO 3Q9SA 4OAZA 2F6CA 2IXSA 3G1MA 1OPCA 2ZMEA 1FEXA 3RZOJ 4PCQA 1ITYA 1Z7UA 1WGXA 3CP8A 2K27A 3OIOA 2XC7A 5BMZA 2EH3A 3QP6A 5EEHA 4ZYEA 2BY1A 2VB6A 2RREA 3IWFA 1K61A 3K10A 3HOXJ 1S9HA 1IZ1A 1CGPA 3LAPA 1WHUA 2DA7A 4DNCA 1IAWA 2DMTA 1XDUA 1FY7A 4AYBN 1G2HA 2A68F 2EINH 3CF2A 3OYBA 1SEUA 2HKOA 3DBRB 4I2OA 4HPQA 2F5VA 2W48A 3EUAA 1WCMJ 3FISA 3CJTB 2JVHA 3JREA 4OAYA 4HDUA 5J6XA 3DKXA 2PMHA 2V1XA 3O8GA 3GZNB 3BG3A 3ECHA 5B3SH 3RIRA 3HB9A 1VFCA 1V5GA 4B48A 3S1MJ 1T98A 3CO7C 5HLGA 2JPCA 2KMUA 1V3FA 2AO9A 4XRFA 2FRHA 2M0MA 2DDBA 2TRTA 3W2VA 2WAQA 1OLTA 2ZJ2A 3M8EA 3QU6A 2FF4A 3VWBA 1SD7A 1TTYA 2CQ7A 3AL0B 1YX3A 1PUEE 1K83J 2JZYA 1IN5A 1MBGA 4BDYA 1ZGWA 1R58A 2NNYA 4IHSA 1F36A 4EJWA 2BY0A 1SFEA 2Z99A 2M0CA 3L09A 4FETA 1V54H 2G0EA 2VPRA 4MLOA 4AIHA 2CV0A 2VQHA 4BE1A 4ZZLA 1YIOA 2KJBA 2P5VA 3RSNA 1KYZA 2HTSA 3U1KA 4UY8I 1VQ7I 3ZQQA 3ZPLA 4IOCF 2K3FA 4FE7A 1FYKA 3K1PA 2KQRA 4XN0A 5HDGA 5CPRB 3PNTA 5K5RA 1G3TA 3OYHA 2CGPA 2KLOA 4XK4A 3K2ZA 4RGSA 2EZIA 4A3IJ 1DPUA 3QODA 4H4KC 4IZZA 2DQRA 3S2WA 4XIDA 3K69A 3D5LA 3O8HA 2V1UA 3TDZC 3S1NJ 1IRZA 4B44A 3F72A 4RAYA 3K4JA 4IF4A 3JAMZ 2JA7J 1D1BA 3JRHA 3EETA 4OU0A 1Z91A 2O6GE 3A01A 2D1VA 1PJRA 3Q0WA 3X2QH 3HC7A 3ML6A 5GTHC 2HZTA 3MD2A 4A5MA 4IHTA 4A93J 4G8XA 4M3FA 1XCVA 3QPSA 3OYEA 1PP8F 1GLNA 2MABA 1LDKB 5A2QK 5ICCA 1FZPB 2LSOA 3E6BA 2RNJA 3OWTA 4E7IA 1DDNA 1IUYA 4IEJA 1MMGA 2CS3A 3F23A 3ZQFA 4DW6A 2YS9A 3GTGJ 3E1SA 3BLYA 1GT0C 2K9SA 4CCLA 4OIPF 3QAHA 1HDPA 3SZPA 4BHBA 4F52A 1T33A 2E1MC 1YFHA 2EK5A 1TT0A 1DU6A 1MGTA 2DMNA 3ISPA 1H88C 3KZIC 1RR7A 5J8CA 1YX5A 5D5VB 3DFGA 2JWTA 2WAEA 3BPVA 2H8WA 3VYUB 4LG3A 3ZOBA 4IQ4A 2EFWA 1LQ1A 1ON2A 2VT2A 2STWA 2QQBA 4FX0A 3PQJA 1Y8RB 3OR2C 4I7HA 3KFWX 1FWZA 4X0GA 3GZ6A 2ID6A 5JHUA 4KA4A 2IS2A 2M45A 4EM1A 2XRLA 2W00A 2DA2A 3L2UA 4RB3C 2L4AA 3HOVJ 3FXRA 3VDXA 1GXPA 3CD6I 3PUBA 1TW3A 1P4XA 2LK2A 3DXJF 1XTAA 3A4CA 5IY5H 4Y4RA 3GO5A 3K4KA 1WPKA 2M8GX 4L5EA 2DN0A 5J40A 4L5IA 4C2MJ 2ME0A 3IH2A 3QU3A 3DKYA 1UG2A 4OWRB 2L01A 1QZYA 4LG0B 4HOBA 4KT5C 1QPMA 4WK8F 2R3SA 1Z9CA 4A3JJ 1XS9A 4FT8A 5FLXK 3CTAA 1B6AA 1DGRM 2QEXI 4UB8C 4BUPA 4PGHA 3BG6A 4RDUA 3BTLA 3L2WA 1G59A 4Y33A 3TL4X 3AKZA 1UB9A 1FBSA 2JUGA 2HTJA 3J80Z 2DCEA 2KDOA 5AONA 1X19A 3RCOA 1T6SA 3LMMA 3QYFA 2EFPA 4BXUA 3RYRA 2Y30A 2XAQA 5E79C 1WJDA 4DBRA 1SFUA 1FOXA 4BQQA 1K6OA 4GO1A 1D1AA 3PNVA 3HTUA 4O3MA 4CYCA 3H36A 2BXZA 2NS8A 4G7ZF 1K78B 1VQMI 3CC7I 2ELHA 3FXLA 1TBXA 1FLIA 3VODA 3DPLC 2M30A 5E20A 2A61A 1R71A 3GTPJ 1Y1VJ 3OYCA 2VKEA 1B9MA 3GF2A 3OIQA 5IP6A 4OMYA 4KIBA 3TW6A 1TLHB 3GLXA 2M4KA 3L2VA 3HKZA 1MMDA 2R5ZA 1MJAA 2EV6A 2Q1ZB 4BE0A 2MLGA 1BM9A 1JHFA 4CUGA 1KA8A 3CCLI 2IEKA 3K4NA 5EDNA 2V26A 2XGXA 4KICA 3H3VK 4JP0A 3JSPA 2GOMA 3P5JA 1XPXA 2CRGA 4PSWA 1X1BA 1MNEA 1WJBA 2FD5A 4I0AA 4LLLA 2TCTA 1RESA 1LFPA 2E36A 2HQRA 2LYCA 2LOOA 2N8GA 4BKXA 3E0JB 2XV4S 1T0FA 2CH0A 4GYIA 1S7AA 2HVSA 5KHDA 3DTIA 2DK5A 2HOAA 1AU7A 2VC1A 3ABLH 3DQVC 3BZCA 4JX6A 2XRNA 1AKHB 2ZNYA 3K0LA 4N4OB 2L0KA 2RV8A 3OL4A 3CCRI 1XN7A 3BWGA 4UV8A 1ETOA 2HVQA 5E17F 2CO5A 3BTJA 2XUBA 1D5YA 1BI2A 2FJ1A 3OYIA 2DFHA 1FYMA 4RAZA 2M7BA 1R49A 1X4OA 4B3XA 2HZDA 1B8IA 3SJMA 3IKVA 4ON0A 2DMUA 4NNJA 3PNYA 3ZMUA 3TP0A 4PFPA 3BR5A 5HS8A 1A04A 1LUJB 5J1UA 5JLXA 3UNGC 1LNWA 1TNTA 2BVMA 2JQ7A 1YYVA 1SAXA 2O8KA 2LLKA 4ETSA 2X6WA 1T38A 4HX7A 4C2UA 3C2GA 4HW0A 2HFHA 3ESWB 4IPAA 3S16J 1R1VA 2WTEA 4BEHA 3J7AY 3CJQB 2R7DA 1T95A 4CZCA 1S3JA 3HUGA 1HC8A 2JA2A 4BL0B 9ANTA 3CP2A 3FHZA 1R5HA 1G3SA 4LLGF 2CYYA 5DM6F 4BQOA 5DV5A 4BAYA 1A6QA 3KEYA 3LSTA 1I27A 2FNAA 1P6RA 2QKLB 2JVGA 4BY1J 4A6DA 5M3MJ 3ZQLA 4HNUA 2K9MA 4ENMA 1ZK8A 5ED4A 2Z5UA 1W0UA 3CMYA 4E4HA 1G8XA 4PZJA 3B6AA 4HDVA 1HKQA 2E2JJ 2L02A 3RKYA 5C4XJ 1QNTA 2BW3B 1JUPA 5A2QZ 2K9LA 2PQ8A 2QYOA 4M9ZA 4PUSA 4AUXA 3NEUA 2CQNA 4OIQF 1RKWA 4EM2A 2DYSH 2XF6A 3AG2H 1R4MB 4Q4ZF 1FIPA 2V1DA 4RB0A 1TWAJ 1F1ZA 4CGZA 3I53A 2GA1A 3BR1A 3RDIA 2DT5A 3F8NA 3M1EA 4EJVA 1SD6A 1G3WA 4F93B 4A0XA 4I6ZA 1MMAA 3PQKA 1RIOH 1YJNI 3ELKA 1NK2P 2IS1A 3B73A 1HCRA 2ISYA 3S32A 4U0WA 4EMSA 3I54A 3S17J 1D5VA 2NRAC 2EIKH 1D0XA 4E7ZA 1A5JA 1IG7A 1Q1VA 3QOEA 1Z3YA 2XIGA 2UXNA 2AS5F 2HDWA 1RNLA 4GCVA 1T08B 3LL7A 3SEQA 1UHWA 2LKPA 3WTWC 3MKZA 3SEZA 2DODA 1X58A 1BOAA 4QIWN 2EIMH 4EM0B 4AIKA 4BJ5C 4XLEA 4HX8A 3H1CA 5FROA 4B47A 3JRAA 3CDIA 2K85A 2QQAA 5DS9A 5TGTA 4AM3A 4UVBA 2E60A 3FXOA 2EZKA 3DP7A 2PMUA 1GXQA 4I0BA 4PJMA 4IHXA 1KGSA 2JT1A 5AIPA 2XGEA 2X6XA 5K7FA 3H0DA 4XNFA 2WY7Q 2X1CA 2JSPA 3JRBA 1L0OC 2ICWG 2WBMA 3DTKA 3KYCB 4RGXA 4BE2A 4BXFA 2KKOA 5FLXZ 2XPWA 3RPUD 1WRJA 2OCCH 3R4KA 1VQOI 1BJZA 2BBYA 4C3JJ 3C18A 2ZNZA 2HU9A 2VASA 2CUZA 3KP5A 4GYGA 2BYVE 5CQGA 2KRCA 3S8PA 2R7UA 1I6XA 3G3ZA 4PSXA 5FRNA 1D8KA 4HQMA 3F8BA 4FISA 2XHKA 3OYMA 5IT9K 3M07A 1V4RA 3ZMTA 1PYVA 1I6HJ 3DCFA 1XSDA 1IN4A 2L4MA 2ZMEC 1TQMA 1ETXA 1I39A 5GPAA 4B09A 4F91B 5FKNA 3HGYA 1H9GA 4IOAF 2DYRH 3GW2A 2RC4A 4P9UA 4GXOA 1HW5A 3H9JA 3Q9VA 2Y0SA 1P92A 4H0EA 2P4WA 2LP0A 3S14J 4WX9A 1RRJA 2HDCA 2HOTA 2D45A 4FASD 1K4TA 5E8IA 3MVPA 3MZYA 1WJCA 2F5FA 5D8LB 2MYSA 4F92B 3LQQA 5D4RA 2NVUB 2DPDA 2H27A 1JTYA 3L7WA 3G4SI 5DD4A 4WXCA 3OYDA 3K1MA 2IA0A 1SFKA 4ESBA 5KCMA 2QENA 3WU2C 2M87A 4P9FA 4LB5A 2JJ7A 1GUUA 1X2NA 4EQQA 4E70A 1XMKA 1I50J 3OYGA 2CQXA 3E97A 5DEQA 4XONA 5EYRA 2ACJA 1Y0NA 2HS5A 1IDZA 2FXAA 1AA7A 1S29A 5D6EA 4BGDA 3SFZA 2OZUA 1J75A 2I8DA 1ZG5A 5F0CA 1WJAA 5D5WB 2DJIA 1YHQI 1WQ2A 2M34A 1SMYF 4RM2A 2V7FA 2PMZA 2X9DA 2MFZA 1KU3A 1UFMA 2F5CA 1MBFA 2CW0F 1JKPC 2R7FA 1DP7P 4XN3A 2VJJA 1YIJI 3MN2A 4JOMA 2QSGX 3H3UA 3DBHB 3QPTA 3UKGA 3V7CA 5EZHA 3G71I 4IHYA 2YX7A 4BJ6C 4FCYA 2JA8J 4M3BA 3OYFA 2E2IJ 3IH3A 4EV0A 1TP4A 3F6OA 4XORA 2OA4A 2VIXA 5E18F 4HBLA 1USTA 1W36C 3EYIA 5ICGA 4HA8A 3DEWA 1BL0A 3C2HA 3DEUA 3S2HJ 1GV2A 2HEOA 3LSRA 2K7LA 2F4IA 1R00A 5ILVA 3MZ8A 3LNQA 2K02A 2RNGA 3CESA 1O3SA 2A6EF 3CO6C 2NNNA 2VONA 4HSRA 3HXLA 4PJNA 3BTIA 1O57A 2KIQA 2ZCWA 1ZARA 3T0YA 1S8NA 2UXXA 3MFKA 4P1WA 2A69F 1REPC 1HOMA 4M3DA 5D6FA 3JRGA 2EJRA 3N97A 3OYLA 3IHUA 3KP4A 1WJFA 2X85A 1UAAA 2JUCA 1WJ5A 2O03A 2LF8A 2ZC2A 5F0FA 2ESNA 2KRHA 3L2QA 4QPOA 1JJ6C 2DW4A 1AOYA 2X51A 1J5YA 4S05A 3HG9A 1IUFA 2DT7B 3BG5A 3KLNA 2FOKA 2DO7A 5CVVA 5DCMB 3ASNH 3I55I 3GX4X 2EA2A 2V1NA 3O2PE 1YS6A 3R0JA 5H2FC 5IYCJ 5TRDA 2BVLA 2XGDA 3KCCA 1Y56A 3W2AA 1IRGA 3F21A 1IN7A 3HOYJ 1V5FA 1YW8A 2K9QA 3TO9A 1U9NA 3BCAA 3BZ6A 4A0YA 2DJNA 3H5RA 1Y1WJ 3V4GA 5LFAA 1MNMC 2E1NA 1ZREA 4G6TB 4B8XA 1SFOJ 4XKBA 4WXDA 2PG4A 1HBXG 2M8EA 1BI0A 4C3IJ 3KIOA 1UJ8A 1XCBA 1BIBA 3QQAA 4BQNA 2HXOA 2HWVA 4CZZA 4Z6YA 3EPZA 1OCZH 2HPIA 4LB6B 1Z1DA 3BTCA 5FKKA 3IWZA 1J09A 1XGSA 4ENKA 2Y0MA 4IVNA 1IN6A 5E3MA 5KNLA 3EUKL 4D7MA 4I01A 1RZ4A 2F5EA 4YIIA 3S93A 2L9VA 4G7HF 1RUOA 