2LRQA

Chemical shift assignment and solution structure of fr822a from drosophila melanogaster. northeast structural genomics consortium target fr822a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
85
structure length
85
Chain Sequence
MNYSTGTDANTLFVDGERVLCFHGPLIYEAKVLKTKPDATPVEYYIHYAGWSKNWDEWVPENRVLKYNDDNVKRRQELARQCGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Fr822A from Drosophila melanogaster.
rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords NuA4 complex subunit EAF3 homolog
total genus 11
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lrqA00
4BD3A 2BKDN 2RI2A 2GFAA 4RG2A 3P8DA 2QQRA 2JZ2A 3NTKA 4FU6A 4PLIA 3OS0A 4NS5A 1WJRA 4Z02A 5KH6A 4C5EA 2DAQA 4E7HA 3OYMA 2YRVA 3L2VA 5FROA 1SSFA 2R57A 3MP8A 3META 1OZ2A 3MEUA 3ZEHA 3O8VA 2M0OA 5D6WA 4BDYA 4LD6A 3OYNA 2O4XB 2F5KA 2MWOA 3LX7A 4II1A 2LVMA 4IUTA 2LTOA 2RJEA 4N4IA 3L2QA 1XNIA 3QJ6A 1KHCA 2BIVA 2X4WA 2L3RA 5J26A 3OYCA 3FLGA 5KE3A 3L42A 4CRIA 4E7LA 2HQEA 1WGSA 2NLUA 2RJFA 3PNWC 2R5MA 3FDRA 3OA6A 2K3XA 3MP6A 4C5IA 2RHYA 3DB4A 4A4EA 3S3NA 3DB3A 4PLLA 2GFUA 2GF7A 4BE0A 3UT1A 2R58A 5J39A 3H8ZA 2EQKA 4L59A 2RHXA 3S3OA 1RI0A 2EFIA 3PFSA 4X34A 3OYKA 2E6NA 3NTIA 1OZ3A 4A4GA 4N4HA 3OYBA 2WACA 4Q5WA 3LLRA 3E9FA 2RI5A 2RJCA 3C4SA 2EKOA 5KCOA 5M9OA 3QKJA 3OB9A 4IUVA 3OYEA 2CKKA 3F70A 4GY5A 4QQ6A 1N27A 2RHZA 2X35A 5CIUA 2O4XA 4B9XA 2E5QA 2XK0A 3OYLA 2R5AA 4IKFA 2L8DA 5FRNA 3S6WA 3L2UA 2X4XA 5KCHA 5IAYA 3FC3A 2QQSA 3OYGA 3UWNA 3OS1A 4A4HA 4HCZA 2X4YA 2XDPA 3OMCA 2L89A 2LRQA 5C6SA 3NTHA 3OYAA 1MHNA 2EQUA 2EQJA 3ME9A 5D6XA 4ZTJA 4E7KA 5C0MA 4UC4A 4N4GA 3OQ5A 3PMTA 4QQDA 4C5GA 3MEWA 4PL6A 5D6YA 4B9WA 2IG0A 3MEVA 4BACA 2RI3A 3BDLA 3S3MA 3FEOA 3DLMA 2DIGA 4E7IA 2PQWA 3L2RA 3EAEA 2RJDA 1H3ZA 3LH0A 2LDMA 2M1HA 3LGFA 3L2WA 4E7JA 2BUDA 3QIIA 1WJSA 2B8AA 3OYJA 1G5VA 2HQXA 4FL6A 4ZTFA 4QW2A 4A4FA 3OYDA 3MP1A 3QBYA 3MO8A 4C5HA 4QVZA 4IUPA 3GOXA 2RHUA 3KUFA 3M9QA 3OYFA 4BE1A 4IUQA 4IURA 2M16A 1OI1A 2MWPA 5FRMA 2RO0A 2D9TA 4IUUA 3OYHA 2K3YA 4EDUA 5KE2A 3OMGA 4QQGA 3OS2A 4OVAA 3OY9A 2FHDA 3P8HA 3ASKA 3LGLA 1WJQA 4BE2A 3E9GA 3H6ZA 3OYIA 2DIQA 2G3RA 2RHIA 3MEAA 3PMIA 1OYXA 2P0KA 5IN1A 3SD4A 2JTFA 3LYIA 3Q1JA 4BDZA 2VYTA 2LCCA 3CEYA 2EQMA
chains in the Genus database with same CATH superfamily
1F1BB 4A54A 1T3SA 1U3OA 1WJRA 2WSEE 2DK3A 4C92G 3I56A 5GAOl 2CP2A 2O4XB 3CCUA 2DRMA 2DFUA 2JN0A 1ZUUA 2L2PA 2NUPA 4CRIA 2OTLA 4LDUA 3H0FA 1YIJA 1YJNT 4M7DE 4F7UE 3QHSA 1VQ9Q 2K79A 2QEXA 1K9AA 4J9CA 1KIKA 4N4HA 1SEMA 2NUTA 2D8JA 4PJOE 3V8KA 1OPKA 3V7RA 1PHTA 2L3SA 4O5VA 1Y96A 4F7UA 1I1JA 4J7FA 2VWFA 1B3QA 1VYVA 3JRZA 3EHRA 3L2UA 5LL6S 1K8AU 2DVJA 3CPWP 1YP5A 2KVQG 4FW2A 3OYAA 5C6SA 4OB3B 4E7SA 1ZHIA 3VU3C 4PL6A 2EJFA 1IO6A 2D6FA 3RIRA 1OU9A 1R77A 1VYTA 1JEGA 1JBMA 2FYKA 4RCBA 3OYJA 2HSEB 1E6HA 4J6YA 1TU0B 4L5GA 4QVZA 3CC4Q 3GIBA 1RLPC 3D7SB 3C95A 1WXBA 1QCNA 2M16A 3OBWA 3ULRB 2OX7A 2ZPIB 1CKBA 1VQLT 1C1AA 3I56Q 2QK0A 2F2WA 2WSFE 1M4ZA 1YCSB 4EMKB 3P8DA 1B07A 4C8QF 2KRMA 4KRTA 4ZN1A 5L23A 2J06A 3JCMd 5FU7B 1ZX6A 3J80E 4C92D 2K5IA 4XTXA 5GAMj 4XTYA 2LT1A 4M77A 5GAN5 3JCMg 2NUTB 1HXDA 2JMAA 1W2BS 4PJOF 2PTKA 4A4EA 1YJ9Q 1M27C 3C94A 3QO3A 4XU0A 2XI9A 5I2SA 3H8ZA 4VUBA 3OYKA 3FJPA 3CC2A 1G3TA 1QKXA 1Y96B 4M78C 2RJCA 2LC4A 2VXEA 3C0CA 3FB9A 4IUVA 2KDSA 2HL5C 2I0NA 1G8XA 3OS1A 4ESRA 1YBYA 5KYWA 3TSWA 3PGGA 4J9DA 1Q81R 3JCMJ 2YRCA 1R8OB 1JJ2S 3MHXA 4D8DA 4YTLA 1WX6A 3SDZA 1U5SA 2CZ7B 3CCLQ 2ZPGB 3CCMA 2J7IA 1Y71A 2CUDA 5GJWB 2YSQA 4OGEA 4KH1B 1EFNA 4F16A 1H3ZA 2LDMA 2M1HA 5FU6C 3CC2Q 5EC7A 3EG3A 4QW2A 1WZOA 4PJMA 4C5HA 3JB9G 3JB9D 1OX8A 2O31A 3JB9J 5CQXA 5I11A 4DOVA 4JZ3A 2CS7A 5GANg 2RMOA 2Y90A 4BE2A 5GAN4 1NLOC 3MEAA 1M3AA 2KYBA 1N8RU 3OW2S 1QP2A 5HCKA 1KC8R 2QA4T 2EBPA 3CPWS 1QVFP 2YT6A 2DM1A 5IH2A 1UUEA 2CGHA 4II1A 2DXBA 4M78E 2EJ9A 4LDYA 3QPHA 2DE0X 2QGGA 1RAIB 4M75C 1SHGA 3HKSA 2XG8D 3CMET 2X9HA 1M90R 3EGDA 2DXTA 3FRNA 2GFUA 2GQVA 2VKNA 2J6OA 1GFCA 2EAYA 2HKQB 1Q86R 4D6WA 2KGTA 2CYZB 1UJYA 4JRPA 1MMGA 3HPWA 2KMTA 1Y07A 3J81E 3JCMh 2CZ1B 4GY5A 5CAIA 2DYIA 4EMKC 3X25B 2RQTA 1YNZA 2EVRA 4F04B 3JCMV 3S6WA 3CCET 1U8RA 2VC8A 4RTWA 1PG5B 4A53A 2RK2A 1UDLA 2FL7A 3PE0A 4RKUE 2JVVA 2KRSA 1D09B 1MNEA 4UC4A 4PJOC 1LVKA 1YITT 3HRUA 4HXJA 2A08A 2RI3A 3UDCA 3DLMA 4JJCA 1GCQC 2ECZA 3I35A 2RJDA 4C8QA 4MZMA 1D3BA 3L2WA 1VQNA 1HJDA 1WJSA 4E7ZA 5GMKm 1BI1A 4WTOB 1BU1A 1VQPA 1S72Q 2LNHB 1M1FA 2O01E 1WHKA 2PUKB 2QA4Q 3OMGA 2QI2A 1UG1A 4OMMA 4OMOA 1FMWA 2COYA 3EFSA 2YLCA 1VQKT 3VS5A 2DBMA 1M2VA 2GFAA 2D1XA 3OS0A 5KH6A 4Z02A 2DX1A 1VQ9A 2ABLA 2YRVA 1Q82R 3M55A 1KSWA 1FXXA 4V2SA 3EG0A 3CCJT 4BDYA 2BTTA 3LX7A 3CCSQ 3L2QA 4M78G 3QJ6A 1KHCA 2COWA 4RTYA 3M56A 1TOVA 3JB9F 3SWNC 5KE3A 4F14A 1PM3A 2K3XA 1SG5A 2M51A 3S3NA 3OW2A 1TXQA 4AFQC 2EQKA 1RI0A 2DKGA 1WLPB 2XICA 3H41A 3CPFA 2DVEA 2J6FA 1NBEB 4M77C 3E9FA 5AYFA 1K73U 3MPUB 5EG2A 1Q7YC 3X26B 3VRYA 2M9UA 2R5AA 4NOYA 1D1AA 1D0XA 1G2BA 2QDYB 1BK2A 4FYYB 2EGCA 2XDPA 4HCCA 3CBMA 1IHVA 1VQLA 4L6V5 4C0FA 2ED1A 3HTRA 1K76A 2V26A 2XKOC 1N9RA 5GAOp 2CSIA 2DMOA 3VUZA 1V29B 4OMNA 3GPLA 4J6WA 2PVGB 2KT1A 1GBRA 1ZUKA 1KK7A 2QAZA 4BE1A 2EYQA 4MDWA 2K3YA 3CMAA 4Z89A 3GNFB 4RTVA 1BIAA 3TREA 1YHQQ 3CC4T 2EGAA 4BDZA 2VYTA 4C8QG 2XMFA 3QWYA 2FO0A 3EFOA 1J3TA 3I56T 2DD4A 4C0DC 4FT2A 2YUQA 2DILA 3FIFA 5FROA 1X69A 4OB1B 2IIMA 1VQKA 2EPDA 1PRLC 4BI4A 1OZ2A 3EGDB 1VQPQ 3R6OA 1XNIA 1ZA2B 3MKDA 1VQPT 1Q81U 1FYNA 4KGXB 3LWIA 1G3YA 1VQMQ 2YXYA 2LX9A 2HAXA 1M90U 2FPFA 1RI9A 3DB3A 1GBQA 5GAOq 2ENMA 1VQMT 4LDWA 1NZ9A 3ZBDA 2NWMA 4HVWA 1VQ9T 2KRNA 2A28A 1RABB 2A36A 2RPNA 3QKJA 1DJ7B 1NM7A 3F70A 4A4KA 1N27A 1RACB 1VQ5A 2BZYA 4IKFA 3H9NA 1IRXA 1Q81C 1I81A 2X4XA 2QQSA 5LJ5d 2EQJA 2RM4A 5KYYB 1IREB 1SPKA 2HNIA 2RB6A 1WHGA 2YDLA 1SRMA 5CKEA 4RTXA 5LJ5e 5DM7R 1YJNQ 4AG1C 2X51A 4M75A 2CP5A 2PVOB 2CT3A 2DZ9A 4IIOA 2BZ8A 2AHJB 4M77F 1PWTA 5A2QE 4JJBA 3MO8A 1WA7A 2MCNA 2RHUA 1I5OB 3EFOB 1LOJA 2HZYA 3M9QA 3MJXA 3JAME 2ROLA 2D9TA 2VGNA 4RUGA 1NJIR 4DQ2A 3SD4A 4C92F 3U23A 2RN8A 3UA7A 2DNUA 1OU8A 3UA6A 4OMFB 2QA4A 4MZTA 3PTAA 3L2VA 1QQJA 3JCMW 3ZEHA 1ARKA 1NE8A 3O8VA 4FM4B 2K2MA 3RESA 4CC4B 3CCQA 4JRIA 8AT1B 5I22A 3WXMB 1YJWQ 2JUFA 2E10A 1QWFA 5LJ5h 1YITQ 2HCKA 1YIJQ 3M59A 4LDVA 2OI3A 4K11A 3PIPA 1ACMB 2VASA 4LN2A 5IXFA 3CCJQ 1PNJA 2QEXQ 1Q7YU 1O9SA 1NPRA 1VA7A 2LJ1A 3LW5E 1UGQB 1UFFA 2EWNA 1VQKQ 3GNGA 4M75G 4A4GA 2DTIA 4Q5WA 4LXCA 4Y92A 1B34B 2E5KA 3CCMT 5HY6A 3C4SA 1XOVA 3M0RA 7AT1B 5GAOn 3M0SA 4QQ6A 1G3SA 2DYBA 3CBOA 5GANe 2QQ9A 4KT0E 1VQOQ 2MPXC 1QCOA 4GLMA 3IQLA 3CCQT 4R56A 2AT1B 3CCEQ 2EQUA 5CKFA 1BB9A 4N4GA 3OW2P 3PMTA 1EZZB 1QMCA 4M77E 2GBQA 4EMGA 4FT4A 4OF1A 2QTVA 3RKYA 