2LRQA

Chemical shift assignment and solution structure of fr822a from drosophila melanogaster. northeast structural genomics consortium target fr822a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
85
structure length
85
Chain Sequence
b'MNYSTGTDANTLFVDGERVLCFHGPLIYEAKVLKTKPDATPVEYYIHYAGWSKNWDEWVPENRVLKYNDDNVKRRQELARQCGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NuA4 complex subunit EAF3 homolog
molecule tags Transcription
source organism Drosophila melanogaster
publication title Solution Structure of Fr822A from Drosophila melanogaster.
rcsb
total genus 11
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lrqA00
2L3RA 3F70A 5KE3A 2D9TA 2RJFA 4ZTJA 1WJQA 4L59A 4FL6A 4E7JA 2O4XB 3E9FA 3OYIA 4LD6A 4BDZA 2BKDN 3DB3A 4C5EA 3OS0A 4HCZA 2EQMA 1WJRA 2R57A 3H6ZA 3PNWC 2F5KA 1XNIA 2R5MA 4PL6A 4BD3A 5J26A 3OYJA 3UT1A 2VYTA 4BE0A 4IURA 4QVZA 4E7IA 5KH6A 4C5IA 2M0OA 3OYLA 3OMGA 1OYXA 3O8VA 2CKKA 3OYHA 3MEAA 2O4XA 1N27A 3OYMA 2BIVA 3OMCA 2YRVA 4ZTFA 3OYCA 3OYEA 4BDYA 3KUFA 4IUVA 4N4GA 4QW2A 2RHIA 4B9WA 2EQJA 3LGFA 2GFUA 3OYNA 3GOXA 2LTOA 3Q1JA 3L2WA 1WJSA 4OVAA 4E7KA 2DAQA 2FHDA 2EFIA 2GF7A 3C4SA 3MEVA 2K3YA 3NTKA 4Q5WA 5IAYA 3OA6A 3PMIA 3MEWA 2WACA 2MWOA 4E7HA 1SSFA 5FRMA 2L8DA 4Z02A 3NTHA 4CRIA 3LGLA 3META 3UWNA 3L2VA 3OYAA 3OYBA 4BE2A 3LH0A 3M9QA 3FDRA 3CEYA 5J39A 2LVMA 2RJDA 2G3RA 2GFAA 2HQEA 4II1A 2XK0A 3MEUA 3ASKA 4UC4A 2JTFA 2EQUA 4PLIA 3DLMA 4QQDA 4A4FA 2LCCA 2RHUA 3ZEHA 1OI1A 4X34A 2L89A 2X4XA 4IKFA 2RO0A 3MO8A 3ME9A 3P8HA 2X4YA 2RHZA 3QIIA 2QQRA 2DIQA 3EAEA 2LDMA 2P0KA 2B8AA 2RI2A 3LX7A 3QBYA 4C5GA 3S3MA 1KHCA 3P8DA 3PFSA 2X4WA 3OYKA 2EKOA 2BUDA 2DIGA 3MP1A 3OS1A 3OS2A 2RHXA 2MWPA 2HQXA 3FLGA 5D6XA 4EDUA 4IUQA 1WGSA 3NTIA 5KCOA 3QJ6A 3MP8A 5C0MA 3OQ5A 3L2QA 4B9XA 5M9OA 5FROA 4QQGA 4IUPA 3S3NA 3QKJA 2NLUA 3LYIA 2K3XA 4A4EA 4RG2A 2JZ2A 3S3OA 1RI0A 2LRQA 4E7LA 2RI5A 2M16A 3BDLA 1MHNA 2X35A 4BACA 3S6WA 4BE1A 5D6YA 3OYGA 2EQKA 3H8ZA 2IG0A 3OY9A 2QQSA 2R58A 2E6NA 4N4HA 1H3ZA 3E9GA 2M1HA 5CIUA 1OZ3A 3L42A 4N4IA 5KE2A 2R5AA 2RHYA 3OYFA 3OYDA 5KCHA 2XDPA 4QQ6A 3MP6A 3SD4A 2RJCA 4A4HA 4PLLA 4NS5A 3L2UA 3LLRA 5D6WA 1OZ2A 2RJEA 5IN1A 2E5QA 4FU6A 4IUTA 3L2RA 4A4GA 5C6SA 3FEOA 3DB4A 2PQWA 3PMTA 4C5HA 4IUUA 2RI3A 3OB9A 5FRNA 1G5VA 4GY5A 3FC3A