1F4KA 3ZMZA 3FMQA 2H1KA 4A5NA 2CSOA 3LOCA 3I4PA 1NH3A 4JX5A 4AWXB 3FXUA 3BQZA 2LBFB 3ROUA 1RETA 3TOAA 1FTTA 4UNOA 1P9QC 1H89C 1U0JA 4KMFA 5J47A 3HPHA 3IAS2 3G2BA 4IRHA 2GXBA 1LJ9A 2PJRB 3P9CA 1HDDC 2W57A 3FDYA 5ILSA 5JLWA 2X1EA 1JT0A 2ZJRF 4LG0A 2ZSIB 2RVCA 3WE3A 1D3YA 1MJ9A 2WAQN 2EZHA 4OIRF 3ZN0A 2E35A 3VEPA 2K3PA 4XLPF 2P5LC 1JGGA 4J19A 4I02A 5L3EA 3IAM2 5TISC 2ESHA 5F08A 3FMRA 4PJLA 2FBHA 1EKEA 1W1WE 1E0EA 5FLMJ 5GADJ 1ZHFA 2CUFA 4UVCA 5IT9Z 2QZ8A 4Y3OA 3I4NJ 1FX7A 2KFDA 3VSLA 5C3EJ 1BA5A 5FJ8J 4HQEA 4C30A 1NG6A 2V6CA 3WE2A 2LTPA 4J01A 3RKWA 2CFOA 2R7TA 4JQFA 1KQ0A 3BZKA 2FU4A 1H0MA 1K78A 1X3WB 2ELJA 1FT9A 3ZMVA 5CVIA 2Q2EB 2ZBKA 4BQAA 2XPVA 4L9JA 3TW7A 3CDHA 4IQJA 1EF4A 3K4BA 2A6TA 3V42A 2BEOA 2NS7A 1ETQA 3GZ5A 4A3FJ 4DIQA 3WHCA 1QU3A 3CLQA 2BY2A 1MBKA 2O7OA 3PO2J 5B1BH 1FOWA 5K5OA 3CCMI 1EH8A 2CW7A 2E5ZA 4R8HA 4HLYA 3WTTC 4N0BA 1KU9A 2KIFA 1IJWC 1TQIA 2Z33A 2OBPA 3G1OA 4HNTA 4IHVA 1X2MA 5LEKA 3FK7A 1HSTA 3IKTA 1T0FC 1DP3A 3PJRA 2VQGA 1LVAA 3S3NA 2WV1A 1POGA 4ENNA 2IT0A 3CCJI 4KISA 2L7KA 1JUMA 1P4WA 2FA5A 1MBEA 5B66C 1P7JA 2BGCA 2TDXA 3KZYA 5GPCA 4NQWB 1T8IA 2L7FP 2YSRA 4KJZA 1AKHA 2V9KA 4O6JA 4A3GJ 4X1EA 1Q1HA 2E1CA 3GTLJ 5HNFA 3DWLE 3E5XA 3GFLA 3FF5A 2QLZA 3K6GA 4M6XA 5EG0B 2V9PA 1W5CC 3MMYB 4N4NB 3WODF 4JBAA 4DGWB 1O7LA 2EA4A 4WF2A 3JSOA 1N75A 2NYXA 3I71A 3HSEA 4R79A 2DA6A 3S3OA 3PIOF 2DA3A 4PFOA 5CJ9A 1MDMB 3CUOA 4GDFA 1UG0A 4RGUA 2DT6A 1UHSA 2MC4A 1ORKA 2QGUA 4GRIA 1OJLA 1WZ2A 5E1WA 2DOFA 2ISZA 3TO6A 3Q0VA 5CVRA 3A0BC 3M9AA 3OOPA 4CCKA 1X1DA 4A0ZA 4MGRA 2O61A 2GWRA 2VOOA 5GAGJ 1R7JA 1JJ8C 4P96A 2MH2A 1JXSA 1R5ID 4CH7A 4BBSJ 2ELKA 2KPMA 1MJBA 3GMEA 4QLCU 4M72A 4G7OF 2H1LA 1IGNA 2QBYB 3CQZJ 3ECOA 5KK1A 3ZXSA 4IL6C 1E2XA 5LRRA 5LGUA 2XAHA 2CWEA 4LIUA 3WGIA 2BW3A 3PSFA 3MCZA 3KX2A 1ZRFA 4PDKA 4RB2C 2D2WA 4MQ9F 1J7KA 3Q5FA 1XG1A 2R7OA 3T8TA 5JVGF 3FK6A 2AQEA 3D0SA 1UCRA 1DQUA 1YJWI 1QRYA 3KYLA 2VN2A 1EA3A 1UELB 4LMYA 3JRCA 5E3OA 1SC7A 4BH9A 1MH3A 4N9IA 2VL8A 4BHPA 5F6FA 1KQ9A 3F0CA 2ECBA 3F8MA 5FKMA 1QGPA 2DPUA 2A5WA 3CDLA 2XGCA 4ANJA 1MW7A 4OINF 3GVAA 3GFJA 2WY8Q 3CCEI 2MA3A 3D5RC 2F4MB 3RPQA 1D0YA 3K7AJ 1DPRA 3C7JA 3LFKA 1YS7A 4DZJA 1X3UA 3FM3A 3M8JA 3PUFA 1XGOA 4W97A 4Y15A 4S0HB 1RR8C 1FMVA 2HPMA 2M2EA 3J81K 4AVZA 1S72I 3V7RA 3I5UA 1MBHA 3HKZN 2W25A 2CW8A 2EBIA 3DF8A 1B59A 3K4MA 2ZXIA 5BPIA 4Q5SF 2IPQX 5D8KB 4HAMA 3A0HC 1O7FA 1TNSA 3BR0A 3KZZA 3E6DA 2I5UA 1IXSB 2D1HA 4ZDLA 1I5ZA 2ZB9A 2VT3A 3LQRA 1GDTA 2QCOA 4ZTFA 5CYVA 2LD5A 4XKVA 3LSPA 3TEDA 4ZYAA 1VQNI 2VC0A 3BR6A 3CUQB 2A05A 2WA0A 2COBA 4MEYF 4O5VA 1W36D 1DGWY 1TT5B 4ESFA 1O3QA 3KP7A 3H0GJ 3HYIA 4LGWA 4KIGA 1ZH5A 3BP8A 2GAUA 2HQ5A 5EEGA 4E6KG 1YRNB 3I4MJ 1PDNC 2VI6A 4F55A 1L3LA 3W3CA 2PX9A 4A3DJ 5DYMA 3QYBA 3RQ4A 2MH9A 3OL3A 5C4JJ 1U5TB 3DKWA 5E3LA 1E17A 1I1GA 4HZFA 2XAGA 1B9NA 2MG4A 1ONVA 5JHFA 2P8TA 2NVXJ 2NVQJ 2FOWA 5F0HA 1YJ9I 3HTSB 3DPTA 3F6VA 2WB1A 2KL4A 3H9QA 5HODA 1ZLKA 4M3GA 4PJJA 3H3ZA 3OOUA 1FSHA 3MKWB 1ZYRF 1MKMA 2MSYA 5EGOB 2A5YB 4OIOF 2E34A 1EH7A 1U9OA 2GZWA 4NDLA 2EFOA 3AG3H 4UVAA 3QP5A 4V19K 2RQQA 1VF9A 1IO2A 2M7AA 3R0AA 4MQVA 2CMPA 1LDDA 2PN6A 3MKLA 5KAFC 1VZ0A 2XKPA 1OMIA 1E3HA 1NHAA 2QF7A 3AFHA 3FZVA 2KP6A 2J5OA 2XPUA 4II3A 1OCTC 1JUSA 1G6NA 1JKQC 4BU2A 4CDGA 1R5GA 4NUBA 2O8XA 5FFXA 2DMPA 1WFXA 2KISA 5IP7J 1FC3A 3MAJA 3GUDA 3KP2A 4EJOA 4KMUX 2G9WA 2KIMA 3F8FA 3FKJA 2YUSA 1KONA 1VQ4I 2MGQA 3E5QA 4ZYDA 2XASA 2WWYA 1YO5C 4QTRA 3CMMA 4U87A 4K2EA 2GXGA 3T5XA 4ESJA 3BY6A 3FBNB 5FD6A 3AAFA 4Q47A 1NK3P 2L7ZA 1R6RA 3M8FA 1ULYA 2F48A 3SFIA 3GTMJ 3ZQGA 2GOXB 3GBGA 2GIVA 4BYYA 3AL0C 1KU2A 3WTVC 1QHGA 4WCGA 2KT0A 1WJEA 4KDPA 2OAZA 4QSHA 2FBKA 2JTVA 4YELA 2IGNA 2XVCA 4ZZDA 2VJIA 2YPRA 1QVUA 1TWHJ 3HBLA 1HF0A 4RLFA 3GWZA 4NHJA 3BQYA 4N9HA 3HRTA 1TL8A 3S1QJ 1XGMA 3I58A 2XSDC 3DLAA 2PLYA 2EWNA 4HV6A 5IP9J 5DUIA 1SD4A 3VYSB 4YFNF 3DU6A 3JRFA 2G7HA 5E1XA 4IKFA 3R61A 2LDUA 1MZBA 1IRFA 2CU7A 5LGNA 3ERED 1ERDA 2XF7A 3P9KA 2P0WA 4GFBA 2GBYA 3OY9A 2W1OA 3MZHA 3FMSA 3ULQB 3P7NA 2XROA 1YW9A 1X1CA 4LJZF 4KNYA 4DBQA 2J5PA 1A36A 3B02A 1P7IA 2DOEA 4B43A 2G7UA 3REOA 4BACA 1ZGAA 2HOSA 2KJCA 3VSKA 1YE9A 4XRSA 1DUXC 2Z9OA 3GTKJ 4KYWA 2R93J 1QA6A 4DZPA 2HR3A 1JKOC 1FP1D 3QWLA 4G6DA 4G12A 2BZTA 1IDYA 2P81A 4UXNA 4BBRJ 5HDNA 3LA7A 3A03A 3E6MA 5K5QA 2P6SA 2MW8A 2X48A 4XMYA 2VBWA 3VFZA 2GA2A 1HLVA 5GTIC 5DCMA 1VQLI 2HNHA 5J4YA 3DLLF 1APLC 1LKXA 1ON1A 3BR3A 3ZQHA 2FQ3A 2P7VB 4MO7A 4PK4A 3F3XA 2AQFA 3OV8A 4U0YA 3K70C 1OQYA 1X3ZB 4XLCA 1YI2I 1RPWA 3WTUC 1JTXA 1BJAA 4IRGA 2M4GA 3CZ6A 2PFBA 2Y0SN 2UV1A 5ICEA 1TWFJ 3J81Z 1FIAA 3BPXA 4UUSB 3LSJA 5JI6A 1BI1A 5IYBJ 2JRTA 3BJ6A 3IUOA 4M71A 1T56A 1YG2A 3JR9A 2K5CA 2B9SA 2LMDA 2R92J 1CQTA 1WH7A 1FPQA 2LR8A 1LE8B 1SFXA 2ZXWH 5F27A 2L9NA 5HLHA 2BXYA 4UUTA 4WXHA 2BY3A 4HF0A 5F04A 1ACIA 2KZVA 2LBFA 3FXJA 5D4SA 1LFBA 1ZRCA 2OF7A 5H20A 3C2BA 5L3FA 2DU9A 4CCJA 2PJRA 1QQIA 3SZTA 3SZGA 4NC8A 4LK1F 1FP2A 1FOYA 1MIJA 1ZELA 3JRIA 3CMEI 2ZSHB 4JX4A 5L3CA 3E6CC 1QPIA 2PMZN 3SHFA 1PP7U 3HSRA 3NWSA 1HKSA 4BJTA 4IO9F 2ADUA 2Z2SB 3HHHA 1Y0UA 4M9XA 4XOPA 3SDBA 2FMLA 1MH4A 2EFQA 3M3YJ 2LG4A 3CCVI 1LEAA 2NXNB 3QPLA 4PGGA 2AXTC 3ABUA 5M5WJ 3NRVA 4D0PA 3CC2I 5HS9A 3BDDA 2Y9YA 3DBLB 1MMNA 5JFRA 1FMWA 4XLAA 3WTYC 1JE8A 1M1EB 1I1SA 2R7RA 3MQ0A 3BT9A 1MD0A 3PFYA 3WGHA 3WHBA 3QYEA 5CVJA 5KAIC 3TKYA 4II2A 1W5SA 2WV0A 5D5XB 2IGKA 4Q48A 4L0YB 4Y52J 2X4HA 4IHWA 3HSFA 3A2KA 4XBFA 2ZJPF 2Q2EA 4D5CA 1BOBA 3H9GA 1XMXA 4YEJA 2DA1A 5IOZA 1BI3A 2VJ5A 4ENJA 4LIVA 2ZXJA 3CUQC 2IBDA 5K7ZA 2DI3A 4NBQA 1LFUP 3TOBA 5C44J 3WU0A 4FTHA 2HYJA 2I10A 2CJJA 3Q0UA 2HYGD 4HLXA 1XMAA 2OPTA 2DA4A 3OS2A 3OYKA 1J59A 4IJAA 2DBBA 3MEXA 4AU7A 5FFZA 4E7JA 4YFXF 1ETKA 1OCCH 1DU0A 3C1DA 1R23A 4GGGA 3TMOA 1EV7A 2D5VA 4RBOA 3L2RA 1OISA 3E5UA 3R60A 4NQWA 4A3EJ 4HEA2 3LSHA 4L18B 2RAEA 3O3KA 1PVEA 1Y39A 2C6YA 2NOJB 5FKLA 3G6EI 1RUNA 2NVTJ 1W0TA 2BHZA 2IA2A 1XB4A 5EG0A 3HIFA 2LKXA 1B72B 4EVIA 5J3LA 1STZA 2Y2ZA 1B4AA 2YX4A 5J4VA 2OZ6A 4CHUA 4W1UA 2QM3A 3T8RA 2HQNA 1WWXA 2HI3A 4A69C 2COMA 1XDSA 2DOAA 4D5FA 3S1RJ 2YU3A 3ZMSA 1MDMA 2AHQA 1TWCJ 4MTEA 2M9HA 1YW7A 3OIPA 1SVLA 3EYYA 4ZDPA 3DEEA 1W7PB 3BOQA 4LOCA 1JKRC 1MSFC 3WGGA 1OYYA 2OUMA 4NC7A 1IV6A 4CCOA 3GEZA 1SAUA 2BHYA 3ABMH 2M5WA 3ZN1A 2IS6A 1IRXA 2LRDA 3FKIJ 4L5JA 3UR3C 1G3YA 5JVTA 3G73A 4FHTA 2Y69H 2VJ4A 2JRMA 2JN6A 4XL9A 1ODDA 5EJCA 4M9SA 1HW1A 4ITVA 4RLQA 4YFKF 2Y75A 3GTOJ 1LEBA 3VPRA 2QBYA 1XGNA 3GFIA 3KE2A 2K4BA 1SD5A 4B1RA 5E1ZB 2M1BA 5HVQC 2DLLA 1LVKA 3E7LA 2FX0A 4E7LA 1VQ8I 1X1PA 2DA5A 3H5AA 3KEQA 5J1YA 4JYKA 4CSWA 3IRRA 4M6YA 4L0ZB 6PAXA 2L3DA 2L54A 5LGTA 4E7KA 2BOLA 3JRDA 2VBYA 5EEAA 4BXXJ 4AIDA 4AYBA 4G6QA 4IXAA 3OSFA 3DPUA 1VQ5I 3KLOA 3CF5F 4RMNA 1O4XA 1QZZA 5FD5A 1S5LC 3FX3A 1JHHA 2MBFA 4DYQA 2VXDA 1Z67A 2ME6A 2ID3A 1U78A 2LC2A 3HOZJ 5CVUA 1X1AA 4P55A 3ZMDA 1XX5A 2FNPA 2VPLA 2FE3A 1ZG3A 2E5NA 3H5NA 4AIJA 1O3RA 1CF7B 3VOEA 2EPFA 3OYNA 1PUFB 2EILH 2R5YB 1Z05A 3HEFA 4EGZA 2F2EA 2XAJA 1BR4A 2ZXHA 4M73A 5GAHJ 1JI8A 2VKHA 4G94A 1GV5A 1OCRH 2RN7A 2DTZA 2OCEA 1Z6TA 3LSKA 3CUQA 1E3OC 1UHMA 3FBIB 1VQKI 2QA4I 2MLKA 2EV5A 2RQPA 4OOIA 1SANA 2IA1A 2V9VA 3C3WA 2DQLA 2RKHA 2HGCA 4NC6A 3RKXA 3TDUC 4KUMA 1Z0XA 4ZC3A 5HS7A 2HDDA 1WI3A 1YRNA 2CQKA 2UUZA 1ZG1A 2P7CB 4DOZA 3Q3SA 4A6EA 4CCNA 5B1AH 3HOSA 2L9SA 1U5TA
