2LRGA

Nmr structure of the protein yp_001300941.1 from bacteroides vulgatus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
126
structure length
126
Chain Sequence
b'GASDFQTGIHKIVIQQSGDTDSFEVSVSIGGADKGGPAKLYNDKGEYIGDSYSAQIRTATMSCCTNGNAFFMTCAGSVSSISEAGKRLHITVIGYIDDKEVNRLEKEYITDGNTLIETFSVSTKEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title NMR structure of the protein YP_001300941.1 from Bacteroides vulgatus
rcsb
source organism Bacteroides vulgatus
molecule tags Unknown function
total genus 18
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2012-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.60.60 Mainly Beta Sandwich Lipoxygenase-1 Lipoxygenase-1 2lrgA00
3U6GA 2LRGA 4QEYA
chains in the Genus database with same CATH superfamily
3BNDA 1N8QA 1HU9A 2PPLA 3PZWA 4WHAA 1RRHA 4NREA 3IBZA 2WXTA 1BU8A 2KXVA 3VF1A 3FG3A 2IUKA 4QWTA 2XFDA 1FGOA 5EEOA 2PVSA 1NO3A 1OLPA 3V99A 1RRLA 1JNQA 2QZ7A 1IK3A 2XHHA 1FGTA 2FNQA 3U6GA 3FG4A 1QMDA 4WFOA 1GYGA 2SBLA 2LG7A 1FGRA 2WXUA 1F8NA 1LOXA 1KHOA 4QEYA 1LNHA 3CWZB 1QM6A 2LGEA 3BNBA 2IUJA 1ROVA 1HPLA 2P0MA 1ETHA 1LPBB 1W52X 3V98A 2LRGA 3FG1A 1YGEA 2WY6A 1CA1A 1Y4KA 1LPAB 3BNEA 3BNCA 2QNGA 3O8YA 1FGMA 1FGQA 2OXEA 2KXTA 1N8SA 3V92A 1RP1A 2XHJA 1GPLA 2XFEA
chains in the Genus database with same CATH topology
2LGEA 2LG7A 4QEYA 2XHHA 2XFDA 3U6GA 2XHJA 2LRGA 2XFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6G A;  2LRG A;  4QEY A; 
#chains in the Genus database with same CATH topology
 3BND A;  1N8Q A;  1HU9 A;  2PPL A;  3PZW A;  4WHA A;  1RRH A;  4NRE A;  3IBZ A;  2WXT A;  1BU8 A;  2KXV A;  3VF1 A;  3FG3 A;  2IUK A;  4QWT A;  2XFD A;  1FGO A;  5EEO A;  2PVS A;  1NO3 A;  1OLP A;  3V99 A;  1RRL A;  1JNQ A;  2QZ7 A;  1IK3 A;  2XHH A;  1FGT A;  2FNQ A;  3U6G A;  3FG4 A;  1QMD A;  4WFO A;  1GYG A;  2SBL A;  2LG7 A;  1FGR A;  2WXU A;  1F8N A;  1LOX A;  1KHO A;  4QEY A;  1LNH A;  3CWZ B;  1QM6 A;  2LGE A;  3BNB A;  2IUJ A;  1ROV A;  1HPL A;  2P0M A;  1ETH A;  1LPB B;  1W52 X;  3V98 A;  2LRG A;  3FG1 A;  1YGE A;  2WY6 A;  1CA1 A;  1Y4K A;  1LPA B;  3BNE A;  3BNC A;  2QNG A;  3O8Y A;  1FGM A;  1FGQ A;  2OXE A;  2KXT A;  1N8S A;  3V92 A;  1RP1 A;  2XHJ A;  1GPL A;  2XFE A; 
#chains in the Genus database with same CATH homology
 2LGE A;  2LG7 A;  4QEY A;  2XHH A;  2XFD A;  3U6G A;  2XHJ A;  2LRG A;  2XFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...