1FX7A 3M0UA 3BDUA 1Q95G 2DL8A 5I2MA 5CO7A 1YI2Q 2DF6A 4FL6A 3OYDA 3M4YA 2XU8A 1K0XA 3A8MB 2K9GA 5LJ3f 1RAGB 2ZGWA 2LJ0A 2L3QA 2DPPB 1M8MA 4M7DG 3G4ST 2F2XA 1JJ2A 2DIQA 3JCMe 2V8JA 5KYNA 2Z0WA 5IN1A 3PMIA 3CCVQ 1JQQA 2LCCA 2DERA 1JXOA 2V1RA 4M78D 3EH1A 2JXBA 4NS5A 4M7AE 1U1TA 5IHNA 4M75F 5GMKj 4E7HA 3OYMA 4M78B 2LP5A 1WI7A 3MP8A 2FPEA 3NHNA 2L0AA 2KE9A 4PFZA 4P5NA 1VQ6A 1LJOA 1HK9A 2DL4A 2RQRA 4HVVA 2RJFA 2SRCA 3X20B 2K2VA 3X24B 3M57A 4JS4A 1MNDA 4PLLA 3CCMQ 1JU5C 4AMCA 4C92C 2AZVA 1FWZA 4EMHA 4X34A 3NTIA 5GAOr 1VQMA 1QP3A 5DLQE 3BFMA 1XTDA 3OB9A 3GP8A 2JTEA 2LQWA 3M0QA 2X35A 1PKTA 1Y57A 1S72T 3VKIA 1YWOA 1WHHA 1S1NA 3BY7A 5FWBA 2KNBB 3OBYA 1E7OA 2EGEA 4RMOA 4ZTJA 1WHMA 3HRSA 1AVZC 1HD3A 2MAMA 3THKA 1RAFB 2LNVA 1VQOA 2WSCE 4XTUA 1X6BA 2GTOA 2M02A 3LH0A 5KYXA 2GNCA 4PJOG 3JCMP 3HL8A 1YIJT 1I8FA 3QZ5B 5CKBA 3V7CA 3CXCA 1VQ4A 4M7AC 3QBYA 1WDXA 3JCMc 4M75D 4ELYC 1B7TA 1K9MC 4QKUA 1UE9A 3M5AA 4M7DA 2O9SA 4RTTA 2FHDA 1VQOT 1OYXA 3JB9I 3M54A 4PJLA 1YITA 3ZL7C 5GANj 2E4HA 1Z9QA 2OJ2A 2RH2A 2A3LA 3TCJA 1D0YA 4C92E 4M7AD 1VIFA 3MEUA 3CC2T 1X27A 3OYNA 1OV3A 4QVDA 3VUBA 1YJNA 2LX7A 1M2VB 3CMAT 1WPYA 1HSQA 1SF9A 1OPLA 2MMPA 3AT1B 2A37A 4HT9A 4A63B 2FPDA 4FSSA 2D0QB 2BE7D 2F5TX 1D0ZA 2QDLA 5GAN2 3RNJA 1KQSP 2SEMA 3C12A 2C06A 2E6NA 3QYGB 2GTJA 2PZ1A 1UB4A 4ANJA 3EGXB 1Q86U 2HBWA 4FIBA 4MMKA 1M3BA 2JS2A 1UEBA 2HDAA 1WIEA 5FU6B 5FRNA 3A98A 5IAYA 3OYGA 4FCYA 4A4HA 1YHQT 1RAAB 2DA9A 1D1CA 3CCST 3N5BB 4N0AC 2EYZA 1KJWA 1AWWA 4C5GA 1IXDA 4BACA 3BDLA 1KQ1A 2QASA 1SRLA 2JMCA 3FEOA 3I55A 1WQ7A 2IVWA 3G6EQ 3NFCA 2ZCFB 3LGFA 1WHLA 4E7JA 4PFPA 3NGPA 4IUPA 2MYSA 3OYFA 4KH0B 2DXCA 2RO0A 1VQNT 2A7YA 3CCQQ 2C0OA 1UGRB 1V1CA 2LQNA 2RHIA 3WVEB 3VS3A 1VQNQ 1VQLQ 1TUDA 4J5YA 3OYYA 4XQ3A 3CMEA 2NUZA 2QQRA 1M9SA 5AT1B 3CC7A 3CCRQ 3E2UA 5A0LA 1YCYA 2JM8A 4LD6A 1K73R 4Z88A 4N4IA 1ZBJA 2QTXA 5GAN7 1KD1U 4J9EA 3CD6Q 1SKUB 2GF7A 4WF2A 4BE0A 2P84A 3AHUA 2V8KA 1KC8C 4L59A 5GAN3 1M90C 4M7AA 1AEYA 2LCLA 1PKSA 1NEBA 2ZPFB 3JCMX 4C92B 4XK8E 4ZGEB 5CCAA 4D8KA 2JM9A 5CIUA 1ZSGA 2RA2A 4TVRA 2OAWA 1RLQC 4J9FA 4X1VA 4HCZA 4PK4A 5GAMe 3OS5A 3EFRA 2QG9B 4R0KA 1MV3A 2PNIA 1MHNA 4C8QC 1K9MU 3JSCA 5D6YA 3RKXA 1MMNA 4B9WA 4DBFA 3MEVA 2ZPBB 5DLOA 1AHJB 1XJWB 3QIIA 1JRIA 3VJPA 1QKWA 2GCXA 3M4GA 1D3BB 1NEGA 2OTJA 4KUDK 2KBTA 1ABOA 3H6ZA 1KQSS 1VQ7A 4ME7A 2VUBA 1T0HA 1M1KU 1VQ7Q 2FB7A 3PIOA 4BD3A 2KI7A 2KXCA 3PVQA 2XD0A 2COZA 2ESWA 3CCLT 1QVGS 2L3PA 2E70A 5D6WA 3I5SA 1IGQA 1YWPA 1YJWA 4ZNXA 1K1ZA 4Z8AA 1CKAA 2LVMA 2V8IA 4N0AA 3QYHB 1R0CB 4DA4A 1K9MR 1BIBA 4AG2C 3V7SA 2HL3A 5CK9A 5CKDA 4E7LA 2NLUA 4BUGA 3FDRA 4C5IA 3KBGA 2RHYA 2YUPA 4F7UG 1Q86C 2DRKA 5GAOm 3SFMA 1TUGB 1S72A 2DTHA 1AWOA 3CD6T 1YJ9A 4C8QE 2H3EB 1ZSZC 1PD0A 2WACA 1Y0MA 2O88A 3I9QA 1HYOA 2DTOA 5KCOA 2ATCB 2KSSA 5A0DA 2DETA 4EIKA 4LDXA 4B9XA 4PKCC 5KCHA 1WFWA 3G7ZA 5GMKl 1PSFA 1ZUYA 1QCFA 4XU2A 1U06A 2FG0A 4ZGJB 2DXUA 1GFDA 3OMCA 3TEEA 4XAXB 9ATCB 3JV3A 4LE9A 1H8KA 4QQDA 3MEWA 1VQ6T 3I5RA 4C92A 4PJJA 4DOWA 2PQWA 4FW1A 1KFZA 4XTWA 4HVUA 1WNLA 1BI2A 4PJOA 1VQ5T 2NYSA 4A4FA 1WXUA 3RMSA 1M1KR 5LJ3e 3CC7Q 4M78F 1A0NB 1BYMA 4IURA 1OI1A 2MWPA 3QJYA 4M75B 1OX9A 3HHTB 2DO3A 4XU1A 3VV0A 1W4SA 1KG1A 2DEQA 3CCSA 1PC0A 3P8HA 3E9GA 2G3RA 3EGXA 3T9NA 1WQWA 2HD0A 5LJ5f 3LYIA 2P4RA 1LPLA 1BCMA 1Q82C 2RI2A 1CSKA 1X75C 2E3HA 4JZ4A 1K8AR 1AOJA 2AZSA 2OTLT 2HKNA 5KYUA 3URGA 3M0PA 5HKCA 2B86A 3WVDB 1VQ4T 5DY9A 1GXIE 1W2BP 4X9CA 1K4US 1ABQA 2MOXA 2RJEA 1N6AA 4HT8A 1BI3A 1RL2A 2AIRB 2C0IA 3HFNA 2VVKA 4JJNK 3MP6A 2YUOA 1AT1B 1OULA 1UECA 3DB4A 3NMZC 1QVPA 3PVLA 2PU9B 2VXFA 5J39A 1RAEB 2RHXA 3CBPA 5GMKi 3S3OA 4E47A 5GANd 2QEXT 2YHTA 4XU3A 2J6KA 2EW3A 3CCVT 2RI5A 1W1FA 4M77B 3EG1A 2OTJQ 2O2OA 4CI0C 2E3IA 2KY9A 1QW1A 2OTJT 3UWNA 4BI3A 2Y4YA 2YLBA 1RUWA 3KFVA 2E6ZA 1N8RC 1ZSZA 2KQWA 2DIGA 4HKEA 3RBBB 2YWWA 2KYMA 1N5ZA 3TVTA 2BUDA 5CKHA 4X9DA 4J9IA 4KULA 5KYYA 3NPFA 2ROTA 2LCSA 1KQSA 2HMAA 1NJIC 3G71A 1G83A 3G1JA 4J83A 4J6XA 2RD1A 3G4SA 3OS2A 3OY9A 3V8LA 1YI2A 1P92A 1IZ6A 2K6DA 2FZCB 1WYXA 3TQ7P 3QG1A 2F69A 4HCKA 3X28B 2A0FB 2W10A 3UATA 5GANf 3R6NA 5I21A 2HEQA 4C0GA 2F2VA 1WHJA 4C5EA 2KAFA 1B34A 4BI8B 4GBQA 3DKMA 3QDFA 1ZBXA 1YN8A 2PUOB 3CD6A 3META 2CSQA 2DL3A 2I2LA 4O6JA 2AK5A 1VQ4Q 2FZKB 4J9BA 4KUIA 1AZGB 2CT4A 5IXBA 1OEBA 2BIVA 1NYFA 3GBQA 3INZA 4QVCA 2HSPA 3EG9A 2R5MA 4MZPA 1IHWA 2LT4A 3VS2A 3TU4K 3QXEB 3OSSC 1BBZA 1GCQA 5HK3A 4KGVB 1I4K1 3ER0A 1OZ3A 2LJ3A 2ZPHB 3OYBA 3CCRA 3REBB 2EKOA 3CCLA 4ELZC 4J7IA 3VS0A 3J7AF 1GCPA 3GLXA 1V76A 4OGCA 2RHZA 3VRZA 2O4XA 1H3HA 5LJ3h 3OYLA 2K5LA 2AKKA 5HK0A 3FC3A 4M78A 2E65A 4M4ZA 2X4YA 5CVIA 4ATOA 2L89A 4E7KA 5C0MA 5D7UA 3OQ5A 4M77G 4FYVB 2IG0A 5J3BA 3S3MA 3CCRT 1ZLMA 2D0NA 4JDSA 1W70A 4F7UF 2JW4A 3A8HB 3G71T 1YFNA 3G6EA 2KROA 1LNXA 1G5VA 5CQYA 2MK5A 2DBKA 2P4TA 1MGQA 4IUQA 2DLPA 2FEIA 1YHQA 4MDXA 3SEMA 5KE2A 5KYWB 3M58A 3OYIA 1UHCA 2DD5A 2EQMA 5LJ5g 2BKDN 3EG9B 3LH5A 4PLIA 1VUBA 1W2BA 1VQ6Q 3L2ZA 2CZ0B 5GAMg 4PNOA 1UGPB 2GQIA 2R57A 5LJ5j 4PJOB 1M1KC 4JJDA 2W0ZA 4KBMB 3RUXA 1OOTA 3CQTA 4AFUC 1AZEA 2LTOA 3EGUA 1EX4A 1SSHA 2LQKA 2DL7A 2Y4XA 1I5LA 2EYWA 4OMPA 3L42A 2HQEA 2GGRA 1PSEA 1TWBA 1TS9A 1G3WA 2EKHA 1H641 3G6ET 2DZCA 3OSVA 1AD5A 3M53A 4BY6B 3QWXX 1M2OA 3RMQA 5KYUB 3CC7T 2LMJA 4F17A 2FVUA 2K57A 4AT1B 2X4JA 5IT9E 4AFSC 3CPWA 1QLYA 1BI0A 1I0CA 2H8HA 2L8DA 5CR2A 4E2FB 1M5Q1 2CZ6B 1MV0B 3E1SA 1VOMA 1MMDA 4M7DB 2FRWA 4B6MA 4R55A 3NTHA 3VS6A 5L8RE 5GAN6 3H0HA 5ECAA 1M8VA 2CH4W 3EG2A 2ZZDA 2XDBA 4CC3A 1TG0A 4LUEA 1T0JA 2LZ6B 4AFZC 2RF0A 3BE3A 3VS7A 1VQ8T 2CDTA 2V1QA 4FYWB 4ZTFA 4RTZA 3A1PA 3QSUA 5A0GA 3I55T 1EIFA 1WXTA 2P0QA 2K3BA 4OMQA 1VQ8A 4WCIA 1X6GA 2CP0A 4ZN3A 2LQ8A 5GAN8 1WJQA 4EPCA 3VYHB 2P0KA 2ZPEB 5FW9A 2M0YA 4MMLA 1SHFA 3CXCS 2VV5A 1AWJA 4FU6A 4LD9K 2JNGA 4CC2A 1GRIA 1T3LA 2DAQA 4M7AG 1AWXA 2JJ9A 2D8HA 2F5KA 2MWOA 4E6RA 1X01A 3M0TA 2KT8A 2QQBA 2QXFA 3GF5A 1UHFA 2X4WA 4C8QD 2KXDA 1WGSA 3PNWC 1JJ2P 3EHQA 2KEAA 1PD1A 5GAMd 1K8AC 1X2KA 2R58A 1K0SA 1XQHA 3PFSA 2CP3A 3QDRB 3ZFJA 1BKBA 4JLIA 8ATCB 4PJOD 4QT7A 4RCCA 2CH4A 2EQIA 2E5QA 4C0ZA 2EJGA 2HQHA 4M77D 1Q7YR 2XHCA 4DBQA 1KC8U 2XIDA 3BW1A 1RADB 5LJ3d 5FWCA 3KXTA 1N8RR 1LCKA 1H92A 1TTHB 2LRQA 1VYUA 3ME9A 1KD1C 3VYGA 3A8LB 1TSFA 5GMKe 2FRYA 1NPPA 4J8OA 1NG2A 1QVGA 3EAEA 3RERA 3SWNA 1X2QA 3VS4A 4DEXA 1E6GA 4JUVA 3CMEQ 3GOXA 1VQ8Q 4Y28E 2QYZA 3QZ9B 1NJIU 5FRMA 1IGUA 2CREA 4EDUA 3I55Q 4OVAA 2AKLA 2HBPA 3LGLA 3L1AA 3Q1JA 3UF4A 2P0PA 3UPUA 2VB6A 2QQAA 3NTKA 2JZ2A 3RR6A 3JB9H 4M7DC 1QWEA 2DL5A 2RQVA 3CMAQ 3CCUQ 4NL3A 1K73C 4RG8A 1SSFA 1QVFS 5GAMf 1JO8A 1VQ7T 1TUCA 2X3WD 2EIFA 3CCJA 3SB2A 4BB7A 3A8OB 2X3XD 4JRKA 1U1SA 5J26A 2ED0A 3FLGA 1PRMC 