chains in the Genus database with same CATH topology
3OS0A 2WBMA 3DTKA 3QYBA 4BE2A 3RQ4A 4BXFA 1Z21A 3OL3A 2ZFUA 3RPUD 5JHFA 3S3MA 3ZGKA 4ZJZA 2DXIA 2L2OA 2OV7A 2R7XA 4P5OA 3VYTB 3DU5A 3DPTA 3ZRGA 2WB1A 2KL4A 2HU9A 3H9QA 2VASA 4XQFA 4PJJA 2CUZA 3OOUA 3MKWB 2CUJA 2Z16A 5CQGA 2KRCA 4LITA 3S8PA 2R7UA 4IX7A 4PSXA 5FRNA 2W7NA 2RQQA 2M7AA 3OYMA 2CMPA 2XAUA 5HOOA 3K70D 2VQCA 1PYVA 1VZ0A 2VXZA 3AFHA 2V6EA 4II3A 2KP6A 3U21A 3ZR8X 4F91B 4BU2A 5HLTA 4NUBA 3H9JA 2Y0SA 4OAZA 3H35A 2F6CA 2IXSA 4XM3A 1WFXA 4FASD 1WJCA 3FKJA 2MYSA 4XR6A 4F92B 1TZLA 2VQLA 3D5SC 2XC7A 3CP8A 1MNDA 3VYRB 1KONA 2X6YA 4KT6A 5CQEA 3OYJA 2LY1A 2VB6A 2RREA 3RTRA 3OYDA 3K10A 5CKTA 1S9HA 3CMMA 4U87A 1SFKA 5KCMA 3FBNB 3CF2A 3OYBA 3OYGA 1R6RA 4HPQA 2F5VA 3EUAA 4XONA 3N05A 2GOXB 2JVHA 3GBGA 3AL0C 4OAYA 1AA7A 1QHGA 4BGDA 3DKXA 1WJEA 1D0ZA 2I8DA 4YELA 2IGNA 1WJAA 1V5GA 1Y6IA 2VJIA 2HVRA 2DJIA 4B48A 4U7BA 3EUHC 4RM2A 2V7FA 2PMZA 2KHMA 4RLFA 2KMUA 1N78A 2M0MA 2MFZA 4HSTA 3DLAA 3W2VA 2WAQA 1OLTA 3VYSB 3DU6A 3VWBA 3AL0B 2IGOA 1YX3A 1BR2A 4XN3A 2VJJA 4XOTA 2XSJC 4BDYA 4JOMA 4IKFA 2LY2A 5FRMA 4FETA 2CV0A 1ERDA 4MLOA 2XF7A 2VQHA 2P0WA 4BJ6C 4BE1A 3OY9A 3RSNA 2W1OA 3OYFA 3ZQQA 3HPGA 4XORA 2VIXA 4CA0A 1X1CA 1W36C 2KQRA 4XN0A 4DBQA 4EATA 4C2TA 3C2HA 5CPRB 3PNTA 3OYHA 4B43A 2KLOA 4BACA 4E7SA 2F4IA 2LREA 5LD2C 2RNGA 3CESA 4E7HA 3VSKA 2QKMB 3QODA 4H4KC 4HSRA 1YE9A 3HXLA 4PJNA 4IZZA 3D5LA 2W82A 2Z1DA 2M3AA 4B44A 4XKCA 3LSMA 4P1WA 3K4JA 4BS9A 1D1BA 4HG2A 3OYLA 2OC6A 4XMYA 1WJFA 2X85A 1UAAA 1WJ5A 2XDVA 2KRHA 3L2QA 4QPOA 1PJRA 2X51A 3HG9A 3HC7A 2HNHA 2DT7B 3MD2A 1LKXA 3HOTA 3OYEA 1GLNA 2MABA 4PK4A 2AQFA 2V1NA 3K70C 1LDKB 2BVLA 4XLCA 2MD0A 1Y56A 3W2AA 2M4GA 3OWTA 4E7IA 3CZ6A 1MMGA 2CS3A 1V5FA 2UV1A 3BCAA 3E1SA 1HA8A 3BLYA 3H5RA 3K4CA 5LFAA 4CCLA 3ONQA 4G6TB 4F3QA 4XKBA 2R7VA 3IUOA 4KITB 4F52A 2E1MC 1TT0A 2K5CA 3DTEA 2WADA 4DJAA 4BQNA 3EPZA 1YX5A 2HPIA 2WAEA 3VYUB 4LG3A 4IQ4A 1J09A 2L9NA 5KNLA 3EUKL 2X1DA 3PL8A 3OR2C 3S93A 4X0GA 3W3CA 2KZVA 2LBFA 2IS2A 2WAFA 3F9KA 1D1CA 2VLAA 2W00A 2LBFB 4HRIA 1K6YA 3L2UA 4CCJA 1P9QC 3VDXA 2PJRA 3PUBA 3SZGA 1U0JA 4NC8A 1ZELA 3A4CA 3HPHA 3IAS2 3G2BA 2ZSHB 4Y4RA 3OS1A 2PJRB 3FDYA 3NWSA 2X1EA 3K4KA 4BJTA 2ZSIB 2Z2SB 4XOPA 3SDBA 3OYAA 3DKYA 4OWRB 2K3PA 2LG4A 3OMYA 4XLFA 3IAM2 2FUG2 4BDZA 4PJLA 3HL2A 1MMNA 1DGRM 1FMWA 4XLAA 1E0EA 3TBIA 4BUPA 2R7RA 3BG6A 4YRVA 3PFYA 3L2WA 1G59A 4Y33A 3TL4X 3AKZA 3QYEA 4Y3OA 4II2A 2JUGA 3VSLA 3FHNA 2UWMA 2DCEA 2IGKA 2KDOA 2R7QA 3BG7A 1X19A 4C30A 1NG6A 3RCOA 3LMMA 3QYFA 3A2KA 4J01A 4D1QA 2CFOA 2R7TA 1WJDA 4JQFA 4DBRA 4BQQA 1BOBA 3H9GA 1D1AA 2L5QA 3ZCOA 3PNVA 2ELJA 3BCBA 2Q2EB 4YEJA 4CCMA 2VJ5A 3DPLC 4LIVA 4IQJA 3K4BA 2A6TA 3V42A 3W2WA 3OYCA 2W4SA 4DIQA 3OIQA 1QU3A 3OS2A 3OYKA 3A1YA 1OR7C 2M4KA 2CW7A 4AU7A 2E5ZA 3L2VA 3HKZA 1MMDA 4E7JA 2Q1ZB 4BE0A 4CUGA 3NWTA 3K4NA 4HNTA 3TMOA 2V26A 2CV1A 1T0FC 1DP3A 2GOMA 3PJRA 2VQGA 3L2RA 3S3NA 4PSWA 1X1BA 1MNEA 4KISA 1WJBA 2L7KA 1LFPA 1V5EA 4HEA2 3LSHA 2LYCA 2LOOA 4NQWB 3E0JB 2NOJB 2CH0A 4KJZA 2HVSA 5KHDA 3PSIA 2V9KA 3DTIA 3DQVC 5HNFA 3DWLE 3BC8A 4N4OB 2V4JC 3K6GA 3OL4A 3M1CA 2HVQA 3OR1C 2R7SA 3MMYB 4N4NB 4DGWB 4J00A 1N75A 2DOAA 3OYIA 2M7BA 3CJRB 1X4OA 4B3XA 4R79A 2HZDA 3S3OA 5HNHA 3OIPA 4PFOA 4NNJA 3PNYA 1UG0A 3DEEA 4ZDPA 4PFPA 2DT6A 4GRIA 2MC4A 3UNGC 2BVMA 2OUMA 4NC7A 2X6WA 4CCOA 4C2UA 1SAUA 3C2GA 2IS6A 1IRXA 2LRDA 2E1MB 4ZTJA 3UR3C 1X1DA 4CCKA 2R7WA 4BEHA 3J7AY 3CJQB 1T95A 4CZCA 2JA2A 2VJ4A 4RM3A 4XL9A 4BEHB 4ZDOA 4BL0B 3CP2A 4ITVA 4RLQA 4CH7A 3HUGB 2KPMA 4BQOA 3KEYA 3K4LA 2CV2A 2QKLB 2JVGA 5HVQC 3ZXSA 2IGMA 1LVKA 4HNUA 2K9MA 4E7LA 2IS4A 1N77A 4LIUA 3H5AA 2BW3A 3PSFA 4CSWA 4E4HA 3KX2A 1G8XA 1Z7LA 2BW3B 4E7KA 2BOLA 2K9LA 2R7OA 4PUSA 2AQEA 1Z3XA 1DQUA 3KYLA 4AYBA 1EA3A 2R4GA 1UELB 2XF6A 3DPUA 3LSGA 4RMNA 2VL8A 2LH9A 2O5RA 2A5WA 2VXDA 4QPQA 4F93B 2LC2A 1MMAA 4ANJA 1MW7A 2WY8Q 1X1AA 4XKWA 2IS1A 4D9JA 3D5RC 1D0YA 3S32A 2VPLA 3M8JA 2E5NA 2HPMA 3H5NA 1FMVA 1D0XA 4AVZA 4E7ZA 3OYNA 3QOEA 3LSIA 1Z3YA 2CW8A 3I3LA 3K4MA 2ZXIA 4XLHA 2HDWA 1NG7A 2ZXHA 1BR4A 2HQAA 3LL7A 3SEQA 4C9YA 1JI8A 2VKHA 3MKZA 3SEZA 4BJ5C 4XLEA 4ZDLA 5FROA 3LSKA 4B47A 3SYTA 3FBIB 3MKYB 3I9V2 4ZTFA 4XKVA 4ZYAA 3IP4B 5TGTA 2WA0A 3LFUA 4ZC3A 1W36D 1BR1A 2E60A 2L9SA 4PJMA 1DGWY 2X6XA 2UUZA 4DOZA 4CCNA 3H0DA 2VKDA 4XNFA 3HOSA 1X4PA 1QHHD 2WY7Q 4E6KG 2XF5A 2X1CA 4F55A 2JSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRE A;  2LRD A; 
#chains in the Genus database with same CATH topology
 3E3V A;  4HV5 A;  3OS0 A;  3KET A;  1Z21 A;  2MD5 A;  1MSE C;  3FM5 A;  2ZFU A;  3FXK A;  3S3M A;  3ZGK A;  1VI0 A;  3R6S A;  4XRM A;  2DXI A;  3VYT B;  3O6B B;  4MFD A;  5EGO A;  1XSV A;  3DU5 A;  3A02 A;  2DFF A;  1VQP I;  2LY9 A;  3HM5 A;  3TP3 A;  4CIC A;  1BC7 C;  4G9Y A;  4XSZ F;  4XQF A;  2DFE A;  1BC8 C;  2Z16 A;  3BR2 A;  2K86 A;  2E7X A;  1BN5 A;  1GHC A;  2CQQ A;  4ZH4 F;  2XB5 A;  2VE9 A;  1ZR2 A;  5L3D A;  3RKQ A;  2NVY J;  2BV6 A;  2W7N A;  4S04 A;  3COA C;  1BW5 A;  1T2K A;  2XAU A;  3K70 D;  2VQC A;  1A35 A;  3U21 A;  1D8J A;  4XRS G;  1GVJ A;  1OCP A;  3ZR8 X;  1HW2 A;  1ENH A;  4XIC A;  5HLT A;  2IW5 A;  2EQR A;  3IL2 A;  5F1J A;  3I59 B;  5TJJ A;  2OD5 A;  2HYF A;  3NAU A;  3GXO A;  5GAE J;  1R4N B;  3H35 A;  4XM3 A;  3SDG A;  2B7E A;  2XB0 X;  1S6L A;  4ZYG A;  4R1H A;  3HDD A;  2QWW A;  3V8L A;  4XR6 A;  4Y17 A;  2ZME B;  1TZL A;  2VQL A;  1KU7 A;  3D5S C;  3P9I A;  1LPQ A;  2IRF G;  1MND A;  3VYR B;  1QVT A;  2RDP A;  2X6Y A;  4KT6 A;  5CQE A;  3OYJ A;  2LY1 A;  4D7N A;  3FXQ A;  2E1O A;  3AG1 H;  3RTR A;  5CKT A;  5LBQ A;  1WI9 A;  3K2A A;  2GIZ A;  5AIQ A;  4ASN A;  5EF6 A;  3G1L A;  1YIT I;  3GCM A;  1TC3 C;  2VE8 A;  2KRF A;  4U0V A;  3CC4 I;  3N05 A;  4RB1 A;  3J7Y J;  1XSX A;  1B1B A;  3S2D J;  4V2G A;  4EJU A;  1D0Z A;  4HNV A;  3LWF A;  4RAG A;  1Y6I A;  5GP9 A;  2HVR A;  3GFM A;  4Y7N J;  1ZLJ A;  3V8J A;  1FSE A;  5DM7 F;  4U7B A;  1C0W A;  3EUH C;  5FO5 A;  1KQ8 A;  1JGS A;  2KHM A;  1W5T A;  2A6H F;  2GQQ A;  3JW4 A;  4KN7 X;  1TQP A;  1N78 A;  2FBI A;  2MC3 A;  1WKM A;  4HST A;  4HYE A;  5B5E C;  3HGG A;  5DTD A;  5M5X J;  4A3K J;  4A3B J;  2NOG A;  4LK0 F;  4MFE A;  3F22 A;  2IGO A;  1BR2 A;  1QZE A;  2F5D A;  4XOT A;  2JA5 J;  4EEF G;  2XSJ C;  1BIA A;  3CCS I;  3IRQ A;  2DMQ A;  2LY2 A;  3EDP A;  3ABT A;  5FRM A;  1U2W A;  3TO7 A;  3I64 A;  2ECC A;  1S7O A;  5LHH A;  1W4M A;  2DAO A;  3I56 I;  2DDA A;  3KEO A;  3V7S A;  5HLI A;  3HPG A;  2VOD A;  4CA0 A;  4EGY A;  4RAF A;  3BJA A;  4EAT A;  4C2T A;  3HRS A;  2EIJ H;  2KDZ A;  4E7S A;  5LHG A;  5FKO A;  2LRE A;  5LD2 C;  2GLO A;  3M4O J;  3SXY A;  4E7H A;  2GM4 A;  1BBY A;  2UZK A;  2QKM B;  3JCU C;  1WVR A;  3HJE A;  2NS0 A;  2W82 A;  2Z1D A;  4UB6 C;  4L9V A;  2M3A A;  4XKC A;  3LSM A;  1A31 A;  1ZQ3 P;  3HRU A;  1U3E M;  5D5U B;  4HX4 A;  2XKO A;  4M74 A;  2WB1 N;  4BS9 A;  5F64 A;  4LFU A;  1FOK A;  1NTC A;  3H92 A;  4HG2 A;  1FBU A;  2DTR A;  2ZO4 A;  2FQ4 A;  2OC6 A;  3DV8 A;  3PIP F;  2XDV A;  3EQL F;  2Y9Z A;  3ZP5 A;  3CLO A;  5FGM A;  3IH4 A;  3RPU A;  2PI0 A;  4Y13 A;  1BW6 A;  5LRS A;  1TWG J;  3HOT A;  3A01 B;  4C3H J;  5IT3 A;  2LF7 A;  5IPA A;  2Y31 A;  4JK1 X;  3V8K A;  1G4D A;  2MD0 A;  2AXL A;  4AVP A;  3VB2 A;  2OJE D;  4UUS A;  2CUE A;  4FE4 A;  1O3T A;  2Q8K A;  5HDK A;  1J2X A;  2LNB A;  1HA8 A;  1K79 A;  3K4C A;  3ONQ A;  2E71 A;  4F3Q A;  5J1R A;  1RKT A;  5BS6 A;  2R7V A;  2W85 A;  4XSX F;  4KIT B;  4MIM A;  1LE8 A;  1QBJ A;  3DTE A;  3CMA I;  2WAD A;  5M5Y J;  4DJA A;  2QSH X;  1UMQ A;  1V55 H;  4UV9 A;  2X6O A;  2B0L A;  1F5T A;  2FSW A;  1FJL A;  4LLN A;  5E8G A;  3K9T A;  2JK3 A;  5H6R A;  3PO3 J;  2K4J A;  3N4M A;  3L9F A;  2X1D A;  2CFX A;  2LKS A;  3PL8 A;  3CCU I;  2VKV A;  1LB2 A;  5DCF A;  4YIR X;  3NAR A;  5FLV A;  2YR2 A;  2ZKZ A;  1U8R A;  2IJL A;  1P2F A;  2WAF A;  1HQC A;  3F9K A;  1D1C A;  2VLA A;  4UHT A;  1OYI A;  4B4C A;  5BQT A;  4HRI A;  1K6Y A;  3QRF F;  5L3G A;  2NAZ A;  3RI4 A;  4TV7 A;  1VQ6 I;  4FQG A;  5BOX A;  3OS1 A;  4RA2 A;  2E19 A;  3CJN A;  3IV5 A;  2E2H J;  1Z6R A;  1ZN2 A;  4AD9 A;  5E3N A;  1RI7 A;  2XAF A;  1FTZ A;  2RGV A;  1UZC A;  3OYA A;  4AC0 A;  3W6K B;  5EZG A;  3MWM A;  1I3Q J;  3WG7 H;  1TW2 A;  3L1P A;  5DDG A;  3OMY A;  2OU2 A;  1RC9 A;  3WTX C;  2DFI A;  4XLF A;  3S15 J;  1USS A;  4WWC A;  3FWE A;  1WSU A;  1JT6 A;  1P4A A;  2FUG 2;  2W84 A;  1ETW A;  4BDZ A;  2HXI A;  3HL2 A;  3TBI A;  2GXA A;  5K1Y A;  1YOV B;  4HF2 A;  4YRV A;  5ICF A;  2O9L A;  3EUH A;  3U1D A;  3ZQ7 A;  1VTN C;  4IRI A;  2QSF X;  1IW7 F;  4DQ2 A;  3FHN A;  2ZFW A;  1IXC A;  2UWM A;  3PFI A;  1ETY A;  2JA6 J;  1F43 A;  2LVS A;  2R7Q A;  3BG7 A;  1AWC A;  4YIF A;  3RYP A;  5J8F A;  4F7Z A;  4D1Q A;  3RZD J;  3WTZ A;  5LHI A;  1AHD P;  1XC5 A;  2L5Q A;  3ZCO A;  5JR3 A;  3BCB A;  3LA3 A;  2X0L A;  1H9T A;  1U8B A;  1SVO A;  1ZR4 A;  5F1R A;  2L7M P;  4M3E A;  4CCM A;  4CYC B;  4DYC A;  1HXD A;  5LLQ A;  3W2W A;  5FB2 A;  3J7Z I;  2EB7 A;  2W4S A;  4BHC A;  3OSG A;  3A1Y A;  1OR7 C;  2EV0 A;  1ZAO A;  1VQ9 I;  3GYH X;  4CO8 A;  5KVR A;  3WU1 B;  3NWT A;  2B63 J;  3PM1 A;  2R0Q C;  2R5Z B;  4MNU A;  3QOP A;  5L3B A;  4L9T A;  2CV1 A;  1IN8 A;  1YQA A;  2FMY A;  1R9T J;  2Y48 A;  3U9G A;  3FXM A;  1T39 A;  4X6A J;  1V5E A;  3KP3 A;  1OCO H;  2JSC A;  3KP6 A;  1I3A A;  4U88 A;  3F8C A;  4MHG A;  1EJ9 A;  2K9N A;  1LDJ A;  1B72 A;  1YLF A;  4KN4 X;  2PEX A;  4I76 A;  3PSI A;  1R1T A;  2STT A;  3QPH A;  4QWQ A;  3TGN A;  2H6B A;  3RJP A;  5BNG A;  2VOP A;  1IXR C;  2F4O B;  2V79 A;  3BC8 A;  2V4J C;  3FIW A;  1IV8 A;  2OQG A;  2L9R A;  3M1C A;  2O0Y A;  2R7S A;  3OR1 C;  2HKX A;  2QUF A;  3B6C A;  1OFC X;  2JMW A;  5H6Q A;  5LEJ A;  1F9N A;  1WH5 A;  4I09 A;  4J00 A;  3CJR B;  1OYW A;  2KZG A;  5ERI A;  5BPD A;  1W7P A;  5HNH A;  3T1B A;  2IAI A;  3ERM A;  3BJO A;  4RS8 A;  4KFC A;  4CXF A;  1XD7 A;  1B8I B;  1ETV A;  3HOW J;  3JTG A;  4V2F A;  4LD5 A;  1ZRD A;  2FEZ A;  5CLS A;  2E1M B;  4ZTJ A;  3BRO A;  3HHG A;  4A3C J;  2R7W A;  1SMT A;  1FBQ A;  3L2C A;  4ZYH A;  2KIU A;  3W6J B;  4UUV A;  2LFB A;  2Z3Y A;  2R7Z J;  4RM3 A;  4ZDO A;  4BEH B;  5DUK A;  3NQO A;  1J0R A;  2IVM A;  4DYR A;  3HUG B;  2PJP A;  3IC7 A;  3TQN A;  2WC2 A;  2P5K A;  1IF1 A;  2OTJ I;  3K4L A;  1E3P A;  2CV2 A;  2IGM A;  2IS4 A;  1N77 A;  1Z77 A;  1A6I A;  1FYL A;  3CCY A;  2OTL I;  1Z7L A;  2QQ8 A;  3JAM K;  1N25 A;  2CG4 A;  3HZJ A;  3WTS C;  4RGR A;  1Z3X A;  3HRM A;  2P6T A;  2VBX A;  2R4G A;  1ZTR A;  3LSG A;  1VND A;  1IC8 A;  4MEX F;  1J9I A;  2H6C A;  4CYD A;  3SQN A;  2E7W A;  2LH9 A;  2O5R A;  4QPQ A;  4Z2Y A;  4A2U A;  2W24 A;  3U2R A;  1OKR A;  1KYW A;  4XKW A;  1KZH A;  2HOE A;  4D9J A;  4U7D A;  3HOU J;  1CF7 A;  1GVD A;  3BG9 A;  1PUF A;  2ZJQ F;  2R5Y A;  3KYD B;  4B3A A;  1SVM A;  2O3F A;  3GTQ J;  1U6G A;  3LSI A;  3JTH A;  3I3L A;  4XLH A;  1FNN A;  5M3F J;  1NG7 A;  2ETH A;  2HQA A;  1S7E A;  4C9Y A;  3ZQI A;  3AG4 H;  5IYD J;  1ZKG A;  3KPH A;  2BE5 F;  3GLL A;  3K1N A;  4L9N A;  4A12 A;  1ZGJ A;  4YG2 F;  3SYT A;  3I0T A;  4XLN F;  3MKY B;  3I9V 2;  1U5T C;  3IP4 B;  4HF1 A;  2H94 A;  3LFU A;  5ILU A;  1OR7 A;  1BR1 A;  3ASO H;  2IP2 A;  2QQ9 A;  3ABK H;  4ABZ A;  4FX4 A;  1YTY A;  2YU9 J;  2VKD A;  4A3M J;  3W6V A;  2EZL A;  1X4P A;  1QHH D;  2H8R A;  2K40 A;  2XF5 A;  5DD8 A;  4KIF A;  1R36 A;  3LAJ A;  2VUM J;  3ZQC A;  2DK8 A;  1MBJ A;  3LA2 A;  3RQI A;  1EH6 A;  4ZJZ A;  2JPB A;  2Q0O A;  1H8A C;  2L2O A;  2OV7 A;  2R7X A;  1K4S A;  2VBZ A;  4P5O A;  3CCQ I;  3L00 A;  3ZRG A;  1R22 A;  4A3L J;  2OQR A;  1HKT A;  5K7H A;  2H09 A;  2CUJ A;  4BNC A;  1MMS A;  4EJT A;  1HSJ A;  4LIT A;  4NB5 A;  3M7G A;  4IX7 A;  3GTJ J;  3WG9 A;  4M6V A;  2QVO A;  4I98 B;  1K7A A;  2PBI A;  4MTD A;  4BY7 J;  1R1U A;  4OMZ A;  2A3S A;  1Y8Q B;  4PJ0 C;  5HOO A;  2V6E A;  2VXZ A;  2A07 F;  3J80 K;  3I59 A;  3D1N I;  1QO0 D;  4I99 C;  1W7P D;  2EFN A;  5IOY A;  3J7A O;  3Q9S A;  4OAZ A;  2F6C A;  2IXS A;  3G1M A;  1OPC A;  2ZME A;  1FEX A;  3RZO J;  4PCQ A;  1ITY A;  1Z7U A;  1WGX A;  3CP8 A;  2K27 A;  3OIO A;  2XC7 A;  5BMZ A;  2EH3 A;  3QP6 A;  5EEH A;  4ZYE A;  2BY1 A;  2VB6 A;  2RRE A;  3IWF A;  1K61 A;  3K10 A;  3HOX J;  1S9H A;  1IZ1 A;  1CGP A;  3LAP A;  1WHU A;  2DA7 A;  4DNC A;  1IAW A;  2DMT A;  1XDU A;  1FY7 A;  4AYB N;  1G2H A;  2A68 F;  2EIN H;  3CF2 A;  3OYB A;  1SEU A;  2HKO A;  3DBR B;  4I2O A;  4HPQ A;  2F5V A;  2W48 A;  3EUA A;  1WCM J;  3FIS A;  3CJT B;  2JVH A;  3JRE A;  4OAY A;  4HDU A;  5J6X A;  3DKX A;  2PMH A;  2V1X A;  3O8G A;  3GZN B;  3BG3 A;  3ECH A;  5B3S H;  3RIR A;  3HB9 A;  1VFC A;  1V5G A;  4B48 A;  3S1M J;  1T98 A;  