1X6OA 5GAMh 2ZAEA 5FU7C 3PT9A 1O75A 2RNAA 1YJWT 1KD1R 2G6FX 2CP6A 2EFIA 4M7AF 1YJ9T 5IHIA 3CXCP 2O9VA 4PFOA 3JCMQ 3LLRA 4BY6C 2YRDA 2K4YA 5M9OA 1Y7XA 3OYEA 4RTUA 4JPBW 4EMKA 4Y91A 1W6XA 2XK0A 2EYXA 1FMVA 1NYGA 2BE9B 2CP7A 4DEYA 4JS5A 4HCBA 3HSBA 2JT4A 3FJ5A 4DBRA 3SHWA 2BZXA 1RAHB 5FLXE 1YI2T 3L2RA 2RQWA 3TSZA 3CCEA 3SWNB 2DEUA 3V8JA 3H0IA 2HQXA 2IPOB 3P8BB 4XTZA 1C6VX 2KK4A 3MP1A 3LWHA 2YUNA 4OMLA 3RKWA 2E64A 5GJVB 1UGSB 3G71Q 2H3JA 3JCMf 1UGVA 4C8QB 2RQUA 4CC7A 1KQ2A 1UJ0A 3E19A 2KR3A 3ASKA 1UTIA 1QVFA 4FSXA 1X43A 2JTFA 5IHKA 3CEYA 1OQKA 4RG2A 3MCAB 4KGZB 1JXMA 3HP9A 2VGMA 1KHIA 2XDDA 1TH7A 2JTMA 3HRTA 2M0OA 4JLGA 4IUTA 2JOYA 5GANh 4FYXB 1ZA1B 4F7UB 1NLPC 4OB0B 1M1GA 2L3RA 3OYCA 3EH2A 4IIMA 3A8GB 4M7DD 3OA6A 4LUDA 2NUPB 4DBHA 1C0MA 1PCXA 1IB8A 1ZQ1A 1FMKA 2MF2A 4OB2B 3UT1A 2MIOA 2RK1A 2DJQA 1R0BG 1BCOA 2E12A 1N9SA 4M7DF 4LNPA 2K5FA 4OP0A 5KYXB 1MUZA 2K7AA 4C0DB 2CKKA 1Q82U 4JRQA 6AT1B 2J05A 3HFOA 1JB0E 2DJZA 2PVDB 2L5QA 4GLKA 4J9HA 4ORZA 2OTLQ 2E1HA 2EYYA 3QUIA 5D6XA 2QGFB 2C0TA 4PJNA 2E41A 3A5ZB 3CCUT 2MI6A 2JS0A 3REAB 3DLLA 4J9GA 2CUBA 4NL2A 4E7IA 5GMKh 2OAUA 4ZGDB 2B8AA 1M30A 3G4SQ 3VS1A 4M7AB 5LJ3g 1QVGP 1VIEA 1VQ5Q 1D1BA 3O5ZA 1M3CA 3CCVA 3KUFA 1ZSZB 1GL5A 2F1LA 3JCMb 3CC4A 4IUUA 3OYHA 4XTVA 3RDVA 4QQGA 5LJ3j 1MMAA 2FZGB 4HA8A 4M75E 1Z9ZA 1I07A
chains in the Genus database with same CATH topology
4XQ3A 5LJ5g 3CMEA 2BKDN 3I56T 2DD4A 4A54A 4PLIA 2QQRA 1M9SA 1VUBA 4C0DC 2WSEE 1WJRA 1W2BA 4FT2A 3CC7A 3L2ZA 2DK3A 4C92G 3I56A 2CZ0B 3FIFA 5A0LA 5GAMg 5FROA 4PNOA 5GAOl 4OB1B 1UGPB 5LJ5j 2R57A 1VQKA 4PJOB 1M1KC 4BI4A 1OZ2A 4KBMB 1YCYA 3RUXA 4LD6A 2O4XB 3R6OA 2LTOA 4N4IA 1XNIA 3CCUA 2JN0A 2LQKA 1VQPT 2Y4XA 1Q81U 1I5LA 2QTXA 5GAN7 3L42A 4CRIA 2OTLA 2HQEA 3LWIA 1G3YA 4LDUA 1KD1U 2LX9A 2HAXA 1M90U 1PSEA 1YIJA 1YJNT 4M7DE 3DB3A 1G3WA 2GF7A 4WF2A 1H641 4F7UE 4BE0A 2V8KA 1KC8C 3QHSA 2DZCA 3OSVA 5GAOq 3G6ET 3M53A 2QEXA 1VQMT 4LDWA 1NZ9A 4L59A 4BY6B 5GAN3 1M90C 4M7AA 3ZBDA 3RMQA 2LCLA 4N4HA 4PJOE 2ZPFB 3V8KA 1VQ9T 3CC7T 3JCMX 4C92B 4XK8E 4ZGEB 2FVUA 2K57A 3V7RA 4O5VA 3QKJA 2X4JA 5CCAA 5IT9E 1Y96A 4F7UA 1DJ7B 3F70A 4J7FA 4A4KA 1N27A 3CPWA 5CIUA 1VQ5A 1BI0A 4IKFA 2L8DA 3JRZA 5CR2A 1Q81C 3L2UA 1I81A 2X4XA 1M5Q1 2RA2A 2CZ6B 2QQSA 3E1SA 4TVRA 5LL6S 1K8AU 4HCZA 2KVQG 5GAMe 4M7DB 3OS5A 3EFRA 3OYAA 5C6SA 3NTHA 4R55A 4OB3B 1MHNA 5L8RE 5GAN6 2EQJA 4C8QC 5LJ5d 2RM4A 1K9MU 1ZHIA 1M8VA 3VU3C 3JSCA 1IREB 5D6YA 4PL6A 3RKXA 4B9WA 2EJFA 2ZZDA 3MEVA 2D6FA 2HNIA 2RB6A 2ZPBB 2XDBA 5DLOA 5CKEA 5LJ5e 3RIRA 5DM7R 4M75A 1AHJB 1JBMA 2FYKA 2PVOB 2DZ9A 3QIIA 1JRIA 4RCBA 1VQ8T 2AHJB 4M77F 3OYJA 4ZTFA 5A2QE 3AHUA 4J6YA 3MO8A 4L5GA 3QSUA 4QVZA 3GIBA 5A0GA 3I55T 1EIFA 2P0QA 3VJPA 2RHUA 3C95A 1LOJA 3M9QA 1VQ8A 2M16A 3JAME 2GCXA 2D9TA 3M4GA 3OBWA 1D3BB 2VGNA 2ZPIB 1VQLT 4ZN3A 2OTJA 4KUDK 2LQ8A 4DQ2A 5GAN8 1WJQA 4EPCA 3H6ZA 3SD4A 3VYHB 4C92F 1KQSS 1VQ7A 2P0KA 4ME7A 2ZPEB 2VUBA 1M1KU 2WSFE 2FB7A 1M4ZA 4MMLA 2VV5A 4BD3A 4EMKB 3PIOA 3CXCS 3P8DA 4FU6A 4LD9K 2XD0A 2JNGA 4OMFB 4C8QF 2QA4A 4MZTA 2DAQA 4M7AG 4ZN1A 3PTAA 3JCMd 3L2VA 3CCLT 1QVGS 5FU7B 2E70A 3JCMW 3ZEHA 1NE8A 3O8VA 4FM4B 4C92D 5D6WA 3J80E 3RESA 2K5IA 1YJWA 2F5KA 2MWOA 4XTXA 3CCQA 2LVMA 4JRIA 4N0AA 1X01A 2V8IA 5GAMj 3QYHB 4XTYA 2LT1A 4M77A 3WXMB 4DA4A 2QQBA 1BIBA 2JUFA 2E10A 2QXFA 3GF5A 3V7SA 5GAN5 2X4WA 4C8QD 5LJ5h 3M59A 4LDVA 3JCMg 5CK9A 5CKDA 3PIPA 4E7LA 1HXDA 1WGSA 2NLUA 3PNWC 4BUGA 3FDRA 1W2BS 4PJOF 4C5IA 3KBGA 2RHYA 4A4EA 1Q7YU 4F7UG 3C94A 5GAMd 3QO3A 4XU0A 1Q86C 1K8AC 2XI9A 1O9SA 5GAOm 5I2SA 2R58A 3H8ZA 1NPRA 3SFMA 1S72A 2DTHA 1XQHA 3CD6T 1YJ9A 3LW5E 1UGQB 3PFSA 2EWNA 4VUBA 4C8QE 3GNGA 4M75G 4A4GA 2DTIA 3OYKA 3FJPA 3CC2A 1G3TA 2WACA 4Q5WA 3QDRB 3ZFJA 1BKBA 1Y96B 1B34B 2DTOA 4M78C 3CCMT 5HY6A 3C4SA 1XOVA 2RJCA 4JLIA 5KCOA 4PJOD 2LC4A 2VXEA 4RCCA 5GAOn 3FB9A 4IUVA 2KDSA 2KSSA 5A0DA 4QQ6A 1G3SA 4LDXA 3CBOA 4B9XA 5GANe 2E5QA 2QQ9A 4KT0E 4C0ZA 2EJGA 4M77D 2XHCA 4PKCC 5KCHA 1KC8U 2XIDA 3BW1A 3G7ZA 5LJ3d 5GMKl 3OS1A 1PSFA 4R56A 4XU2A 3KXTA 3CCQT 1YBYA 4ZGJB 2DXUA 3OMCA 3PGGA 2LRQA 2EQUA 3JCMJ 3ME9A 1KD1C 3TEEA 4XAXB 1R8OB 1JJ2S 5CKFA 3MHXA 4N4GA 3VYGA 3A8LB 3PMTA 4YTLA 4QQDA 3SDZA 2CZ7B 4M77E 3MEWA 2ZPGB 3CCMA 1VQ6T 1Y71A 5GMKe 4C92A 4EMGA 1NPPA 4J8OA 1YIJT 4FT4A 4DOWA 2PQWA 4OGEA 1QVGA 3EAEA 4XTWA 4OF1A 3RERA 3SWNA 1H3ZA 2LDMA 1WNLA 2M1HA 3RKYA 1FX7A 5FU6C 3BDUA 1BI2A 5I2MA 4PJOA 5CO7A 1VQ5T 4FL6A 4QW2A 4A4FA 3OYDA 3M4YA 2XU8A 3RMSA 5LJ3e 4C5HA 3JB9G 3JB9D 3A8MB 4JUVA 3GOXA 3JB9J 5LJ3f 4M78F 1BYMA 5CQXA 2ZGWA 4Y28E 3QZ9B 4IURA 1NJIU 1OI1A 2MWPA 3QJYA 4M75B 2DPPB 3HHTB 4DOVA 5FRMA 2CS7A 2DO3A 4XU1A 3VV0A 4EDUA 5GANg 1W4SA 3G4ST 4M7DG 1KG1A 2DEQA 1JJ2A 4OVAA 2Y90A 3P8HA 2HBPA 3LGLA 3CCSA 5GAN4 4BE2A 3E9GA 2DIQA 2G3RA 2V8JA 3MEAA 3PMIA 3L1AA 5IN1A 1WQWA 2HD0A 3T9NA 3LYIA 3Q1JA 5LJ5f 3JCMe 2LCCA 2P0PA 3UPUA 3OW2S 1Q82C 1QP2A 2RI2A 1N8RU 1X75C 2QQAA 4M78D 3NTKA 2JZ2A 2OTLT 3URGA 2QA4T 4NS5A 3JB9H 4M7DC 1U1TA 4M7AE 4M75F 5HKCA 5GMKj 3CPWS 3OYMA 3WVDB 4NL3A 4M78B 4E7HA 1K73C 1VQ4T 4RG8A 1SSFA 5DY9A 1QVFS 5GAMf 3MP8A 1GXIE 1VQ7T 4X9CA 2EIFA 3CCJA 2CGHA 3SB2A 4BB7A 3A8OB 4P5NA 4II1A 2DXBA 2RJEA 1N6AA 4M78E 1LJOA 2EJ9A 1HK9A 4JRKA 4LDYA 4HT8A 1VQ6A 3QPHA 1U1SA 4M7AC 1BI3A 1RL2A 5J26A 4M75C 3FLGA 3HFNA 1X6OA 3HKSA 5GAMh 2XG8D 2RJFA 5FU7C 4JJNK 3X20B 3PT9A 2K2VA 3CMET 3MP6A 1O75A 3X24B 3M57A 4JS4A 3DB4A 2DXTA 1QVPA 2GFUA 2GQVA 3FRNA 4PLLA 1YJWT 2PU9B 2VXFA 5J39A 4C92C 2EAYA 2RHXA 3CBPA 5GMKi 4E47A 2EFIA 1FWZA 4EMHA 4X34A 3S3OA 1YJ9T 3NTIA 5GAOr 4M7AF 5GANd 2QEXT 4D6WA 1QP3A 2YHTA 1VQMA 3JCMQ 4XU3A 2CYZB 3LLRA 5DLQE 4BY6C 3BFMA 3CCVT 2K4YA 1XTDA 4JRPA 2RI5A 3HPWA 5M9OA 2KMTA 3OB9A 1Y07A 1Y7XA 3OYEA 3GP8A 4M77B 3J81E 3JCMh 2CZ1B 4GY5A 4EMKA 5CAIA 2X35A 4Y91A 3X25B 4EMKC 2XK0A 4CI0C 1S72T 3JCMV 3S6WA 3CCET 3VKIA 1U8RA 2VC8A 2KY9A 1QW1A 2OTJT 4A53A 3UWNA 4BI3A 3BY7A 2Y4YA 2RK2A 2FL7A 2YLBA 4JS5A 4HCBA 3OBYA 4RKUE 3HSBA 2JVVA 4RMOA 4ZTJA 2E6ZA 3HRSA 4UC4A 1N8RC 4PJOC 2MAMA 1YITT 3HRUA 2KQWA 2RI3A 2LNVA 3UDCA 3DLMA 1VQOA 2WSCE 4XTUA 2DIGA 4HKEA 5FLXE 1YI2T 3L2RA 2RJDA 3LH0A 4C8QA 4MZMA 1D3BA 3L2WA 1VQNA 2BUDA 5CKHA 4X9DA 3CCEA 1WJSA 3SWNB 3V8JA 4PJOG 5GMKm 4KULA 2HQXA 1BI1A 3JCMP 3HL8A 4XTZA 1I8FA 3P8BB 3MP1A 2KK4A 3QZ5B 5CKBA 3V7CA 3LWHA 3QBYA 3CXCA 1VQ4A 3JCMc 4M75D 1KQSA 1NJIC 3RKWA 2E64A 1UGSB 4ELYC 2H3JA 1VQPA 3JCMf 1K9MC 4C8QB 3G71A 1M1FA 1KQ2A 2O01E 3M5AA 4J6XA 4J83A 2PUKB 2RD1A 3E19A 3OMGA 3G4SA 3OS2A 4M7DA 2QI2A 3OY9A 2FHDA 3V8LA 3ASKA 1YI2A 1P92A 1VQOT 1IZ6A 1QVFA 1OYXA 4FSXA 2JTFA 3EFSA 2YLCA 3JB9I 1VQKT 3M54A 3CEYA 3QG1A 2F69A 3X28B 1YITA 5GANj 2GFAA 4RG2A 3MCAB 5GANf 5I21A 2RH2A 3OS0A 