3CO7 C;  5HLG A;  2JPC A;  2KMU A;  1V3F A;  2AO9 A;  4XRF A;  2FRH A;  2M0M A;  2DDB A;  2TRT A;  3W2V A;  2WAQ A;  1OLT A;  2ZJ2 A;  3M8E A;  3QU6 A;  2FF4 A;  3VWB A;  1SD7 A;  1TTY A;  2CQ7 A;  3AL0 B;  1YX3 A;  1PUE E;  1K83 J;  2JZY A;  1IN5 A;  1MBG A;  4BDY A;  1ZGW A;  1R58 A;  2NNY A;  4IHS A;  1F36 A;  4EJW A;  2BY0 A;  1SFE A;  2Z99 A;  2M0C A;  3L09 A;  4FET A;  1V54 H;  2G0E A;  2VPR A;  4MLO A;  4AIH A;  2CV0 A;  2VQH A;  4BE1 A;  4ZZL A;  1YIO A;  2KJB A;  2P5V A;  3RSN A;  1KYZ A;  2HTS A;  3U1K A;  4UY8 I;  1VQ7 I;  3ZQQ A;  3ZPL A;  4IOC F;  2K3F A;  4FE7 A;  1FYK A;  3K1P A;  2KQR A;  4XN0 A;  5HDG A;  5CPR B;  3PNT A;  5K5R A;  1G3T A;  3OYH A;  2CGP A;  2KLO A;  4XK4 A;  3K2Z A;  4RGS A;  2EZI A;  4A3I J;  1DPU A;  3QOD A;  4H4K C;  4IZZ A;  2DQR A;  3S2W A;  4XID A;  3K69 A;  3D5L A;  3O8H A;  2V1U A;  3TDZ C;  3S1N J;  1IRZ A;  4B44 A;  3F72 A;  4RAY A;  3K4J A;  4IF4 A;  3JAM Z;  2JA7 J;  1D1B A;  3JRH A;  3EET A;  4OU0 A;  1Z91 A;  2O6G E;  3A01 A;  2D1V A;  1PJR A;  3Q0W A;  3X2Q H;  3HC7 A;  3ML6 A;  5GTH C;  2HZT A;  3MD2 A;  4A5M A;  4IHT A;  4A93 J;  4G8X A;  4M3F A;  1XCV A;  3QPS A;  3OYE A;  1PP8 F;  1GLN A;  2MAB A;  1LDK B;  5A2Q K;  5ICC A;  1FZP B;  2LSO A;  3E6B A;  2RNJ A;  3OWT A;  4E7I A;  1DDN A;  1IUY A;  4IEJ A;  1MMG A;  2CS3 A;  3F23 A;  3ZQF A;  4DW6 A;  2YS9 A;  3GTG J;  3E1S A;  3BLY A;  1GT0 C;  2K9S A;  4CCL A;  4OIP F;  3QAH A;  1HDP A;  3SZP A;  4BHB A;  4F52 A;  1T33 A;  2E1M C;  1YFH A;  2EK5 A;  1TT0 A;  1DU6 A;  1MGT A;  2DMN A;  3ISP A;  1H88 C;  3KZI C;  1RR7 A;  5J8C A;  1YX5 A;  5D5V B;  3DFG A;  2JWT A;  2WAE A;  3BPV A;  2H8W A;  3VYU B;  4LG3 A;  3ZOB A;  4IQ4 A;  2EFW A;  1LQ1 A;  1ON2 A;  2VT2 A;  2STW A;  2QQB A;  4FX0 A;  3PQJ A;  1Y8R B;  3OR2 C;  4I7H A;  3KFW X;  1FWZ A;  4X0G A;  3GZ6 A;  2ID6 A;  5JHU A;  4KA4 A;  2IS2 A;  2M45 A;  4EM1 A;  2XRL A;  2W00 A;  2DA2 A;  3L2U A;  4RB3 C;  2L4A A;  3HOV J;  3FXR A;  3VDX A;  1GXP A;  3CD6 I;  3PUB A;  1TW3 A;  1P4X A;  2LK2 A;  3DXJ F;  1XTA A;  3A4C A;  5IY5 H;  4Y4R A;  3GO5 A;  3K4K A;  1WPK A;  2M8G X;  4L5E A;  2DN0 A;  5J40 A;  4L5I A;  4C2M J;  2ME0 A;  3IH2 A;  3QU3 A;  3DKY A;  1UG2 A;  4OWR B;  2L01 A;  1QZY A;  4LG0 B;  4HOB A;  4KT5 C;  1QPM A;  4WK8 F;  2R3S A;  1Z9C A;  4A3J J;  1XS9 A;  4FT8 A;  5FLX K;  3CTA A;  1B6A A;  1DGR M;  2QEX I;  4UB8 C;  4BUP A;  4PGH A;  3BG6 A;  4RDU A;  3BTL A;  3L2W A;  1G59 A;  4Y33 A;  3TL4 X;  3AKZ A;  1UB9 A;  1FBS A;  2JUG A;  2HTJ A;  3J80 Z;  2DCE A;  2KDO A;  5AON A;  1X19 A;  3RCO A;  1T6S A;  3LMM A;  3QYF A;  2EFP A;  4BXU A;  3RYR A;  2Y30 A;  2XAQ A;  5E79 C;  1WJD A;  4DBR A;  1SFU A;  1FOX A;  4BQQ A;  1K6O A;  4GO1 A;  1D1A A;  3PNV A;  3HTU A;  4O3M A;  4CYC A;  3H36 A;  2BXZ A;  2NS8 A;  4G7Z F;  1K78 B;  1VQM I;  3CC7 I;  2ELH A;  3FXL A;  1TBX A;  1FLI A;  3VOD A;  3DPL C;  2M30 A;  5E20 A;  2A61 A;  1R71 A;  3GTP J;  1Y1V J;  3OYC A;  2VKE A;  1B9M A;  3GF2 A;  3OIQ A;  5IP6 A;  4OMY A;  4KIB A;  3TW6 A;  1TLH B;  3GLX A;  2M4K A;  3L2V A;  3HKZ A;  1MMD A;  2R5Z A;  1MJA A;  2EV6 A;  2Q1Z B;  4BE0 A;  2MLG A;  1BM9 A;  1JHF A;  4CUG A;  1KA8 A;  3CCL I;  2IEK A;  3K4N A;  5EDN A;  2V26 A;  2XGX A;  4KIC A;  3H3V K;  4JP0 A;  3JSP A;  2GOM A;  3P5J A;  1XPX A;  2CRG A;  4PSW A;  1X1B A;  1MNE A;  1WJB A;  2FD5 A;  4I0A A;  4LLL A;  2TCT A;  1RES A;  1LFP A;  2E36 A;  2HQR A;  2LYC A;  2LOO A;  2N8G A;  4BKX A;  3E0J B;  2XV4 S;  1T0F A;  2CH0 A;  4GYI A;  1S7A A;  2HVS A;  5KHD A;  3DTI A;  2DK5 A;  2HOA A;  1AU7 A;  2VC1 A;  3ABL H;  3DQV C;  3BZC A;  4JX6 A;  2XRN A;  1AKH B;  2ZNY A;  3K0L A;  4N4O B;  2L0K A;  2RV8 A;  3OL4 A;  3CCR I;  1XN7 A;  3BWG A;  4UV8 A;  1ETO A;  2HVQ A;  5E17 F;  2CO5 A;  3BTJ A;  2XUB A;  1D5Y A;  1BI2 A;  2FJ1 A;  3OYI A;  2DFH A;  1FYM A;  4RAZ A;  2M7B A;  1R49 A;  1X4O A;  4B3X A;  2HZD A;  1B8I A;  3SJM A;  3IKV A;  4ON0 A;  2DMU A;  4NNJ A;  3PNY A;  3ZMU A;  3TP0 A;  4PFP A;  3BR5 A;  5HS8 A;  1A04 A;  1LUJ B;  5J1U A;  5JLX A;  3UNG C;  1LNW A;  1TNT A;  2BVM A;  2JQ7 A;  1YYV A;  1SAX A;  2O8K A;  2LLK A;  4ETS A;  2X6W A;  1T38 A;  4HX7 A;  4C2U A;  3C2G A;  4HW0 A;  2HFH A;  3ESW B;  4IPA A;  3S16 J;  1R1V A;  2WTE A;  4BEH A;  3J7A Y;  3CJQ B;  2R7D A;  1T95 A;  4CZC A;  1S3J A;  3HUG A;  1HC8 A;  2JA2 A;  4BL0 B;  9ANT A;  3CP2 A;  3FHZ A;  1R5H A;  1G3S A;  4LLG F;  2CYY A;  5DM6 F;  4BQO A;  5DV5 A;  4BAY A;  1A6Q A;  3KEY A;  3LST A;  1I27 A;  2FNA A;  1P6R A;  2QKL B;  2JVG A;  4BY1 J;  4A6D A;  5M3M J;  3ZQL A;  4HNU A;  2K9M A;  4ENM A;  1ZK8 A;  5ED4 A;  2Z5U A;  1W0U A;  3CMY A;  4E4H A;  1G8X A;  4PZJ A;  3B6A A;  4HDV A;  1HKQ A;  2E2J J;  2L02 A;  3RKY A;  5C4X J;  1QNT A;  2BW3 B;  1JUP A;  5A2Q Z;  2K9L A;  2PQ8 A;  2QYO A;  4M9Z A;  4PUS A;  4AUX A;  3NEU A;  2CQN A;  4OIQ F;  1RKW A;  4EM2 A;  2DYS H;  2XF6 A;  3AG2 H;  1R4M B;  4Q4Z F;  1FIP A;  2V1D A;  4RB0 A;  1TWA J;  1F1Z A;  4CGZ A;  3I53 A;  2GA1 A;  3BR1 A;  3RDI A;  2DT5 A;  3F8N A;  3M1E A;  4EJV A;  1SD6 A;  1G3W A;  4F93 B;  4A0X A;  4I6Z A;  1MMA A;  3PQK A;  1RIO H;  1YJN I;  3ELK A;  1NK2 P;  2IS1 A;  3B73 A;  1HCR A;  2ISY A;  3S32 A;  4U0W A;  4EMS A;  3I54 A;  3S17 J;  1D5V A;  2NRA C;  2EIK H;  1D0X A;  4E7Z A;  1A5J A;  1IG7 A;  1Q1V A;  3QOE A;  1Z3Y A;  2XIG A;  2UXN A;  2AS5 F;  2HDW A;  1RNL A;  4GCV A;  1T08 B;  3LL7 A;  3SEQ A;  1UHW A;  2LKP A;  3WTW C;  3MKZ A;  3SEZ A;  2DOD A;  1X58 A;  1BOA A;  4QIW N;  2EIM H;  4EM0 B;  4AIK A;  4BJ5 C;  4XLE A;  4HX8 A;  3H1C A;  5FRO A;  4B47 A;  3JRA A;  3CDI A;  2K85 A;  2QQA A;  5DS9 A;  5TGT A;  4AM3 A;  4UVB A;  2E60 A;  3FXO A;  2EZK A;  3DP7 A;  2PMU A;  1GXQ A;  4I0B A;  4PJM A;  4IHX A;  1KGS A;  2JT1 A;  5AIP A;  2XGE A;  2X6X A;  5K7F A;  3H0D A;  4XNF A;  2WY7 Q;  2X1C A;  2JSP A;  3JRB A;  1L0O C;  2ICW G;  2WBM A;  3DTK A;  3KYC B;  4RGX A;  4BE2 A;  4BXF A;  2KKO A;  5FLX Z;  2XPW A;  3RPU D;  1WRJ A;  2OCC H;  3R4K A;  1VQO I;  1BJZ A;  2BBY A;  4C3J J;  3C18 A;  2ZNZ A;  2HU9 A;  2VAS A;  2CUZ A;  3KP5 A;  4GYG A;  2BYV E;  5CQG A;  2KRC A;  3S8P A;  2R7U A;  1I6X A;  3G3Z A;  4PSX A;  5FRN A;  1D8K A;  4HQM A;  3F8B A;  4FIS A;  2XHK A;  3OYM A;  5IT9 K;  3M07 A;  1V4R A;  3ZMT A;  1PYV A;  1I6H J;  3DCF A;  1XSD A;  1IN4 A;  2L4M A;  2ZME C;  1TQM A;  1ETX A;  1I39 A;  5GPA A;  4B09 A;  4F91 B;  5FKN A;  3HGY A;  1H9G A;  4IOA F;  2DYR H;  3GW2 A;  2RC4 A;  4P9U A;  4GXO A;  1HW5 A;  3H9J A;  3Q9V A;  2Y0S A;  1P92 A;  4H0E A;  2P4W A;  2LP0 A;  3S14 J;  4WX9 A;  1RRJ A;  2HDC A;  2HOT A;  2D45 A;  4FAS D;  1K4T A;  5E8I A;  3MVP A;  3MZY A;  1WJC A;  2F5F A;  5D8L B;  2MYS A;  4F92 B;  3LQQ A;  5D4R A;  2NVU B;  2DPD A;  2H27 A;  1JTY A;  3L7W A;  3G4S I;  5DD4 A;  4WXC A;  3OYD A;  3K1M A;  2IA0 A;  1SFK A;  4ESB A;  5KCM A;  2QEN A;  3WU2 C;  2M87 A;  4P9F A;  4LB5 A;  2JJ7 A;  1GUU A;  1X2N A;  4EQQ A;  4E70 A;  1XMK A;  1I50 J;  3OYG A;  2CQX A;  3E97 A;  5DEQ A;  4XON A;  5EYR A;  2ACJ A;  1Y0N A;  2HS5 A;  1IDZ A;  2FXA A;  1AA7 A;  1S29 A;  5D6E A;  4BGD A;  3SFZ A;  2OZU A;  1J75 A;  2I8D A;  1ZG5 A;  5F0C A;  1WJA A;  5D5W B;  2DJI A;  1YHQ I;  1WQ2 A;  2M34 A;  1SMY F;  4RM2 A;  2V7F A;  2PMZ A;  2X9D A;  2MFZ A;  1KU3 A;  1UFM A;  2F5C A;  1MBF A;  2CW0 F;  1JKP C;  2R7F A;  1DP7 P;  4XN3 A;  2VJJ A;  1YIJ I;  3MN2 A;  4JOM A;  2QSG X;  3H3U A;  3DBH B;  3QPT A;  3UKG A;  3V7C A;  5EZH A;  3G71 I;  4IHY A;  2YX7 A;  4BJ6 C;  4FCY A;  2JA8 J;  4M3B A;  3OYF A;  2E2I J;  3IH3 A;  4EV0 A;  1TP4 A;  3F6O A;  4XOR A;  2OA4 A;  2VIX A;  5E18 F;  4HBL A;  1UST A;  1W36 C;  3EYI A;  5ICG A;  4HA8 A;  3DEW A;  1BL0 A;  3C2H A;  3DEU A;  3S2H J;  1GV2 A;  2HEO A;  3LSR A;  2K7L A;  2F4I A;  1R00 A;  5ILV A;  3MZ8 A;  3LNQ A;  2K02 A;  2RNG A;  3CES A;  1O3S A;  2A6E F;  3CO6 C;  2NNN A;  2VON A;  4HSR A;  3HXL A;  4PJN A;  3BTI A;  1O57 A;  2KIQ A;  2ZCW A;  1ZAR A;  3T0Y A;  1S8N A;  2UXX A;  3MFK A;  4P1W A;  2A69 F;  1REP C;  1HOM A;  4M3D A;  5D6F A;  3JRG A;  2EJR A;  3N97 A;  3OYL A;  3IHU A;  3KP4 A;  1WJF A;  2X85 A;  1UAA A;  2JUC A;  1WJ5 A;  2O03 A;  2LF8 A;  2ZC2 A;  5F0F A;  2ESN A;  2KRH A;  3L2Q A;  4QPO A;  1JJ6 C;  2DW4 A;  1AOY A;  2X51 A;  1J5Y A;  4S05 A;  3HG9 A;  1IUF A;  2DT7 B;  3BG5 A;  3KLN A;  2FOK A;  2DO7 A;  5CVV A;  5DCM B;  3ASN H;  3I55 I;  3GX4 X;  2EA2 A;  2V1N A;  3O2P E;  1YS6 A;  3R0J A;  5H2F C;  5IYC J;  5TRD A;  2BVL A;  2XGD A;  3KCC A;  1Y56 A;  3W2A A;  1IRG A;  3F21 A;  1IN7 A;  3HOY J;  1V5F A;  1YW8 A;  2K9Q A;  3TO9 A;  1U9N A;  3BCA A;  3BZ6 A;  4A0Y A;  2DJN A;  3H5R A;  1Y1W J;  3V4G A;  5LFA A;  1MNM C;  2E1N A;  1ZRE A;  4G6T B;  4B8X A;  1SFO J;  4XKB A;  4WXD A;  2PG4 A;  1HBX G;  2M8E A;  1BI0 A;  4C3I J;  3KIO A;  1UJ8 A;  1XCB A;  1BIB A;  3QQA A;  4BQN A;  2HXO A;  2HWV A;  4CZZ A;  4Z6Y A;  3EPZ A;  1OCZ H;  2HPI A;  4LB6 B;  1Z1D A;  3BTC A;  5FKK A;  3IWZ A;  1J09 A;  1XGS A;  4ENK A;  2Y0M A;  4IVN A;  1IN6 A;  5E3M A;  5KNL A;  3EUK L;  4D7M A;  4I01 A;  1RZ4 A;  2F5E A;  4YII A;  3S93 A;  2L9V A;  4G7H F;  1RUO A;  1F4K A;  3ZMZ A;  3FMQ A;  2H1K A;  4A5N A;  2CSO A;  3LOC A;  3I4P A;  1NH3 A;  4JX5 A;  4AWX B;  3FXU A;  3BQZ A;  2LBF B;  3ROU A;  1RET A;  3TOA A;  1FTT A;  4UNO A;  1P9Q C;  1H89 C;  1U0J A;  4KMF A;  5J47 A;  3HPH A;  3IAS 2;  3G2B A;  4IRH A;  2GXB A;  1LJ9 A;  2PJR B;  3P9C A;  1HDD C;  2W57 A;  3FDY A;  5ILS A;  5JLW A;  2X1E A;  1JT0 A;  2ZJR F;  4LG0 A;  2ZSI B;  2RVC A;  3WE3 A;  1D3Y A;  1MJ9 A;  2WAQ N;  2EZH A;  4OIR F;  3ZN0 A;  2E35 A;  3VEP A;  2K3P A;  4XLP F;  2P5L C;  1JGG A;  4J19 A;  4I02 A;  5L3E A;  3IAM 2;  5TIS C;  2ESH A;  5F08 A;  3FMR A;  4PJL A;  2FBH A;  1EKE A;  1W1W E;  1E0E A;  5FLM J;  5GAD J;  1ZHF A;  2CUF A;  4UVC A;  5IT9 Z;  2QZ8 A;  4Y3O A;  3I4N J;  1FX7 A;  2KFD A;  3VSL A;  5C3E J;  1BA5 A;  5FJ8 J;  4HQE A;  4C30 A;  1NG6 A;  2V6C A;  3WE2 A;  2LTP A;  4J01 A;  3RKW A;  2CFO A;  2R7T A;  4JQF A;  1KQ0 A;  3BZK A;  2FU4 A;  1H0M A;  1K78 A;  1X3W B;  2ELJ A;  1FT9 A;  3ZMV A;  5CVI A;  2Q2E B;  2ZBK A;  4BQA A;  2XPV A;  4L9J A;  3TW7 A;  3CDH A;  4IQJ A;  1EF4 A;  3K4B A;  2A6T A;  3V42 A;  2BEO A;  2NS7 A;  1ETQ A;  3GZ5 A;  4A3F J;  4DIQ A;  3WHC A;  1QU3 A;  3CLQ A;  2BY2 A;  1MBK A;  2O7O A;  3PO2 J;  5B1B H;  1FOW A;  5K5O A;  3CCM I;  1EH8 A;  2CW7 A;  2E5Z A;  4R8H A;  4HLY A;  3WTT C;  4N0B A;  1KU9 A;  2KIF A;  1IJW C;  1TQI A;  2Z33 A;  2OBP A;  3G1O A;  4HNT A;  4IHV A;  1X2M A;  5LEK A;  3FK7 A;  1HST A;  3IKT A;  1T0F C;  1DP3 A;  3PJR A;  2VQG A;  1LVA A;  3S3N A;  2WV1 A;  1POG A;  4ENN A;  2IT0 A;  3CCJ I;  4KIS A;  2L7K A;  1JUM A;  1P4W A;  2FA5 A;  1MBE A;  5B66 C;  1P7J A;  2BGC A;  2TDX A;  3KZY A;  5GPC A;  4NQW B;  1T8I A;  2L7F P;  2YSR A;  4KJZ A;  1AKH A;  2V9K A;  4O6J A;  4A3G J;  4X1E A;  1Q1H A;  2E1C A;  3GTL J;  5HNF A;  3DWL E;  3E5X A;  3GFL A;  3FF5 A;  2QLZ A;  3K6G A;  4M6X A;  5EG0 B;  2V9P A;  1W5C C;  3MMY B;  4N4N B;  3WOD F;  4JBA A;  4DGW B;  1O7L A;  2EA4 A;  4WF2 A;  3JSO A;  1N75 A;  2NYX A;  3I71 A;  3HSE A;  4R79 A;  2DA6 A;  3S3O A;  3PIO F;  2DA3 A;  4PFO A;  5CJ9 A;  1MDM B;  3CUO A;  4GDF A;  1UG0 A;  4RGU A;  2DT6 A;  1UHS A;  2MC4 A;  1ORK A;  2QGU A;  4GRI A;  1OJL A;  1WZ2 A;  5E1W A;  2DOF A;  2ISZ A;  3TO6 A;  3Q0V A;  5CVR A;  3A0B C;  3M9A A;  3OOP A;  4CCK A;  1X1D A;  4A0Z A;  4MGR A;  2O61 A;  2GWR A;  2VOO A;  5GAG J;  1R7J A;  1JJ8 C;  4P96 A;  2MH2 A;  1JXS A;  1R5I D;  4CH7 A;  4BBS J;  2ELK A;  2KPM A;  1MJB A;  3GME A;  4QLC U;  4M72 A;  4G7O F;  2H1L A;  1IGN A;  2QBY B;  3CQZ J;  3ECO A;  5KK1 A;  3ZXS A;  4IL6 C;  1E2X A;  5LRR A;  5LGU A;  2XAH A;  2CWE A;  4LIU A;  3WGI A;  2BW3 A;  3PSF A;  3MCZ A;  3KX2 A;  1ZRF A;  4PDK A;  4RB2 C;  2D2W A;  4MQ9 F;  1J7K A;  3Q5F A;  1XG1 A;  2R7O A;  3T8T A;  5JVG F;  3FK6 A;  2AQE A;  3D0S A;  1UCR A;  1DQU A;  1YJW I;  1QRY A;  3KYL A;  2VN2 A;  1EA3 A;  1UEL B;  4LMY A;  3JRC A;  5E3O A;  1SC7 A;  4BH9 A;  1MH3 A;  4N9I A;  2VL8 A;  4BHP A;  5F6F A;  1KQ9 A;  3F0C A;  2ECB A;  3F8M A;  5FKM A;  1QGP A;  2DPU A;  2A5W A;  3CDL A;  2XGC A;  4ANJ A;  1MW7 A;  4OIN F;  3GVA A;  3GFJ A;  2WY8 Q;  3CCE I;  2MA3 A;  3D5R C;  2F4M B;  3RPQ A;  1D0Y A;  3K7A J;  1DPR A;  3C7J A;  3LFK A;  1YS7 A;  4DZJ A;  1X3U A;  3FM3 A;  3M8J A;  3PUF A;  1XGO A;  4W97 A;  4Y15 A;  4S0H B;  1RR8 C;  1FMV A;  2HPM A;  2M2E A;  3J81 K;  4AVZ A;  1S72 I;  3V7R A;  3I5U A;  1MBH A;  3HKZ N;  2W25 A;  2CW8 A;  2EBI A;  3DF8 A;  1B59 A;  3K4M A;  2ZXI A;  5BPI A;  4Q5S F;  2IPQ X;  5D8K B;  4HAM A;  3A0H C;  1O7F A;  1TNS A;  3BR0 A;  3KZZ A;  3E6D A;  2I5U A;  1IXS B;  2D1H A;  4ZDL A;  1I5Z A;  2ZB9 A;  2VT3 A;  3LQR A;  1GDT A;  2QCO A;  4ZTF A;  5CYV A;  2LD5 A;  4XKV A;  3LSP A;  3TED A;  4ZYA A;  1VQN I;  2VC0 A;  3BR6 A;  3CUQ B;  2A05 A;  2WA0 A;  2COB A;  4MEY F;  4O5V A;  1W36 D;  1DGW Y;  1TT5 B;  4ESF A;  1O3Q A;  3KP7 A;  3H0G J;  3HYI A;  4LGW A;  4KIG A;  1ZH5 A;  3BP8 A;  2GAU A;  2HQ5 A;  5EEG A;  4E6K G;  1YRN B;  3I4M J;  1PDN C;  2VI6 A;  4F55 A;  