2A3LA 3TCJA 5KH6A 4Z02A 4C0GA 4C5EA 3HP9A 1VQ9A 2KAFA 1B34A 4BI8B 2VGMA 2YRVA 1KHIA 3DKMA 4C92E 2XDDA 3M55A 1TH7A 1ZBXA 4M7AD 1VIFA 2PUOB 2JTMA 3CD6A 1FXXA 3META 3HRTA 3MEUA 4V2SA 3CC2T 2M0OA 2I2LA 4JLGA 3CCJT 3OYNA 4BDYA 4O6JA 3LX7A 4IUTA 2JOYA 4QVDA 3VUBA 5GANh 4KUIA 3L2QA 4M78G 1YJNA 4F7UB 3QJ6A 1KHCA 3CMAT 1WPYA 3M56A 4OB0B 3JB9F 1M1GA 2BIVA 2L3RA 3OYCA 3INZA 4QVCA 3SWNC 5KE3A 3A8GB 4M7DD 2MMPA 3OA6A 2R5MA 4MZPA 2K3XA 4HT9A 2LT4A 2D0QB 2F5TX 3S3NA 1ZQ1A 2MF2A 3OW2A 5GAN2 3TU4K 3QXEB 4OB2B 3OSSC 3UT1A 5HK3A 2EQKA 3C12A 2C06A 2RK1A 1RI0A 2DKGA 1I4K1 2E6NA 3ER0A 1OZ3A 2E12A 3QYGB 2XICA 2ZPHB 3OYBA 1UB4A 3CPFA 2DVEA 4M77C 5AYFA 1K73U 3E9FA 1N9SA 3CCRA 4M7DF 5EG2A 2EKOA 1Q7YC 2K5FA 4FIBA 4J7IA 3X26B 4OP0A 4MMKA 4ELZC 1Q86U 3CCLA 3J7AF 3GLXA 4C0DB 2CKKA 1Q82U 4OGCA 4JRQA 2RHZA 1UEBA 2O4XA 5LJ3h 2M9UA 2R5AA 3HFOA 5FU6B 3OYLA 5FRNA 2K5LA 4NOYA 1JB0E 2DJZA 2PVDB 5HK0A 3FC3A 5IAYA 4M78A 2L5QA 4GLKA 3OYGA 4A4HA 1YHQT 2E65A 2QDYB 2X4YA 5CVIA 2XDPA 4ATOA 2L89A 3CCST 3N5BB 2E1HA 4HCCA 4N0AC 3CBMA 3QUIA 5D6XA 4E7KA 5C0MA 4L6V5 1VQLA 4C0FA 3CCUT 2E41A 3A5ZB 3OQ5A 2MI6A 4M77G 4C5GA 2IG0A 4BACA 5J3BA 3BDLA 3S3MA 1KQ1A 3CCRT 3FEOA 2XKOC 1WQ7A 3I55A 3DLLA 4JDSA 2IVWA 1N9RA 4NL2A 5GAOp 3NFCA 4E7IA 2ZCFB 5GMKh 3VUZA 2OAUA 3LGFA 4F7UF 3A8HB 3G71T 4E7JA 4ZGDB 1V29B 2B8AA 3G6EA 3GPLA 1LNXA 4J6WA 1G5VA 2PVGB 5CQYA 4M7AB 2P4TA 5LJ3g 4IUPA 1VIEA 3CCVA 3KUFA 1MGQA 3OYFA 2EYQA 4IUQA 4MDWA 4BE1A 3JCMb 3CC4A 2DXCA 2RO0A 4IUUA 3OYHA 2K3YA 4XTVA 3CMAA 1YHQA 1VQNT 4MDXA 3GNFB 2A7YA 5KE2A 1BIAA 4QQGA 3TREA 5LJ3j 3M58A 1UGRB 3CC4T 3OYIA 2RHIA 3WVEB 4HA8A 4BDZA 4M75E 2DD5A 2VYTA 4C8QG 4J5YA 3OYYA 2EQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BD3 A;  2BKD N;  2RI2 A;  2GFA A;  4RG2 A;  3P8D A;  2QQR A;  2JZ2 A;  3NTK A;  4FU6 A;  4PLI A;  3OS0 A;  4NS5 A;  1WJR A;  4Z02 A;  5KH6 A;  4C5E A;  2DAQ A;  4E7H A;  3OYM A;  2YRV A;  3L2V A;  5FRO A;  1SSF A;  2R57 A;  3MP8 A;  3MET A;  1OZ2 A;  3MEU A;  3ZEH A;  3O8V A;  2M0O A;  5D6W A;  4BDY A;  4LD6 A;  3OYN A;  2O4X B;  2F5K A;  2MWO A;  3LX7 A;  4II1 A;  2LVM A;  4IUT A;  2LTO A;  2RJE A;  4N4I A;  3L2Q A;  1XNI A;  3QJ6 A;  1KHC A;  2BIV A;  2X4W A;  2L3R A;  5J26 A;  3OYC A;  3FLG A;  5KE3 A;  3L42 A;  4CRI A;  4E7L A;  2HQE A;  1WGS A;  2NLU A;  2RJF A;  3PNW C;  2R5M A;  3FDR A;  3OA6 A;  2K3X A;  3MP6 A;  4C5I A;  2RHY A;  3DB4 A;  4A4E A;  3S3N A;  3DB3 A;  4PLL A;  2GFU A;  2GF7 A;  4BE0 A;  3UT1 A;  2R58 A;  5J39 A;  3H8Z A;  2EQK A;  4L59 A;  2RHX A;  3S3O A;  1RI0 A;  2EFI A;  3PFS A;  4X34 A;  3OYK A;  2E6N A;  3NTI A;  1OZ3 A;  4A4G A;  4N4H A;  3OYB A;  2WAC A;  4Q5W A;  3LLR A;  3E9F A;  2RI5 A;  2RJC A;  3C4S A;  2EKO A;  5KCO A;  5M9O A;  3QKJ A;  3OB9 A;  4IUV A;  3OYE A;  2CKK A;  3F70 A;  4GY5 A;  4QQ6 A;  1N27 A;  2RHZ A;  2X35 A;  5CIU A;  2O4X A;  4B9X A;  2E5Q A;  2XK0 A;  3OYL A;  2R5A A;  4IKF A;  2L8D A;  5FRN A;  3S6W A;  3L2U A;  2X4X A;  5KCH A;  5IAY A;  3FC3 A;  2QQS A;  3OYG A;  3UWN A;  3OS1 A;  4A4H A;  4HCZ A;  2X4Y A;  2XDP A;  3OMC A;  2L89 A;  2LRQ A;  5C6S A;  3NTH A;  3OYA A;  1MHN A;  2EQU A;  2EQJ A;  3ME9 A;  5D6X A;  4ZTJ A;  4E7K A;  5C0M A;  4UC4 A;  4N4G A;  3OQ5 A;  3PMT A;  4QQD A;  4C5G A;  3MEW A;  4PL6 A;  5D6Y A;  4B9W A;  2IG0 A;  3MEV A;  4BAC A;  2RI3 A;  3BDL A;  3S3M A;  3FEO A;  3DLM A;  2DIG A;  4E7I A;  2PQW A;  3L2R A;  3EAE A;  2RJD A;  1H3Z A;  3LH0 A;  2LDM A;  2M1H A;  3LGF A;  3L2W A;  4E7J A;  2BUD A;  3QII A;  1WJS A;  2B8A A;  3OYJ A;  1G5V A;  2HQX A;  4FL6 A;  4ZTF A;  4QW2 A;  4A4F A;  3OYD A;  3MP1 A;  3QBY A;  3MO8 A;  4C5H A;  4QVZ A;  4IUP A;  3GOX A;  2RHU A;  3KUF A;  3M9Q A;  3OYF A;  4BE1 A;  4IUQ A;  4IUR A;  2M16 A;  1OI1 A;  2MWP A;  5FRM A;  2RO0 A;  2D9T A;  4IUU A;  3OYH A;  2K3Y A;  4EDU A;  5KE2 A;  3OMG A;  4QQG A;  3OS2 A;  4OVA A;  3OY9 A;  2FHD A;  3P8H A;  3ASK A;  3LGL A;  1WJQ A;  4BE2 A;  3E9G A;  3H6Z A;  3OYI A;  2DIQ A;  2G3R A;  2RHI A;  3MEA A;  3PMI A;  1OYX A;  2P0K A;  5IN1 A;  3SD4 A;  2JTF A;  3LYI A;  3Q1J A;  4BDZ A;  2VYT A;  2LCC A;  3CEY A;  2EQM A; 
#chains in the Genus database with same CATH topology
 1F1B B;  4A54 A;  1T3S A;  1U3O A;  1WJR A;  2WSE E;  2DK3 A;  4C92 G;  3I56 A;  5GAO l;  2CP2 A;  2O4X B;  3CCU A;  2DRM A;  2DFU A;  2JN0 A;  1ZUU A;  2L2P A;  2NUP A;  4CRI A;  2OTL A;  4LDU A;  3H0F A;  1YIJ A;  1YJN T;  4M7D E;  4F7U E;  3QHS A;  1VQ9 Q;  2K79 A;  2QEX A;  1K9A A;  4J9C A;  1KIK A;  4N4H A;  1SEM A;  2NUT A;  2D8J A;  4PJO E;  3V8K A;  1OPK A;  3V7R A;  1PHT A;  2L3S A;  4O5V A;  1Y96 A;  4F7U A;  1I1J A;  4J7F A;  2VWF A;  1B3Q A;  1VYV A;  3JRZ A;  3EHR A;  3L2U A;  5LL6 S;  1K8A U;  2DVJ A;  3CPW P;  1YP5 A;  2KVQ G;  4FW2 A;  3OYA A;  5C6S A;  4OB3 B;  4E7S A;  1ZHI A;  3VU3 C;  4PL6 A;  2EJF A;  1IO6 A;  2D6F A;  3RIR A;  1OU9 A;  1R77 A;  1VYT A;  1JEG A;  1JBM A;  2FYK A;  4RCB A;  3OYJ A;  2HSE B;  1E6H A;  4J6Y A;  1TU0 B;  4L5G A;  4QVZ A;  3CC4 Q;  3GIB A;  1RLP C;  3D7S B;  3C95 A;  1WXB A;  1QCN A;  2M16 A;  3OBW A;  3ULR B;  2OX7 A;  2ZPI B;  1CKB A;  1VQL T;  1C1A A;  3I56 Q;  2QK0 A;  2F2W A;  2WSF E;  1M4Z A;  1YCS B;  4EMK B;  3P8D A;  1B07 A;  4C8Q F;  2KRM A;  4KRT A;  4ZN1 A;  5L23 A;  2J06 A;  3JCM d;  5FU7 B;  1ZX6 A;  3J80 E;  4C92 D;  2K5I A;  4XTX A;  5GAM j;  4XTY A;  2LT1 A;  4M77 A;  5GAN 5;  3JCM g;  2NUT B;  1HXD A;  2JMA A;  1W2B S;  4PJO F;  2PTK A;  4A4E A;  1YJ9 Q;  1M27 C;  3C94 A;  3QO3 A;  4XU0 A;  2XI9 A;  5I2S A;  3H8Z A;  4VUB A;  3OYK A;  3FJP A;  3CC2 A;  1G3T A;  1QKX A;  1Y96 B;  4M78 C;  2RJC A;  2LC4 A;  2VXE A;  3C0C A;  3FB9 A;  4IUV A;  2KDS A;  2HL5 C;  2I0N A;  1G8X A;  3OS1 A;  4ESR A;  1YBY A;  5KYW A;  3TSW A;  3PGG A;  4J9D A;  1Q81 R;  3JCM J;  2YRC A;  1R8O B;  1JJ2 S;  3MHX A;  4D8D A;  4YTL A;  1WX6 A;  3SDZ A;  1U5S A;  2CZ7 B;  3CCL Q;  2ZPG B;  3CCM A;  2J7I A;  1Y71 A;  2CUD A;  5GJW B;  2YSQ A;  4OGE A;  4KH1 B;  1EFN A;  4F16 A;  1H3Z A;  2LDM A;  2M1H A;  5FU6 C;  3CC2 Q;  5EC7 A;  3EG3 A;  4QW2 A;  1WZO A;  4PJM A;  4C5H A;  3JB9 G;  3JB9 D;  1OX8 A;  2O31 A;  3JB9 J;  5CQX A;  5I11 A;  4DOV A;  4JZ3 A;  2CS7 A;  5GAN g;  2RMO A;  2Y90 A;  4BE2 A;  5GAN 4;  1NLO C;  3MEA A;  1M3A A;  2KYB A;  1N8R U;  3OW2 S;  1QP2 A;  5HCK A;  1KC8 R;  2QA4 T;  2EBP A;  3CPW S;  1QVF P;  2YT6 A;  2DM1 A;  5IH2 A;  1UUE A;  2CGH A;  4II1 A;  2DXB A;  4M78 E;  2EJ9 A;  4LDY A;  3QPH A;  2DE0 X;  2QGG A;  1RAI B;  4M75 C;  1SHG A;  3HKS A;  2XG8 D;  3CME T;  2X9H A;  1M90 R;  3EGD A;  2DXT