1L3L A;  3W3C A;  2PX9 A;  4A3D J;  5DYM A;  3QYB A;  3RQ4 A;  2MH9 A;  3OL3 A;  5C4J J;  1U5T B;  3DKW A;  5E3L A;  1E17 A;  1I1G A;  4HZF A;  2XAG A;  1B9N A;  2MG4 A;  1ONV A;  5JHF A;  2P8T A;  2NVX J;  2NVQ J;  2FOW A;  5F0H A;  1YJ9 I;  3HTS B;  3DPT A;  3F6V A;  2WB1 A;  2KL4 A;  3H9Q A;  5HOD A;  1ZLK A;  4M3G A;  4PJJ A;  3H3Z A;  3OOU A;  1FSH A;  3MKW B;  1ZYR F;  1MKM A;  2MSY A;  5EGO B;  2A5Y B;  4OIO F;  2E34 A;  1EH7 A;  1U9O A;  2GZW A;  4NDL A;  2EFO A;  3AG3 H;  4UVA A;  3QP5 A;  4V19 K;  2RQQ A;  1VF9 A;  1IO2 A;  2M7A A;  3R0A A;  4MQV A;  2CMP A;  1LDD A;  2PN6 A;  3MKL A;  5KAF C;  1VZ0 A;  2XKP A;  1OMI A;  1E3H A;  1NHA A;  2QF7 A;  3AFH A;  3FZV A;  2KP6 A;  2J5O A;  2XPU A;  4II3 A;  1OCT C;  1JUS A;  1G6N A;  1JKQ C;  4BU2 A;  4CDG A;  1R5G A;  4NUB A;  2O8X A;  5FFX A;  2DMP A;  1WFX A;  2KIS A;  5IP7 J;  1FC3 A;  3MAJ A;  3GUD A;  3KP2 A;  4EJO A;  4KMU X;  2G9W A;  2KIM A;  3F8F A;  3FKJ A;  2YUS A;  1KON A;  1VQ4 I;  2MGQ A;  3E5Q A;  4ZYD A;  2XAS A;  2WWY A;  1YO5 C;  4QTR A;  3CMM A;  4U87 A;  4K2E A;  2GXG A;  3T5X A;  4ESJ A;  3BY6 A;  3FBN B;  5FD6 A;  3AAF A;  4Q47 A;  1NK3 P;  2L7Z A;  1R6R A;  3M8F A;  1ULY A;  2F48 A;  3SFI A;  3GTM J;  3ZQG A;  2GOX B;  3GBG A;  2GIV A;  4BYY A;  3AL0 C;  1KU2 A;  3WTV C;  1QHG A;  4WCG A;  2KT0 A;  1WJE A;  4KDP A;  2OAZ A;  4QSH A;  2FBK A;  2JTV A;  4YEL A;  2IGN A;  2XVC A;  4ZZD A;  2VJI A;  2YPR A;  1QVU A;  1TWH J;  3HBL A;  1HF0 A;  4RLF A;  3GWZ A;  4NHJ A;  3BQY A;  4N9H A;  3HRT A;  1TL8 A;  3S1Q J;  1XGM A;  3I58 A;  2XSD C;  3DLA A;  2PLY A;  2EWN A;  4HV6 A;  5IP9 J;  5DUI A;  1SD4 A;  3VYS B;  4YFN F;  3DU6 A;  3JRF A;  2G7H A;  5E1X A;  4IKF A;  3R61 A;  2LDU A;  1MZB A;  1IRF A;  2CU7 A;  5LGN A;  3ERE D;  1ERD A;  2XF7 A;  3P9K A;  2P0W A;  4GFB A;  2GBY A;  3OY9 A;  2W1O A;  3MZH A;  3FMS A;  3ULQ B;  3P7N A;  2XRO A;  1YW9 A;  1X1C A;  4LJZ F;  4KNY A;  4DBQ A;  2J5P A;  1A36 A;  3B02 A;  1P7I A;  2DOE A;  4B43 A;  2G7U A;  3REO A;  4BAC A;  1ZGA A;  2HOS A;  2KJC A;  3VSK A;  1YE9 A;  4XRS A;  1DUX C;  2Z9O A;  3GTK J;  4KYW A;  2R93 J;  1QA6 A;  4DZP A;  2HR3 A;  1JKO C;  1FP1 D;  3QWL A;  4G6D A;  4G12 A;  2BZT A;  1IDY A;  2P81 A;  4UXN A;  4BBR J;  5HDN A;  3LA7 A;  3A03 A;  3E6M A;  5K5Q A;  2P6S A;  2MW8 A;  2X48 A;  4XMY A;  2VBW A;  3VFZ A;  2GA2 A;  1HLV A;  5GTI C;  5DCM A;  1VQL I;  2HNH A;  5J4Y A;  3DLL F;  1APL C;  1LKX A;  1ON1 A;  3BR3 A;  3ZQH A;  2FQ3 A;  2P7V B;  4MO7 A;  4PK4 A;  3F3X A;  2AQF A;  3OV8 A;  4U0Y A;  3K70 C;  1OQY A;  1X3Z B;  4XLC A;  1YI2 I;  1RPW A;  3WTU C;  1JTX A;  1BJA A;  4IRG A;  2M4G A;  3CZ6 A;  2PFB A;  2Y0S N;  2UV1 A;  5ICE A;  1TWF J;  3J81 Z;  1FIA A;  3BPX A;  4UUS B;  3LSJ A;  5JI6 A;  1BI1 A;  5IYB J;  2JRT A;  3BJ6 A;  3IUO A;  4M71 A;  1T56 A;  1YG2 A;  3JR9 A;  2K5C A;  2B9S A;  2LMD A;  2R92 J;  1CQT A;  1WH7 A;  1FPQ A;  2LR8 A;  1LE8 B;  1SFX A;  2ZXW H;  5F27 A;  2L9N A;  5HLH A;  2BXY A;  4UUT A;  4WXH A;  2BY3 A;  4HF0 A;  5F04 A;  1ACI A;  2KZV A;  2LBF A;  3FXJ A;  5D4S A;  1LFB A;  1ZRC A;  2OF7 A;  5H20 A;  3C2B A;  5L3F A;  2DU9 A;  4CCJ A;  2PJR A;  1QQI A;  3SZT A;  3SZG A;  4NC8 A;  4LK1 F;  1FP2 A;  1FOY A;  1MIJ A;  1ZEL A;  3JRI A;  3CME I;  2ZSH B;  4JX4 A;  5L3C A;  3E6C C;  1QPI A;  2PMZ N;  3SHF A;  1PP7 U;  3HSR A;  3NWS A;  1HKS A;  4BJT A;  4IO9 F;  2ADU A;  2Z2S B;  3HHH A;  1Y0U A;  4M9X A;  4XOP A;  3SDB A;  2FML A;  1MH4 A;  2EFQ A;  3M3Y J;  2LG4 A;  3CCV I;  1LEA A;  2NXN B;  3QPL A;  4PGG A;  2AXT C;  3ABU A;  5M5W J;  3NRV A;  4D0P A;  3CC2 I;  5HS9 A;  3BDD A;  2Y9Y A;  3DBL B;  1MMN A;  5JFR A;  1FMW A;  4XLA A;  3WTY C;  1JE8 A;  1M1E B;  1I1S A;  2R7R A;  3MQ0 A;  3BT9 A;  1MD0 A;  3PFY A;  3WGH A;  3WHB A;  3QYE A;  5CVJ A;  5KAI C;  3TKY A;  4II2 A;  1W5S A;  2WV0 A;  5D5X B;  2IGK A;  4Q48 A;  4L0Y B;  4Y52 J;  2X4H A;  4IHW A;  3HSF A;  3A2K A;  4XBF A;  2ZJP F;  2Q2E A;  4D5C A;  1BOB A;  3H9G A;  1XMX A;  4YEJ A;  2DA1 A;  5IOZ A;  1BI3 A;  2VJ5 A;  4ENJ A;  4LIV A;  2ZXJ A;  3CUQ C;  2IBD A;  5K7Z A;  2DI3 A;  4NBQ A;  1LFU P;  3TOB A;  5C44 J;  3WU0 A;  4FTH A;  2HYJ A;  2I10 A;  2CJJ A;  3Q0U A;  2HYG D;  4HLX A;  1XMA A;  2OPT A;  2DA4 A;  3OS2 A;  3OYK A;  1J59 A;  4IJA A;  2DBB A;  3MEX A;  4AU7 A;  5FFZ A;  4E7J A;  4YFX F;  1ETK A;  1OCC H;  1DU0 A;  3C1D A;  1R23 A;  4GGG A;  3TMO A;  1EV7 A;  2D5V A;  4RBO A;  3L2R A;  1OIS A;  3E5U A;  3R60 A;  4NQW A;  4A3E J;  4HEA 2;  3LSH A;  4L18 B;  2RAE A;  3O3K A;  1PVE A;  1Y39 A;  2C6Y A;  2NOJ B;  5FKL A;  3G6E I;  1RUN A;  2NVT J;  1W0T A;  2BHZ A;  2IA2 A;  1XB4 A;  5EG0 A;  3HIF A;  2LKX A;  1B72 B;  4EVI A;  5J3L A;  1STZ A;  2Y2Z A;  1B4A A;  2YX4 A;  5J4V A;  2OZ6 A;  4CHU A;  4W1U A;  2QM3 A;  3T8R A;  2HQN A;  1WWX A;  2HI3 A;  4A69 C;  2COM A;  1XDS A;  2DOA A;  4D5F A;  3S1R J;  2YU3 A;  3ZMS A;  1MDM A;  2AHQ A;  1TWC J;  4MTE A;  2M9H A;  1YW7 A;  3OIP A;  1SVL A;  3EYY A;  4ZDP A;  3DEE A;  1W7P B;  3BOQ A;  4LOC A;  1JKR C;  1MSF C;  3WGG A;  1OYY A;  2OUM A;  4NC7 A;  1IV6 A;  4CCO A;  3GEZ A;  1SAU A;  2BHY A;  3ABM H;  2M5W A;  3ZN1 A;  2IS6 A;  1IRX A;  2LRD A;  3FKI J;  4L5J A;  3UR3 C;  1G3Y A;  5JVT A;  3G73 A;  4FHT A;  2Y69 H;  2VJ4 A;  2JRM A;  2JN6 A;  4XL9 A;  1ODD A;  5EJC A;  4M9S A;  1HW1 A;  4ITV A;  4RLQ A;  4YFK F;  2Y75 A;  3GTO J;  1LEB A;  3VPR A;  2QBY A;  1XGN A;  3GFI A;  3KE2 A;  2K4B A;  1SD5 A;  4B1R A;  5E1Z B;  2M1B A;  5HVQ C;  2DLL A;  1LVK A;  3E7L A;  2FX0 A;  4E7L A;  1VQ8 I;  1X1P A;  2DA5 A;  3H5A A;  3KEQ A;  5J1Y A;  4JYK A;  4CSW A;  3IRR A;  4M6Y A;  4L0Z B;  6PAX A;  2L3D A;  2L54 A;  5LGT A;  4E7K A;  2BOL A;  3JRD A;  2VBY A;  5EEA A;  4BXX J;  4AID A;  4AYB A;  4G6Q A;  4IXA A;  3OSF A;  3DPU A;  1VQ5 I;  3KLO A;  3CF5 F;  4RMN A;  1O4X A;  1QZZ A;  5FD5 A;  1S5L C;  3FX3 A;  1JHH A;  2MBF A;  4DYQ A;  2VXD A;  1Z67 A;  2ME6 A;  2ID3 A;  1U78 A;  2LC2 A;  3HOZ J;  5CVU A;  1X1A A;  4P55 A;  3ZMD A;  1XX5 A;  2FNP A;  2VPL A;  2FE3 A;  1ZG3 A;  2E5N A;  3H5N A;  4AIJ A;  1O3R A;  1CF7 B;  3VOE A;  2EPF A;  3OYN A;  1PUF B;  2EIL H;  2R5Y B;  1Z05 A;  3HEF A;  4EGZ A;  2F2E A;  2XAJ A;  1BR4 A;  2ZXH A;  4M73 A;  5GAH J;  1JI8 A;  2VKH A;  4G94 A;  1GV5 A;  1OCR H;  2RN7 A;  2DTZ A;  2OCE A;  1Z6T A;  3LSK A;  3CUQ A;  1E3O C;  1UHM A;  3FBI B;  1VQK I;  2QA4 I;  2MLK A;  2EV5 A;  2RQP A;  4OOI A;  1SAN A;  2IA1 A;  2V9V A;  3C3W A;  2DQL A;  2RKH A;  2HGC A;  4NC6 A;  3RKX A;  3TDU C;  4KUM A;  1Z0X A;  4ZC3 A;  5HS7 A;  2HDD A;  1WI3 A;  1YRN A;  2CQK A;  2UUZ A;  1ZG1 A;  2P7C B;  4DOZ A;  3Q3S A;  4A6E A;  4CCN A;  5B1A H;  3HOS A;  2L9S A;  1U5T A; 
#chains in the Genus database with same CATH homology
 3OS0 A;  2WBM A;  3DTK A;  3QYB A;  4BE2 A;  3RQ4 A;  4BXF A;  1Z21 A;  3OL3 A;  2ZFU A;  3RPU D;  5JHF A;  3S3M A;  3ZGK A;  4ZJZ A;  2DXI A;  2L2O A;  2OV7 A;  2R7X A;  4P5O A;  3VYT B;  3DU5 A;  3DPT A;  3ZRG A;  2WB1 A;  2KL4 A;  2HU9 A;  3H9Q A;  2VAS A;  4XQF A;  4PJJ A;  2CUZ A;  3OOU A;  3MKW B;  2CUJ A;  2Z16 A;  5CQG A;  2KRC A;  4LIT A;  3S8P A;  2R7U A;  4IX7 A;  4PSX A;  5FRN A;  2W7N A;  2RQQ A;  2M7A A;  3OYM A;  2CMP A;  2XAU A;  5HOO A;  3K70 D;  2VQC A;  1PYV A;  1VZ0 A;  2VXZ A;  3AFH A;  2V6E A;  4II3 A;  2KP6 A;  3U21 A;  3ZR8 X;  4F91 B;  4BU2 A;  5HLT A;  4NUB A;  3H9J A;  2Y0S A;  4OAZ A;  3H35 A;  2F6C A;  2IXS A;  4XM3 A;  1WFX A;  4FAS D;  1WJC A;  3FKJ A;  2MYS A;  4XR6 A;  4F92 B;  1TZL A;  2VQL A;  3D5S C;  2XC7 A;  3CP8 A;  1MND A;  3VYR B;  1KON A;  2X6Y A;  4KT6 A;  5CQE A;  3OYJ A;  2LY1 A;  2VB6 A;  2RRE A;  3RTR A;  3OYD A;  3K10 A;  5CKT A;  1S9H A;  3CMM A;  4U87 A;  1SFK A;  5KCM A;  3FBN B;  3CF2 A;  3OYB A;  3OYG A;  1R6R A;  4HPQ A;  2F5V A;  3EUA A;  4XON A;  3N05 A;  2GOX B;  2JVH A;  3GBG A;  3AL0 C;  4OAY A;  1AA7 A;  1QHG A;  4BGD A;  3DKX A;  1WJE A;  1D0Z A;  2I8D A;  4YEL A;  2IGN A;  1WJA A;  1V5G A;  1Y6I A;  2VJI A;  2HVR A;  2DJI A;  4B48 A;  4U7B A;  3EUH C;  4RM2 A;  2V7F A;  2PMZ A;  2KHM A;  4RLF A;  2KMU A;  1N78 A;  2M0M A;  2MFZ A;  4HST A;  3DLA A;  3W2V A;  2WAQ A;  1OLT A;  3VYS B;  3DU6 A;  3VWB A;  3AL0 B;  2IGO A;  1YX3 A;  1BR2 A;  4XN3 A;  2VJJ A;  4XOT A;  2XSJ C;  4BDY A;  4JOM A;  4IKF A;  2LY2 A;  5FRM A;  4FET A;  2CV0 A;  1ERD A;  4MLO A;  2XF7 A;  2VQH A;  2P0W A;  4BJ6 C;  4BE1 A;  3OY9 A;  3RSN A;  2W1O A;  3OYF A;  3ZQQ A;  3HPG A;  4XOR A;  2VIX A;  4CA0 A;  1X1C A;  1W36 C;  2KQR A;  4XN0 A;  4DBQ A;  4EAT A;  4C2T A;  3C2H A;  5CPR B;  3PNT A;  3OYH A;  4B43 A;  2KLO A;  4BAC A;  4E7S A;  2F4I A;  2LRE A;  5LD2 C;  2RNG A;  3CES A;  4E7H A;  3VSK A;  2QKM B;  3QOD A;  4H4K C;  4HSR A;  1YE9 A;  3HXL A;  4PJN A;  4IZZ A;  3D5L A;  2W82 A;  2Z1D A;  2M3A A;  4B44 A;  4XKC A;  3LSM A;  4P1W A;  3K4J A;  4BS9 A;  1D1B A;  4HG2 A;  3OYL A;  2OC6 A;  4XMY A;  1WJF A;  2X85 A;  1UAA A;  1WJ5 A;  2XDV A;  2KRH A;  3L2Q A;  4QPO A;  1PJR A;  2X51 A;  3HG9 A;  3HC7 A;  2HNH A;  2DT7 B;  3MD2 A;  1LKX A;  3HOT A;  3OYE A;  1GLN A;  2MAB A;  4PK4 A;  2AQF A;  2V1N A;  3K70 C;  1LDK B;  2BVL A;  4XLC A;  2MD0 A;  1Y56 A;  3W2A A;  2M4G A;  3OWT A;  4E7I A;  3CZ6 A;  1MMG A;  2CS3 A;  1V5F A;  2UV1 A;  3BCA A;  3E1S A;  1HA8 A;  3BLY A;  3H5R A;  3K4C A;  5LFA A;  4CCL A;  3ONQ A;  4G6T B;  4F3Q A;  4XKB A;  2R7V A;  3IUO A;  4KIT B;  4F52 A;  2E1M C;  1TT0 A;  2K5C A;  3DTE A;  2WAD A;  4DJA A;  4BQN A;  3EPZ A;  1YX5 A;  2HPI A;  2WAE A;  3VYU B;  4LG3 A;  4IQ4 A;  1J09 A;  2L9N A;  5KNL A;  3EUK L;  2X1D A;  3PL8 A;  3OR2 C;  3S93 A;  4X0G A;  3W3C A;  2KZV A;  2LBF A;  2IS2 A;  2WAF A;  3F9K A;  1D1C A;  2VLA A;  2W00 A;  2LBF B;  4HRI A;  1K6Y A;  3L2U A;  4CCJ A;  1P9Q C;  3VDX A;  2PJR A;  3PUB A;  3SZG A;  1U0J A;  4NC8 A;  1ZEL A;  3A4C A;  3HPH A;  3IAS 2;  3G2B A;  2ZSH B;  4Y4R A;  3OS1 A;  2PJR B;  3FDY A;  3NWS A;  2X1E A;  3K4K A;  4BJT A;  2ZSI B;  2Z2S B;  4XOP A;  3SDB A;  3OYA A;  3DKY A;  4OWR B;  2K3P A;  2LG4 A;  3OMY A;  4XLF A;  3IAM 2;  2FUG 2;  4BDZ A;  4PJL A;  3HL2 A;  1MMN A;  1DGR M;  1FMW A;  4XLA A;  1E0E A;  3TBI A;  4BUP A;  2R7R A;  3BG6 A;  4YRV A;  3PFY A;  3L2W A;  1G59 A;  4Y33 A;  3TL4 X;  3AKZ A;  3QYE A;  4Y3O A;  4II2 A;  2JUG A;  3VSL A;  3FHN A;  2UWM A;  2DCE A;  2IGK A;  2KDO A;  2R7Q A;  3BG7 A;  1X19 A;  4C30 A;  1NG6 A;  3RCO A;  3LMM A;  3QYF A;  3A2K A;  4J01 A;  4D1Q A;  2CFO A;  2R7T A;  1WJD A;  4JQF A;  4DBR A;  4BQQ A;  1BOB A;  3H9G A;  1D1A A;  2L5Q A;  3ZCO A;  3PNV A;  2ELJ A;  3BCB A;  2Q2E B;  4YEJ A;  4CCM A;  2VJ5 A;  3DPL C;  4LIV A;  4IQJ A;  3K4B A;  2A6T A;  3V42 A;  3W2W A;  3OYC A;  2W4S A;  4DIQ A;  3OIQ A;  1QU3 A;  3OS2 A;  3OYK A;  3A1Y A;  1OR7 C;  2M4K A;  2CW7 A;  4AU7 A;  2E5Z A;  3L2V A;  3HKZ A;  1MMD A;  4E7J A;  2Q1Z B;  4BE0 A;  4CUG A;  3NWT A;  3K4N A;  4HNT A;  3TMO A;  2V26 A;  2CV1 A;  1T0F C;  1DP3 A;  2GOM A;  3PJR A;  2VQG A;  3L2R A;  3S3N A;  4PSW A;  1X1B A;  1MNE A;  4KIS A;  1WJB A;  2L7K A;  1LFP A;  1V5E A;  4HEA 2;  3LSH A;  2LYC A;  2LOO A;  4NQW B;  3E0J B;  2NOJ B;  2CH0 A;  4KJZ A;  2HVS A;  5KHD A;  3PSI A;  2V9K A;  3DTI A;  3DQV C;  5HNF A;  3DWL E;  3BC8 A;  4N4O B;  2V4J C;  3K6G A;  3OL4 A;  3M1C A;  2HVQ A;  3OR1 C;  2R7S A;  3MMY B;  4N4N B;  4DGW B;  4J00 A;  1N75 A;  2DOA A;  3OYI A;  2M7B A;  3CJR B;  1X4O A;  4B3X A;  4R79 A;  2HZD A;  3S3O A;  5HNH A;  3OIP A;  4PFO A;  4NNJ A;  3PNY A;  1UG0 A;  3DEE A;  4ZDP A;  4PFP A;  2DT6 A;  4GRI A;  2MC4 A;  3UNG C;  2BVM A;  2OUM A;  4NC7 A;  2X6W A;  4CCO A;  4C2U A;  1SAU A;  3C2G A;  2IS6 A;  1IRX A;  2LRD A;  2E1M B;  4ZTJ A;  3UR3 C;  1X1D A;  4CCK A;  2R7W A;  4BEH A;  3J7A Y;  3CJQ B;  1T95 A;  4CZC A;  2JA2 A;  2VJ4 A;  4RM3 A;  4XL9 A;  4BEH B;  4ZDO A;  4BL0 B;  3CP2 A;  4ITV A;  4RLQ A;  4CH7 A;  3HUG B;  2KPM A;  4BQO A;  3KEY A;  3K4L A;  2CV2 A;  2QKL B;  2JVG A;  5HVQ C;  3ZXS A;  2IGM A;  1LVK A;  4HNU A;  2K9M A;  4E7L A;  2IS4 A;  1N77 A;  4LIU A;  3H5A A;  2BW3 A;  3PSF A;  4CSW A;  4E4H A;  3KX2 A;  1G8X A;  1Z7L A;  2BW3 B;  4E7K A;  2BOL A;  2K9L A;  2R7O A;  4PUS A;  2AQE A;  1Z3X A;  1DQU A;  3KYL A;  4AYB A;  1EA3 A;  2R4G A;  1UEL B;  2XF6 A;  3DPU A;  3LSG A;  4RMN A;  2VL8 A;  2LH9 A;  2O5R A;  2A5W A;  2VXD A;  4QPQ A;  4F93 B;  2LC2 A;  1MMA A;  4ANJ A;  1MW7 A;  2WY8 Q;  1X1A A;  4XKW A;  2IS1 A;  4D9J A;  3D5R C;  1D0Y A;  3S32 A;  2VPL A;  3M8J A;  2E5N A;  2HPM A;  3H5N A;  1FMV A;  1D0X A;  4AVZ A;  4E7Z A;  3OYN A;  3QOE A;  3LSI A;  1Z3Y A;  2CW8 A;  3I3L A;  3K4M A;  2ZXI A;  4XLH A;  2HDW A;  1NG7 A;  2ZXH A;  1BR4 A;  2HQA A;  3LL7 A;  3SEQ A;  4C9Y A;  1JI8 A;  2VKH A;  3MKZ A;  3SEZ A;  4BJ5 C;  4XLE A;  4ZDL A;  5FRO A;  3LSK A;  4B47 A;  3SYT A;  3FBI B;  3MKY B;  3I9V 2;  4ZTF A;  4XKV A;  4ZYA A;  3IP4 B;  5TGT A;  2WA0 A;  3LFU A;  4ZC3 A;  1W36 D;  1BR1 A;  2E60 A;  2L9S A;  4PJM A;  1DGW Y;  2X6X A;  2UUZ A;  4DOZ A;  4CCN A;  3H0D A;  2VKD A;  4XNF A;  3HOS A;  1X4P A;  1QHH D;  2WY7 Q;  4E6K G;  2XF5 A;  2X1C A;  4F55 A;  2JSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...