A;  3FRN A;  2GFU A;  2GQV A;  2VKN A;  2J6O A;  1GFC A;  2EAY A;  2HKQ B;  1Q86 R;  4D6W A;  2KGT A;  2CYZ B;  1UJY A;  4JRP A;  1MMG A;  3HPW A;  2KMT A;  1Y07 A;  3J81 E;  3JCM h;  2CZ1 B;  4GY5 A;  5CAI A;  2DYI A;  4EMK C;  3X25 B;  2RQT A;  1YNZ A;  2EVR A;  4F04 B;  3JCM V;  3S6W A;  3CCE T;  1U8R A;  2VC8 A;  4RTW A;  1PG5 B;  4A53 A;  2RK2 A;  1UDL A;  2FL7 A;  3PE0 A;  4RKU E;  2JVV A;  2KRS A;  1D09 B;  1MNE A;  4UC4 A;  4PJO C;  1LVK A;  1YIT T;  3HRU A;  4HXJ A;  2A08 A;  2RI3 A;  3UDC A;  3DLM A;  4JJC A;  1GCQ C;  2ECZ A;  3I35 A;  2RJD A;  4C8Q A;  4MZM A;  1D3B A;  3L2W A;  1VQN A;  1HJD A;  1WJS A;  4E7Z A;  5GMK m;  1BI1 A;  4WTO B;  1BU1 A;  1VQP A;  1S72 Q;  2LNH B;  1M1F A;  2O01 E;  1WHK A;  2PUK B;  2QA4 Q;  3OMG A;  2QI2 A;  1UG1 A;  4OMM A;  4OMO A;  1FMW A;  2COY A;  3EFS A;  2YLC A;  1VQK T;  3VS5 A;  2DBM A;  1M2V A;  2GFA A;  2D1X A;  3OS0 A;  5KH6 A;  4Z02 A;  2DX1 A;  1VQ9 A;  2ABL A;  2YRV A;  1Q82 R;  3M55 A;  1KSW A;  1FXX A;  4V2S A;  3EG0 A;  3CCJ T;  4BDY A;  2BTT A;  3LX7 A;  3CCS Q;  3L2Q A;  4M78 G;  3QJ6 A;  1KHC A;  2COW A;  4RTY A;  3M56 A;  1TOV A;  3JB9 F;  3SWN C;  5KE3 A;  4F14 A;  1PM3 A;  2K3X A;  1SG5 A;  2M51 A;  3S3N A;  3OW2 A;  1TXQ A;  4AFQ C;  2EQK A;  1RI0 A;  2DKG A;  1WLP B;  2XIC A;  3H41 A;  3CPF A;  2DVE A;  2J6F A;  1NBE B;  4M77 C;  3E9F A;  5AYF A;  1K73 U;  3MPU B;  5EG2 A;  1Q7Y C;  3X26 B;  3VRY A;  2M9U A;  2R5A A;  4NOY A;  1D1A A;  1D0X A;  1G2B A;  2QDY B;  1BK2 A;  4FYY B;  2EGC A;  2XDP A;  4HCC A;  3CBM A;  1IHV A;  1VQL A;  4L6V 5;  4C0F A;  2ED1 A;  3HTR A;  1K76 A;  2V26 A;  2XKO C;  1N9R A;  5GAO p;  2CSI A;  2DMO A;  3VUZ A;  1V29 B;  4OMN A;  3GPL A;  4J6W A;  2PVG B;  2KT1 A;  1GBR A;  1ZUK A;  1KK7 A;  2QAZ A;  4BE1 A;  2EYQ A;  4MDW A;  2K3Y A;  3CMA A;  4Z89 A;  3GNF B;  4RTV A;  1BIA A;  3TRE A;  1YHQ Q;  3CC4 T;  2EGA A;  4BDZ A;  2VYT A;  4C8Q G;  2XMF A;  3QWY A;  2FO0 A;  3EFO A;  1J3T A;  3I56 T;  2DD4 A;  4C0D C;  4FT2 A;  2YUQ A;  2DIL A;  3FIF A;  5FRO A;  1X69 A;  4OB1 B;  2IIM A;  1VQK A;  2EPD A;  1PRL C;  4BI4 A;  1OZ2 A;  3EGD B;  1VQP Q;  3R6O A;  1XNI A;  1ZA2 B;  3MKD A;  1VQP T;  1Q81 U;  1FYN A;  4KGX B;  3LWI A;  1G3Y A;  1VQM Q;  2YXY A;  2LX9 A;  2HAX A;  1M90 U;  2FPF A;  1RI9 A;  3DB3 A;  1GBQ A;  5GAO q;  2ENM A;  1VQM T;  4LDW A;  1NZ9 A;  3ZBD A;  2NWM A;  4HVW A;  1VQ9 T;  2KRN A;  2A28 A;  1RAB B;  2A36 A;  2RPN A;  3QKJ A;  1DJ7 B;  1NM7 A;  3F70 A;  4A4K A;  1N27 A;  1RAC B;  1VQ5 A;  2BZY A;  4IKF A;  3H9N A;  1IRX A;  1Q81 C;  1I81 A;  2X4X A;  2QQS A;  5LJ5 d;  2EQJ A;  2RM4 A;  5KYY B;  1IRE B;  1SPK A;  2HNI A;  2RB6 A;  1WHG A;  2YDL A;  1SRM A;  5CKE A;  4RTX A;  5LJ5 e;  5DM7 R;  1YJN Q;  4AG1 C;  2X51 A;  4M75 A;  2CP5 A;  2PVO B;  2CT3 A;  2DZ9 A;  4IIO A;  2BZ8 A;  2AHJ B;  4M77 F;  1PWT A;  5A2Q E;  4JJB A;  3MO8 A;  1WA7 A;  2MCN A;  2RHU A;  1I5O B;  3EFO B;  1LOJ A;  2HZY A;  3M9Q A;  3MJX A;  3JAM E;  2ROL A;  2D9T A;  2VGN A;  4RUG A;  1NJI R;  4DQ2 A;  3SD4 A;  4C92 F;  3U23 A;  2RN8 A;  3UA7 A;  2DNU A;  1OU8 A;  3UA6 A;  4OMF B;  2QA4 A;  4MZT A;  3PTA A;  3L2V A;  1QQJ A;  3JCM W;  3ZEH A;  1ARK A;  1NE8 A;  3O8V A;  4FM4 B;  2K2M A;  3RES A;  4CC4 B;  3CCQ A;  4JRI A;  8AT1 B;  5I22 A;  3WXM B;  1YJW Q;  2JUF A;  2E10 A;  1QWF A;  5LJ5 h;  1YIT Q;  2HCK A;  1YIJ Q;  3M59 A;  4LDV A;  2OI3 A;  4K11 A;  3PIP A;  1ACM B;  2VAS A;  4LN2 A;  5IXF A;  3CCJ Q;  1PNJ A;  2QEX Q;  1Q7Y U;  1O9S A;  1NPR A;  1VA7 A;  2LJ1 A;  3LW5 E;  1UGQ B;  1UFF A;  2EWN A;  1VQK Q;  3GNG A;  4M75 G;  4A4G A;  2DTI A;  4Q5W A;  4LXC A;  4Y92 A;  1B34 B;  2E5K A;  3CCM T;  5HY6 A;  3C4S A;  1XOV A;  3M0R A;  7AT1 B;  5GAO n;  3M0S A;  4QQ6 A;  1G3S A;  2DYB A;  3CBO A;  5GAN e;  2QQ9 A;  4KT0 E;  1VQO Q;  2MPX C;  1QCO A;  4GLM A;  3IQL A;  3CCQ T;  4R56 A;  2AT1 B;  3CCE Q;  2EQU A;  5CKF A;  1BB9 A;  4N4G A;  3OW2 P;  3PMT A;  1EZZ B;  1QMC A;  4M77 E;  2GBQ A;  4EMG A;  4FT4 A;  4OF1 A;  2QTV A;  3RKY A;  1FX7 A;  3M0U A;  3BDU A;  1Q95 G;  2DL8 A;  5I2M A;  5CO7 A;  1YI2 Q;  2DF6 A;  4FL6 A;  3OYD A;  3M4Y A;  2XU8 A;  1K0X A;  3A8M B;  2K9G A;  5LJ3 f;  1RAG B;  2ZGW A;  2LJ0 A;  2L3Q A;  2DPP B;  1M8M A;  4M7D G;  3G4S T;  2F2X A;  1JJ2 A;  2DIQ A;  3JCM e;  2V8J A;  5KYN A;  2Z0W A;  5IN1 A;  3PMI A;  3CCV Q;  1JQQ A;  2LCC A;  2DER A;  1JXO A;  2V1R A;  4M78 D;  3EH1 A;  2JXB A;  4NS5 A;  4M7A E;  1U1T A;  5IHN A;  4M75 F;  5GMK j;  4E7H A;  3OYM A;  4M78 B;  2LP5 A;  1WI7 A;  3MP8 A;  2FPE A;  3NHN A;  2L0A A;  2KE9 A;  4PFZ A;  4P5N A;  1VQ6 A;  1LJO A;  1HK9 A;  2DL4 A;  2RQR A;  4HVV A;  2RJF A;  2SRC A;  3X20 B;  2K2V A;  3X24 B;  3M57 A;  4JS4 A;  1MND A;  4PLL A;  3CCM Q;  1JU5 C;  4AMC A;  4C92 C;  2AZV A;  1FWZ A;  4EMH A;  4X34 A;  3NTI A;  5GAO r;  1VQM A;  1QP3 A;  5DLQ E;  3BFM A;  1XTD A;  3OB9 A;  3GP8 A;  2JTE A;  2LQW A;  3M0Q A;  2X35 A;  1PKT A;  1Y57 A;  1S72 T;  3VKI A;  1YWO A;  1WHH A;  1S1N A;  3BY7 A;  5FWB A;  2KNB B;  3OBY A;  1E7O A;  2EGE A;  4RMO A;  4ZTJ A;  1WHM A;  3HRS A;  1AVZ C;  1HD3 A;  2MAM A;  3THK A;  1RAF B;  2LNV A;  1VQO A;  2WSC E;  4XTU A;  1X6B A;  2GTO A;  2M02 A;  3LH0 A;  5KYX A;  2GNC A;  4PJO G;  3JCM P;  3HL8 A;  1YIJ T;  1I8F A;  3QZ5 B;  5CKB A;  3V7C A;  3CXC A;  1VQ4 A;  4M7A C;  3QBY A;  1WDX A;  3JCM c;  4M75 D;  4ELY C;  1B7T A;  1K9M C;  4QKU A;  1UE9 A;  3M5A A;  4M7D A;  2O9S A;  4RTT A;  2FHD A;  1VQO T;  1OYX A;  3JB9 I;  3M54 A;  4PJL A;  1YIT A;  3ZL7 C;  5GAN j;  2E4H A;  1Z9Q A;  2OJ2 A;  2RH2 A;  2A3L A;  3TCJ A;  1D0Y A;  4C92 E;  4M7A D;  1VIF A;  3MEU A;  3CC2 T;  1X27 A;  3OYN A;  1OV3 A;  4QVD A;  3VUB A;  1YJN A;  2LX7 A;  1M2V B;  3CMA T;  1WPY A;  1HSQ A;  1SF9 A;  1OPL A;  2MMP A;  3AT1 B;  2A37 A;  4HT9 A;  4A63 B;  2FPD A;  4FSS A;  2D0Q B;  2BE7 D;  2F5T X;  1D0Z A;  2QDL A;  5GAN 2;  3RNJ A;  1KQS P;  2SEM A;  3C12 A;  2C06 A;  2E6N A;  3QYG B;  2GTJ A;  2PZ1 A;  1UB4 A;  4ANJ A;  3EGX B;  1Q86 U;  2HBW A;  4FIB A;  4MMK A;  1M3B A;  2JS2 A;  1UEB A;  2HDA A;  1WIE A;  5FU6 B;  5FRN A;  3A98 A;  5IAY A;  3OYG A;  4FCY A;  4A4H A;  1YHQ T;  1RAA B;  2DA9 A;  1D1C A;  3CCS T;  3N5B B;  4N0A C;  2EYZ A;  1KJW A;  1AWW A;  4C5G A;  1IXD A;  4BAC A;  3BDL A;  1KQ1 A;  2QAS A;  1SRL A;  2JMC A;  3FEO A;  3I55 A;  1WQ7 A;  2IVW A;  3G6E Q;  3NFC A;  2ZCF B;  3LGF A;  1WHL A;  4E7J A;  4PFP A;  3NGP A;  4IUP A;  2MYS A;  3OYF A;  4KH0 B;  2DXC A;  2RO0 A;  1VQN T;  2A7Y A;  3CCQ Q;  2C0O A;  1UGR B;  1V1C A;  2LQN A;  2RHI A;  3WVE B;  3VS3 A;  1VQN Q;  1VQL Q;  1TUD A;  4J5Y A;  3OYY A;  4XQ3 A;  3CME A;  2NUZ A;  2QQR A;  1M9S A;  5AT1 B;  3CC7 A;  3CCR Q;  3E2U A;  5A0L A;  1YCY A;  2JM8 A;  4LD6 A;  1K73 R;  4Z88 A;  4N4I A;  1ZBJ A;  2QTX A;  5GAN 7;  1KD1 U;  4J9E A;  3CD6 Q;  1SKU B;  2GF7 A;  4WF2 A;  4BE0 A;  2P84 A;  3AHU A;  2V8K A;  1KC8 C;  4L59 A;  5GAN 3;  1M90 C;  4M7A A;  1AEY A;  2LCL A;  1PKS A;  1NEB A;  2ZPF B;  3JCM X;  4C92 B;  4XK8 E;  4ZGE B;  5CCA A;  4D8K A;  2JM9 A;  5CIU A;  1ZSG A;  2RA2 A;  4TVR A;  2OAW A;  1RLQ C;  4J9F A;  4X1V A;  4HCZ A;  4PK4 A;  5GAM e;  3OS5 A;  3EFR A;  2QG9 B;  4R0K A;  1MV3 A;  2PNI A;  1MHN A;  4C8Q C;  1K9M U;  3JSC A;  5D6Y A;  3RKX A;  1MMN A;  4B9W A;  4DBF A;  3MEV A;  2ZPB B;  5DLO A;  1AHJ B;  1XJW B;  3QII A;  1JRI A;  3VJP A;  1QKW A;  2GCX A;  3M4G A;  1D3B B;  1NEG A;  2OTJ A;  4KUD K;  2KBT A;  1ABO A;  3H6Z A;  1KQS S;  1VQ7 A;  4ME7 A;  2VUB A;  1T0H A;  1M1K U;  1VQ7 Q;  2FB7 A;  3PIO A;  4BD3 A;  2KI7 A;  2KXC A;  3PVQ A;  2XD0 A;  2COZ A;  2ESW A;  3CCL T;  1QVG S;  2L3P A;  2E70 A;  5D6W A;  3I5S A;  1IGQ A;  1YWP A;  1YJW A;  4ZNX A;  1K1Z A;  4Z8A A;  1CKA A;  2LVM A;  2V8I A;  4N0A A;  3QYH B;  1R0C B;  4DA4 A;  1K9M R;  1BIB A;  4AG2 C;  3V7S A;  2HL3 A;  5CK9 A;  5CKD A;  4E7L A;  2NLU A;  4BUG A;  3FDR A;  4C5I A;  3KBG A;  2RHY A;  2YUP A;  4F7U G;  1Q86 C;  2DRK A;  5GAO m;  3SFM A;  1TUG B;  1S72 A;  2DTH A;  1AWO A;  3CD6 T;  1YJ9 A;  4C8Q E;  2H3E B;  1ZSZ C;  1PD0 A;  2WAC A;  1Y0M A;  2O88 A;  3I9Q A;  1HYO A;  2DTO A;  5KCO A;  2ATC B;  2KSS A;  5A0D A;  2DET A;  4EIK A;  4LDX A;  4B9X A;  4PKC C;  5KCH A;  1WFW A;  3G7Z A;  5GMK l;  1PSF A;  1ZUY A;  1QCF A;  4XU2 A;  1U06 A;  2FG0 A;  4ZGJ B;  2DXU A;  1GFD A;  3OMC A;  3TEE A;  4XAX B;  9ATC B;  3JV3 A;  4LE9 A;  1H8K A;  4QQD A;  3MEW A;  1VQ6 T;  3I5R A;  4C92 A;  4PJJ A;  4DOW A;  2PQW A;  4FW1 A;  1KFZ A;  4XTW A;  4HVU A;  1WNL A;  1BI2 A;  4PJO A;  1VQ5 T;  2NYS A;  4A4F A;  1WXU A;  3RMS A;  1M1K R;  5LJ3 e;  3CC7 Q;  4M78 F;  1A0N B;  1BYM A;  4IUR A;  1OI1 A;  2MWP A;  3QJY A;  4M75 B;  1OX9 A;  3HHT B;  2DO3 A;  4XU1 A;  3VV0 A;  1W4S A;  1KG1 A;  2DEQ A;  3CCS A;  1PC0 A;  3P8H A;  3E9G A;  2G3R A;  3EGX A;  3T9N A;  1WQW A;  2HD0 A;  5LJ5 f;  3LYI A;  2P4R A;  1LPL A;  1BCM A;  1Q82 C;  2RI2 A;  1CSK A;  1X75 C;  2E3H A;  4JZ4 A;  1K8A R;  1AOJ A;  2AZS A;  2OTL T;  2HKN A;  5KYU A;  3URG A;  3M0P A;  5HKC A;  2B86 A;  3WVD B;  1VQ4 T;  5DY9 A;  1GXI E;  1W2B P;  4X9C A;  1K4U S;  1ABQ A;  2MOX A;  2RJE A;  1N6A A;  4HT8 A;  1BI3 A;  1RL2 A;  2AIR B;  2C0I A;  3HFN A;  2VVK A;  4JJN K;  3MP6 A;  2YUO A;  1AT1 B;  1OUL A;  1UEC A;  3DB4 A;  3NMZ C;  1QVP A;  3PVL A;  2PU9 B;  2VXF A;  5J39 A;  1RAE B;  2RHX A;  3CBP A;  5GMK i;  3S3O A;  4E47 A;  5GAN d;  2QEX T;  2YHT A;  4XU3 A;  2J6K A;  2EW3 A;  3CCV T;  2RI5 A;  1W1F A;  4M77 B;  3EG1 A;  2OTJ Q;  2O2O A;  4CI0 C;  2E3I A;  2KY9 A;  1QW1 A;  2OTJ T;  3UWN A;  4BI3 A;  2Y4Y A;  2YLB A;  1RUW A;  3KFV A;  2E6Z A;  1N8R C;  1ZSZ A;  2KQW A;  2DIG A;  4HKE A;  3RBB B;  2YWW A;  2KYM A;  1N5Z A;  3TVT A;  2BUD A;  5CKH A;  4X9D A;  4J9I A;  4KUL A;  5KYY A;  3NPF A;  2ROT A;  2LCS A;  1KQS A;  2HMA A;  1NJI C;  3G71 A;  1G83 A;  3G1J A;  4J83 A;  4J6X A;  2RD1 A;  3G4S A;  3OS2 A;  3OY9 A;  3V8L A;  1YI2 A;  1P92 A;  1IZ6 A;  2K6D A;  2FZC B;  1WYX A;  3TQ7 P;  3QG1 A;  2F69 A;  4HCK A;  3X28 B;  2A0F B;  2W10 A;  3UAT A;  5GAN f;  3R6N A;  5I21 A;  2HEQ A;  4C0G A;  2F2V A;  1WHJ A;  4C5E A;  2KAF A;  1B34 A;  4BI8 B;  4GBQ A;  3DKM A;  3QDF A;  1ZBX A;  1YN8 A;  2PUO B;  3CD6 A;  3MET A;  2CSQ A;  2DL3 A;  2I2L A;  4O6J A;  2AK5 A;  1VQ4 Q;  2FZK B;  4J9B A;  4KUI A;  1AZG B;  2CT4 A;  5IXB A;  1OEB A;  2BIV A;  1NYF A;  3GBQ A;  3INZ A;  4QVC A;  2HSP A;  3EG9 A;  2R5M A;  4MZP A;  1IHW A;  2LT4 A;  3VS2 A;  3TU4 K;  3QXE B;  3OSS C;  1BBZ A;  1GCQ A;  5HK3 A;  4KGV B;  1I4K 1;  3ER0 A;  1OZ3 A;  2LJ3 A;  2ZPH B;  3OYB A;  3CCR A;  3REB B;  2EKO A;  3CCL A;  4ELZ C;  4J7I A;  3VS0 A;  3J7A F;  1GCP A;  3GLX A;  1V76 A;  4OGC A;  2RHZ A;  3VRZ A;  2O4X A;  1H3H A;  5LJ3 h;  3OYL A;  2K5L A;  2AKK A;  5HK0 A;  3FC3 A;  4M78 A;  2E65 A;  4M4Z A;  2X4Y A;  5CVI A;  4ATO A;  2L89 A;  4E7K A;  5C0M A;  5D7U A;  3OQ5 A;  4M77 G;  4FYV B;  2IG0 A;  5J3B A;  3S3M A;  3CCR T;  1ZLM A;  2D0N A;  4JDS A;  1W70 A;  4F7U F;  2JW4 A;  3A8H B;  3G71 T;  1YFN A;  3G6E A;  2KRO A;  1LNX A;  1G5V A;  5CQY A;  2MK5 A;  2DBK A;  2P4T A;  1MGQ A;  4IUQ A;  2DLP A;  2FEI A;  1YHQ A;  4MDX A;  3SEM A;  5KE2 A;  5KYW B;  3M58 A;  3OYI A;  1UHC A;  2DD5 A;  2EQM A;  5LJ5 g;  2BKD N;  3EG9 B;  3LH5 A;  4PLI A;  1VUB A;  1W2B A;  1VQ6 Q;  3L2Z A;  2CZ0 B;  5GAM g;  4PNO A;  1UGP B;  2GQI A;  2R57 A;  5LJ5 j;  4PJO B;  1M1K C;  4JJD A;  2W0Z A;  4KBM B;  3RUX A;  1OOT A;  3CQT A;  4AFU C;  1AZE A;  2LTO A;  3EGU A;  1EX4 A;  1SSH A;  2LQK A;  2DL7 A;  2Y4X A;  1I5L A;  2EYW A;  4OMP A;  3L42 A;  2HQE A;  2GGR A;  1PSE A;  1TWB A;  1TS9 A;  1G3W A;  2EKH A;  1H64 1;  3G6E T;  2DZC A;  3OSV A;  1AD5 A;  3M53 A;  4BY6 B;  3QWX X;  1M2O A;  3RMQ A;  5KYU B;  3CC7 T;  2LMJ A;  4F17 A;  2FVU A;  2K57 A;  4AT1 B;  2X4J A;  5IT9 E;  4AFS C;  3CPW A;  1QLY A;  1BI0 A;  1I0C A;  2H8H A;  2L8D A;  5CR2 A;  4E2F B;  1M5Q 1;  2CZ6 B;  1MV0 B;  3E1S A;  1VOM A;  1MMD A;  4M7D B;  2FRW A;  4B6M A;  4R55 A;  3NTH A;  3VS6 A;  5L8R E;  5GAN 6;  3H0H A;  5ECA A;  1M8V A;  2CH4 W;  3EG2 A;  2ZZD A;  2XDB A;  4CC3 A;  1TG0 A;  4LUE A;  1T0J A;  2LZ6 B;  4AFZ C;  2RF0 A;  3BE3 A;  3VS7 A;  1VQ8 T;  2CDT A;  2V1Q A;  4FYW B;  4ZTF A;  4RTZ A;  3A1P A;  3QSU A;  5A0G A;  3I55 T;  1EIF A;  1WXT A;  2P0Q A;  2K3B A;  4OMQ A;  1VQ8 A;  4WCI A;  1X6G A;  2CP0 A;  4ZN3 A;  2LQ8 A;  5GAN 8;  1WJQ A;  4EPC A;  3VYH B;  2P0K A;  2ZPE B;  5FW9 A;  2M0Y A;  4MML A;  1SHF A;  3CXC S;  2VV5 A;  1AWJ A;  4FU6 A;  4LD9 K;  2JNG A;  4CC2 A;  1GRI A;  1T3L A;  2DAQ A;  4M7A G;  1AWX A;  2JJ9 A;  2D8H A;  2F5K A;  2MWO A;  4E6R A;  1X01 A;  3M0T A;  2KT8 A;  2QQB A;  2QXF A;  3GF5 A;  1UHF A;  2X4W A;  4C8Q D;  2KXD A;  1WGS A;  3PNW C;  1JJ2 P;  3EHQ A;  2KEA A;  1PD1 A;  5GAM d;  1K8A C;  1X2K A;  2R58 A;  1K0S A;  1XQH A;  3PFS A;  2CP3 A;  3QDR B;  3ZFJ A;  1BKB A;  4JLI A;  8ATC B;  4PJO D;  4QT7 A;  4RCC A;  2CH4 A;  2EQI A;  2E5Q A;  4C0Z A;  2EJG A;  2HQH A;  4M77 D;  1Q7Y R;  2XHC A;  4DBQ A;  1KC8 U;  2XID A;  3BW1 A;  1RAD B;  5LJ3 d;  5FWC A;  3KXT A;  1N8R R;  1LCK A;  1H92 A;  1TTH B;  2LRQ A;  1VYU A;  3ME9 A;  1KD1 C;  3VYG A;  3A8L B;  1TSF A;  5GMK e;  2FRY A;  1NPP A;  4J8O A;  1NG2 A;  1QVG A;  3EAE A;  3RER A;  3SWN A;  1X2Q A;  3VS4 A;  4DEX A;  1E6G A;  4JUV A;  3CME Q;  3GOX A;  1VQ8 Q;  4Y28 E;  2QYZ A;  3QZ9 B;  1NJI U;  5FRM A;  1IGU A;  2CRE A;  4EDU A;  3I55 Q;  4OVA A;  2AKL A;  2HBP A;  3LGL A;  3L1A A;  3Q1J A;  3UF4 A;  2P0P A;  3UPU A;  2VB6 A;  2QQA A;  3NTK A;  2JZ2 A;  3RR6 A;  3JB9 H;  4M7D C;  1QWE A;  2DL5 A;  2RQV A;  3CMA Q;  3CCU Q;  4NL3 A;  1K73 C;  4RG8 A;  1SSF A;  1QVF S;  5GAM f;  1JO8 A;  1VQ7 T;  1TUC A;  2X3W D;  2EIF A;  3CCJ A;  3SB2 A;  4BB7 A;  3A8O B;  2X3X D;  4JRK A;  1U1S A;  5J26 A;  2ED0 A;  3FLG A;  1PRM C;  1X6O A;  5GAM h;  2ZAE A;  5FU7 C;  3PT9 A;  1O75 A;  2RNA A;  1YJW T;  1KD1 R;  2G6F X;  2CP6 A;  2EFI A;  4M7A F;  1YJ9 T;  5IHI A;  3CXC P;  2O9V A;  4PFO A;  3JCM Q;  3LLR A;  4BY6 C;  2YRD A;  2K4Y A;  5M9O A;  1Y7X A;  3OYE A;  4RTU A;  4JPB W;  4EMK A;  4Y91 A;  1W6X A;  2XK0 A;  2EYX A;  1FMV A;  1NYG A;  2BE9 B;  2CP7 A;  4DEY A;  4JS5 A;  4HCB A;  3HSB A;  2JT4 A;  3FJ5 A;  4DBR A;  3SHW A;  2BZX A;  1RAH B;  5FLX E;  1YI2 T;  3L2R A;  2RQW A;  3TSZ A;  3CCE A;  3SWN B;  2DEU A;  3V8J A;  3H0I A;  2HQX A;  2IPO B;  3P8B B;  4XTZ A;  1C6V X;  2KK4 A;  3MP1 A;  3LWH A;  2YUN A;  4OML A;  3RKW A;  2E64 A;  5GJV B;  1UGS B;  3G71 Q;  2H3J A;  3JCM f;  1UGV A;  4C8Q B;  2RQU A;  4CC7 A;  1KQ2 A;  1UJ0 A;  3E19 A;  2KR3 A;  3ASK A;  1UTI A;  1QVF A;  4FSX A;  1X43 A;  2JTF A;  5IHK A;  3CEY A;  1OQK A;  4RG2 A;  3MCA B;  4KGZ B;  1JXM A;  3HP9 A;  2VGM A;  1KHI A;  2XDD A;  1TH7 A;  2JTM A;  3HRT A;  2M0O A;  4JLG A;  4IUT A;  2JOY A;  5GAN h;  4FYX B;  1ZA1 B;  4F7U B;  1NLP C;  4OB0 B;  1M1G A;  2L3R A;  3OYC A;  3EH2 A;  4IIM A;  3A8G B;  4M7D D;  3OA6 A;  4LUD A;  2NUP B;  4DBH A;  1C0M A;  1PCX A;  1IB8 A;  1ZQ1 A;  1FMK A;  2MF2 A;  4OB2 B;  3UT1 A;  2MIO A;  2RK1 A;  2DJQ A;  1R0B G;  1BCO A;  2E12 A;  1N9S A;  4M7D F;  4LNP A;  2K5F A;  4OP0 A;  5KYX B;  1MUZ A;  2K7A A;  4C0D B;  2CKK A;  1Q82 U;  4JRQ A;  6AT1 B;  2J05 A;  3HFO A;  1JB0 E;  2DJZ A;  2PVD B;  2L5Q A;  4GLK A;  4J9H A;  4ORZ A;  2OTL Q;  2E1H A;  2EYY A;  3QUI A;  5D6X A;  2QGF B;  2C0T A;  4PJN A;  2E41 A;  3A5Z B;  3CCU T;  2MI6 A;  2JS0 A;  3REA B;  3DLL A;  4J9G A;  2CUB A;  4NL2 A;  4E7I A;  5GMK h;  2OAU A;  4ZGD B;  2B8A A;  1M30 A;  3G4S Q;  3VS1 A;  4M7A B;  5LJ3 g;  1QVG P;  1VIE A;  1VQ5 Q;  1D1B A;  3O5Z A;  1M3C A;  3CCV A;  3KUF A;  1ZSZ B;  1GL5 A;  2F1L A;  3JCM b;  3CC4 A;  4IUU A;  3OYH A;  4XTV A;  3RDV A;  4QQG A;  5LJ3 j;  1MMA A;  2FZG B;  4HA8 A;  4M75 E;  1Z9Z A;  1I07 A; 
#chains in the Genus database with same CATH homology
 4XQ3 A;  5LJ5 g;  3CME A;  2BKD N;  3I56 T;  2DD4 A;  4A54 A;  4PLI A;  2QQR A;  1M9S A;  1VUB A;  4C0D C;  2WSE E;  1WJR A;  1W2B A;  4FT2 A;  3CC7 A;  3L2Z A;  2DK3 A;  4C92 G;  3I56 A;  2CZ0 B;  3FIF A;  5A0L A;  5GAM g;  5FRO A;  4PNO A;  5GAO l;  4OB1 B;  1UGP B;  5LJ5 j;  2R57 A;  1VQK A;  4PJO B;  1M1K C;  4BI4 A;  1OZ2 A;  4KBM B;  1YCY A;  3RUX A;  4LD6 A;  2O4X B;  3R6O A;  2LTO A;  4N4I A;  1XNI A;  3CCU A;  2JN0 A;  2LQK A;  1VQP T;  2Y4X A;  1Q81 U;  1I5L A;  2QTX A;  5GAN 7;  3L42 A;  4CRI A;  2OTL A;  2HQE A;  3LWI A;  1G3Y A;  4LDU A;  1KD1 U;  2LX9 A;  2HAX A;  1M90 U;  1PSE A;  1YIJ A;  1YJN T;  4M7D E;  3DB3 A;  1G3W A;  2GF7 A;  4WF2 A;  1H64 1;  4F7U E;  4BE0 A;  2V8K A;  1KC8 C;  3QHS A;  2DZC A;  3OSV A;  5GAO q;  3G6E T;  3M53 A;  2QEX A;  1VQM T;  4LDW A;  1NZ9 A;  4L59 A;  4BY6 B;  5GAN 3;  1M90 C;  4M7A A;  3ZBD A;  3RMQ A;  2LCL A;  4N4H A;  4PJO E;  2ZPF B;  3V8K A;  1VQ9 T;  3CC7 T;  3JCM X;  4C92 B;  4XK8 E;  4ZGE B;  2FVU A;  2K57 A;  3V7R A;  4O5V A;  3QKJ A;  2X4J A;  5CCA A;  5IT9 E;  1Y96 A;  4F7U A;  1DJ7 B;  3F70 A;  4J7F A;  4A4K A;  1N27 A;  3CPW A;  5CIU A;  1VQ5 A;  1BI0 A;  4IKF A;  2L8D A;  3JRZ A;  5CR2 A;  1Q81 C;  3L2U A;  1I81 A;  2X4X A;  1M5Q 1;  2RA2 A;  2CZ6 B;  2QQS A;  3E1S A;  4TVR A;  5LL6 S;  1K8A U;  4HCZ A;  2KVQ G;  5GAM e;  4M7D B;  3OS5 A;  3EFR A;  3OYA A;  5C6S A;  3NTH A;  4R55 A;  4OB3 B;  1MHN A;  5L8R E;  5GAN 6;  2EQJ A;  4C8Q C;  5LJ5 d;  2RM4 A;  1K9M U;  1ZHI A;  1M8V A;  3VU3 C;  3JSC A;  1IRE B;  5D6Y A;  4PL6 A;  3RKX A;  4B9W A;  2EJF A;  2ZZD A;  3MEV A;  2D6F A;  2HNI A;  2RB6 A;  2ZPB B;  2XDB A;  5DLO A;  5CKE A;  5LJ5 e;  3RIR A;  5DM7 R;  4M75 A;  1AHJ B;  1JBM A;  2FYK A;  2PVO B;  2DZ9 A;  3QII A;  1JRI A;  4RCB A;  1VQ8 T;  2AHJ B;  4M77 F;  3OYJ A;  4ZTF A;  5A2Q E;  3AHU A;  4J6Y A;  3MO8 A;  4L5G A;  3QSU A;  4QVZ A;  3GIB A;  5A0G A;  3I55 T;  1EIF A;  2P0Q A;  3VJP A;  2RHU A;  3C95 A;  1LOJ A;  3M9Q A;  1VQ8 A;  2M16 A;  3JAM E;  2GCX A;  2D9T A;  3M4G A;  3OBW A;  1D3B B;  2VGN A;  2ZPI B;  1VQL T;  4ZN3 A;  2OTJ A;  4KUD K;  2LQ8 A;  4DQ2 A;  5GAN 8;  1WJQ A;  4EPC A;  3H6Z A;  3SD4 A;  3VYH B;  4C92 F;  1KQS S;  1VQ7 A;  2P0K A;  4ME7 A;  2ZPE B;  2VUB A;  1M1K U;  2WSF E;  2FB7 A;  1M4Z A;  4MML A;  2VV5 A;  4BD3 A;  4EMK B;  3PIO A;  3CXC S;  3P8D A;  4FU6 A;  4LD9 K;  2XD0 A;  2JNG A;  4OMF B;  4C8Q F;  2QA4 A;  4MZT A;  2DAQ A;  4M7A G;  4ZN1 A;  3PTA A;  3JCM d;  3L2V A;  3CCL T;  1QVG S;  5FU7 B;  2E70 A;  3JCM W;  3ZEH A;  1NE8 A;  3O8V A;  4FM4 B;  4C92 D;  5D6W A;  3J80 E;  3RES A;  2K5I A;  1YJW A;  2F5K A;  2MWO A;  4XTX A;  3CCQ A;  2LVM A;  4JRI A;  4N0A A;  1X01 A;  2V8I A;  5GAM j;  3QYH B;  4XTY A;  2LT1 A;  4M77 A;  3WXM B;  4DA4 A;  2QQB A;  1BIB A;  2JUF A;  2E10 A;  2QXF A;  3GF5 A;  3V7S A;  5GAN 5;  2X4W A;  4C8Q D;  5LJ5 h;  3M59 A;  4LDV A;  3JCM g;  5CK9 A;  5CKD A;  3PIP A;  4E7L A;  1HXD A;  1WGS A;  2NLU A;  3PNW C;  4BUG A;  3FDR A;  1W2B S;  4PJO F;  4C5I A;  3KBG A;  2RHY A;  4A4E A;  1Q7Y U;  4F7U G;  3C94 A;  5GAM d;  3QO3 A;  4XU0 A;  1Q86 C;  1K8A C;  2XI9 A;  1O9S A;  5GAO m;  5I2S A;  2R58 A;  3H8Z A;  1NPR A;  3SFM A;  1S72 A;  2DTH A;  1XQH A;  3CD6 T;  1YJ9 A;  3LW5 E;  1UGQ B;  3PFS A;  2EWN A;  4VUB A;  4C8Q E;  3GNG A;  4M75 G;  4A4G A;  2DTI A;  3OYK A;  3FJP A;  3CC2 A;  1G3T A;  2WAC A;  4Q5W A;  3QDR B;  3ZFJ A;  1BKB A;  1Y96 B;  1B34 B;  2DTO A;  4M78 C;  3CCM T;  5HY6 A;  3C4S A;  1XOV A;  2RJC A;  4JLI A;  5KCO A;  4PJO D;  2LC4 A;  2VXE A;  4RCC A;  5GAO n;  3FB9 A;  4IUV A;  2KDS A;  2KSS A;  5A0D A;  4QQ6 A;  1G3S A;  4LDX A;  3CBO A;  4B9X A;  5GAN e;  2E5Q A;  2QQ9 A;  4KT0 E;  4C0Z A;  2EJG A;  4M77 D;  2XHC A;  4PKC C;  5KCH A;  1KC8 U;  2XID A;  3BW1 A;  3G7Z A;  5LJ3 d;  5GMK l;  3OS1 A;  1PSF A;  4R56 A;  4XU2 A;  3KXT A;  3CCQ T;  1YBY A;  4ZGJ B;  2DXU A;  3OMC A;  3PGG A;  2LRQ A;  2EQU A;  3JCM J;  3ME9 A;  1KD1 C;  3TEE A;  4XAX B;  1R8O B;  1JJ2 S;  5CKF A;  3MHX A;  4N4G A;  3VYG A;  3A8L B;  3PMT A;  4YTL A;  4QQD A;  3SDZ A;  2CZ7 B;  4M77 E;  3MEW A;  2ZPG B;  3CCM A;  1VQ6 T;  1Y71 A;  5GMK e;  4C92 A;  4EMG A;  1NPP A;  4J8O A;  1YIJ T;  4FT4 A;  4DOW A;  2PQW A;  4OGE A;  1QVG A;  3EAE A;  4XTW A;  4OF1 A;  3RER A;  3SWN A;  1H3Z A;  2LDM A;  1WNL A;  2M1H A;  3RKY A;  1FX7 A;  5FU6 C;  3BDU A;  1BI2 A;  5I2M A;  4PJO A;  5CO7 A;  1VQ5 T;  4FL6 A;  4QW2 A;  4A4F A;  3OYD A;  3M4Y A;  2XU8 A;  3RMS A;  5LJ3 e;  4C5H A;  3JB9 G;  3JB9 D;  3A8M B;  4JUV A;  3GOX A;  3JB9 J;  5LJ3 f;  4M78 F;  1BYM A;  5CQX A;  2ZGW A;  4Y28 E;  3QZ9 B;  4IUR A;  1NJI U;  1OI1 A;  2MWP A;  3QJY A;  4M75 B;  2DPP B;  3HHT B;  4DOV A;  5FRM A;  2CS7 A;  2DO3 A;  4XU1 A;  3VV0 A;  4EDU A;  5GAN g;  1W4S A;  3G4S T;  4M7D G;  1KG1 A;  2DEQ A;  1JJ2 A;  4OVA A;  2Y90 A;  3P8H A;  2HBP A;  3LGL A;  3CCS A;  5GAN 4;  4BE2 A;  3E9G A;  2DIQ A;  2G3R A;  2V8J A;  3MEA A;  3PMI A;  3L1A A;  5IN1 A;  1WQW A;  2HD0 A;  3T9N A;  3LYI A;  3Q1J A;  5LJ5 f;  3JCM e;  2LCC A;  2P0P A;  3UPU A;  3OW2 S;  1Q82 C;  1QP2 A;  2RI2 A;  1N8R U;  1X75 C;  2QQA A;  4M78 D;  3NTK A;  2JZ2 A;  2OTL T;  3URG A;  2QA4 T;  4NS5 A;  3JB9 H;  4M7D C;  1U1T A;  4M7A E;  4M75 F;  5HKC A;  5GMK j;  3CPW S;  3OYM A;  3WVD B;  4NL3 A;  4M78 B;  4E7H A;  1K73 C;  1VQ4 T;  4RG8 A;  1SSF A;  5DY9 A;  1QVF S;  5GAM f;  3MP8 A;  1GXI E;  1VQ7 T;  4X9C A;  2EIF A;  3CCJ A;  2CGH A;  3SB2 A;  4BB7 A;  3A8O B;  4P5N A;  4II1 A;  2DXB A;  2RJE A;  1N6A A;  4M78 E;  1LJO A;  2EJ9 A;  1HK9 A;  4JRK A;  4LDY A;  4HT8 A;  1VQ6 A;  3QPH A;  1U1S A;  4M7A C;  1BI3 A;  1RL2 A;  5J26 A;  4M75 C;  3FLG A;  3HFN A;  1X6O A;  3HKS A;  5GAM h;  2XG8 D;  2RJF A;  5FU7 C;  4JJN K;  3X20 B;  3PT9 A;  2K2V A;  3CME T;  3MP6 A;  1O75 A;  3X24 B;  3M57 A;  4JS4 A;  3DB4 A;  2DXT A;  1QVP A;  2GFU A;  2GQV A;  3FRN A;  4PLL A;  1YJW T;  2PU9 B;  2VXF A;  5J39 A;  4C92 C;  2EAY A;  2RHX A;  3CBP A;  5GMK i;  4E47 A;  2EFI A;  1FWZ A;  4EMH A;  4X34 A;  3S3O A;  1YJ9 T;  3NTI A;  5GAO r;  4M7A F;  5GAN d;  2QEX T;  4D6W A;  1QP3 A;  2YHT A;  1VQM A;  3JCM Q;  4XU3 A;  2CYZ B;  3LLR A;  5DLQ E;  4BY6 C;  3BFM A;  3CCV T;  2K4Y A;  1XTD A;  4JRP A;  2RI5 A;  3HPW A;  5M9O A;  2KMT A;  3OB9 A;  1Y07 A;  1Y7X A;  3OYE A;  3GP8 A;  4M77 B;  3J81 E;  3JCM h;  2CZ1 B;  4GY5 A;  4EMK A;  5CAI A;  2X35 A;  4Y91 A;  3X25 B;  4EMK C;  2XK0 A;  4CI0 C;  1S72 T;  3JCM V;  3S6W A;  3CCE T;  3VKI A;  1U8R A;  2VC8 A;  2KY9 A;  1QW1 A;  2OTJ T;  4A53 A;  3UWN A;  4BI3 A;  3BY7 A;  2Y4Y A;  2RK2 A;  2FL7 A;  2YLB A;  4JS5 A;  4HCB A;  3OBY A;  4RKU E;  3HSB A;  2JVV A;  4RMO A;  4ZTJ A;  2E6Z A;  3HRS A;  4UC4 A;  1N8R C;  4PJO C;  2MAM A;  1YIT T;  3HRU A;  2KQW A;  2RI3 A;  2LNV A;  3UDC A;  3DLM A;  1VQO A;  2WSC E;  4XTU A;  2DIG A;  4HKE A;  5FLX E;  1YI2 T;  3L2R A;  2RJD A;  3LH0 A;  4C8Q A;  4MZM A;  1D3B A;  3L2W A;  1VQN A;  2BUD A;  5CKH A;  4X9D A;  3CCE A;  1WJS A;  3SWN B;  3V8J A;  4PJO G;  5GMK m;  4KUL A;  2HQX A;  1BI1 A;  3JCM P;  3HL8 A;  4XTZ A;  1I8F A;  3P8B B;  3MP1 A;  2KK4 A;  3QZ5 B;  5CKB A;  3V7C A;  3LWH A;  3QBY A;  3CXC A;  1VQ4 A;  3JCM c;  4M75 D;  1KQS A;  1NJI C;  3RKW A;  2E64 A;  1UGS B;  4ELY C;  2H3J A;  1VQP A;  3JCM f;  1K9M C;  4C8Q B;  3G71 A;  1M1F A;  1KQ2 A;  2O01 E;  3M5A A;  4J6X A;  4J83 A;  2PUK B;  2RD1 A;  3E19 A;  3OMG A;  3G4S A;  3OS2 A;  4M7D A;  2QI2 A;  3OY9 A;  2FHD A;  3V8L A;  3ASK A;  1YI2 A;  1P92 A;  1VQO T;  1IZ6 A;  1QVF A;  1OYX A;  4FSX A;  2JTF A;  3EFS A;  2YLC A;  3JB9 I;  1VQK T;  3M54 A;  3CEY A;  3QG1 A;  2F69 A;  3X28 B;  1YIT A;  5GAN j;  2GFA A;  4RG2 A;  3MCA B;  5GAN f;  5I21 A;  2RH2 A;  3OS0 A;  2A3L A;  3TCJ A;  5KH6 A;  4Z02 A;  4C0G A;  4C5E A;  3HP9 A;  1VQ9 A;  2KAF A;  1B34 A;  4BI8 B;  2VGM A;  2YRV A;  1KHI A;  3DKM A;  4C92 E;  2XDD A;  3M55 A;  1TH7 A;  1ZBX A;  4M7A D;  1VIF A;  2PUO B;  2JTM A;  3CD6 A;  1FXX A;  3MET A;  3HRT A;  3MEU A;  4V2S A;  3CC2 T;  2M0O A;  2I2L A;  4JLG A;  3CCJ T;  3OYN A;  4BDY A;  4O6J A;  3LX7 A;  4IUT A;  2JOY A;  4QVD A;  3VUB A;  5GAN h;  4KUI A;  3L2Q A;  4M78 G;  1YJN A;  4F7U B;  3QJ6 A;  1KHC A;  3CMA T;  1WPY A;  3M56 A;  4OB0 B;  3JB9 F;  1M1G A;  2BIV A;  2L3R A;  3OYC A;  3INZ A;  4QVC A;  3SWN C;  5KE3 A;  3A8G B;  4M7D D;  2MMP A;  3OA6 A;  2R5M A;  4MZP A;  2K3X A;  4HT9 A;  2LT4 A;  2D0Q B;  2F5T X;  3S3N A;  1ZQ1 A;  2MF2 A;  3OW2 A;  5GAN 2;  3TU4 K;  3QXE B;  4OB2 B;  3OSS C;  3UT1 A;  5HK3 A;  2EQK A;  3C12 A;  2C06 A;  2RK1 A;  1RI0 A;  2DKG A;  1I4K 1;  2E6N A;  3ER0 A;  1OZ3 A;  2E12 A;  3QYG B;  2XIC A;  2ZPH B;  3OYB A;  1UB4 A;  3CPF A;  2DVE A;  4M77 C;  5AYF A;  1K73 U;  3E9F A;  1N9S A;  3CCR A;  4M7D F;  5EG2 A;  2EKO A;  1Q7Y C;  2K5F A;  4FIB A;  4J7I A;  3X26 B;  4OP0 A;  4MMK A;  4ELZ C;  1Q86 U;  3CCL A;  3J7A F;  3GLX A;  4C0D B;  2CKK A;  1Q82 U;  4OGC A;  4JRQ A;  2RHZ A;  1UEB A;  2O4X A;  5LJ3 h;  2M9U A;  2R5A A;  3HFO A;  5FU6 B;  3OYL A;  5FRN A;  2K5L A;  4NOY A;  1JB0 E;  2DJZ A;  2PVD B;  5HK0 A;  3FC3 A;  5IAY A;  4M78 A;  2L5Q A;  4GLK A;  3OYG A;  4A4H A;  1YHQ T;  2E65 A;  2QDY B;  2X4Y A;  5CVI A;  2XDP A;  4ATO A;  2L89 A;  3CCS T;  3N5B B;  2E1H A;  4HCC A;  4N0A C;  3CBM A;  3QUI A;  5D6X A;  4E7K A;  5C0M A;  4L6V 5;  1VQL A;  4C0F A;  3CCU T;  2E41 A;  3A5Z B;  3OQ5 A;  2MI6 A;  4M77 G;  4C5G A;  2IG0 A;  4BAC A;  5J3B A;  3BDL A;  3S3M A;  1KQ1 A;  3CCR T;  3FEO A;  2XKO C;  1WQ7 A;  3I55 A;  3DLL A;  4JDS A;  2IVW A;  1N9R A;  4NL2 A;  5GAO p;  3NFC A;  4E7I A;  2ZCF B;  5GMK h;  3VUZ A;  2OAU A;  3LGF A;  4F7U F;  3A8H B;  3G71 T;  4E7J A;  4ZGD B;  1V29 B;  2B8A A;  3G6E A;  3GPL A;  1LNX A;  4J6W A;  1G5V A;  2PVG B;  5CQY A;  4M7A B;  2P4T A;  5LJ3 g;  4IUP A;  1VIE A;  3CCV A;  3KUF A;  1MGQ A;  3OYF A;  2EYQ A;  4IUQ A;  4MDW A;  4BE1 A;  3JCM b;  3CC4 A;  2DXC A;  2RO0 A;  4IUU A;  3OYH A;  2K3Y A;  4XTV A;  3CMA A;  1YHQ A;  1VQN T;  4MDX A;  3GNF B;  2A7Y A;  5KE2 A;  1BIA A;  4QQG A;  3TRE A;  5LJ3 j;  3M58 A;  1UGR B;  3CC4 T;  3OYI A;  2RHI A;  3WVE B;  4HA8 A;  4BDZ A;  4M75 E;  2DD5 A;  2VYT A;  4C8Q G;  4J5Y A;  3OYY A;  2EQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...