chains in the Genus database with same CATH superfamily
1AHJB 4JLGA 3E9FA 4MZMA 2CYZB 3GIBA 5CK9A 3SWNA 1PKSA 5CVIA 2CREA 2OAUA 4FYYB 2Y4YA 3EG0A 1M2VA 3LWHA 3REAB 1B7TA 4KGZB 2QAZA 2KDSA 2HD0A 3EG9B 2ENMA 2PVDB 1GFDA 2EYQA 4OMNA 4M77A 4FSSA 1PC0A 4OMQA 3X20B 4E7ZA 3Q1JA 1ZSZC 1KD1U 2DRMA 4ATOA 2DAQA 3C4SA 3RMSA 3CCUT 3PMIA 1KSWA 5L23A 1Y07A 5GAMh 1G83A 4PJOC 4LDUA 4R0KA 3KFVA 1SRLA 2KSSA 2JTEA 4D8KA 3CMEQ 2JTFA 2MI6A 3A5ZB 1B34A 4QQDA 2LCCA 3M53A 1GCPA 2D0QB 2DYIA 2X4YA 1JJ2A 3QDFA 3JRZA 1G8XA 4WCIA 2D0NA 5I11A 2MWPA 2P4RA 1WGSA 3TU4K 5GANf 3NTIA 3QYGB 3OQ5A 1M1KR 4A4KA 2ZPIB 5GAMe 2DFUA 4LDXA 2BE9B 1G2BA 1JB0E 3CC4T 2DPPB 3QHSA 2GQVA 1ZA2B 1AWOA 4J9EA 1NLPC 3VS5A 2EKHA 2YUPA 1N6AA 1IXDA 1C6VX 1Y7XA 5GAN2 1Q7YC 1UGVA 2E12A 4JS4A 5AYFA 4O6JA 4M7AA 1AVZC 1A0NB 1AEYA 2RJEA 2DXTA 3TSZA 3L2RA 4C0DB 6AT1B 2J05A 1RL2A 3G4ST 3CBMA 4ZTJA 1MUZA 1MGQA 4M78G 4JLIA 3M4GA 4HCZA 4OMLA 4CC2A 1Q82R 3PNWC 1GCQC 4PL6A 2ROLA 3JCMQ 1WXBA 3NGPA 3UF4A 2DO3A 4ZN1A 1D3BB 1VQ5A 2IPOB 2L3PA 1YIJA 5CAIA 2CKKA 1W70A 1YI2Q 2KY9A 3I56A 4M78F 3I9QA 3NHNA 3EHQA 1VQOA 3NPFA 4J83A 4F14A 2V8JA 1YN8A 4GLMA 1YNZA 4PJNA 3JV3A 5LJ5g 1V76A 2EJFA 2L8DA 4Z02A 4CRIA 3L2VA 3TREA 3FJ5A 3AT1B 1C1AA 2F1LA 4J9IA 2DBMA 1KQ2A 4EMHA 3DLMA 1N8RU 2KXDA 4X34A 3I35A 3CC2A 5HK3A 4M7DF 2RHZA 2LT1A 4J7IA 3CCQQ 2LDMA 1KQSP 4YTLA 1NYGA 1QVGS 2FL7A 3RDVA 2DETA 2DIGA 2OTJA 2RHXA 2KRNA 4EDUA 1LPLA 2YUQA 4B9XA 4QVDA 1YJWQ 5M9OA 1MV0B 2JXBA 1NPPA 2RN8A 3CQTA 4J9BA 1BYMA 2E70A 3TVTA 1YJNA 3CMAT 4M75G 2JNGA 2XMFA 1FX7A 1O9SA 5LJ3h 1KQSA 2A0FB 1TUDA 1MHNA 4BACA 4M7AB 2DVJA 1OPLA 4AFUC 1CKBA 3M58A 4HT8A 1Q7YU 1X2KA 1OZ3A 3L42A 3CPWS 1K4US 5IT9E 4X9CA 3OYDA 2OTLT 3CCSA 2JT4A 1VQ8A 2CP6A 5GANg 3JCMg 2CZ0B 4C0GA 1UB4A 4JRQA 3CCET 3HKSA 2KNBB 3RIRA 2K9GA 4DOWA 2RI3A 5IAYA 3PGGA 3CCLQ 2L3RA 4M4ZA 1D0YA 3UDCA 1SSHA 2EQMA 3CCJT 2EGEA 3CCVA 2HKNA 2DL3A 4J8OA 3A8MB 4PJLA 3GNFB 4QKUA 4C92D 3OYLA 2HZYA 4F7UB 2D8JA 2DRKA 2IIMA 3ULRB 4RTVA 1ZHIA 1WYXA 1ZQ1A 1RUWA 4PKCC 2MYSA 1U1TA 3GPLA 1MV3A 1J3TA 3G71Q 2RQTA 3MEVA 3GLXA 2RA2A 2HMAA 2E41A 3NTHA 1UHCA 1C0MA 5ECAA 1NEBA 4PFZA 4ZNXA 2JS0A 3PVLA 4LN2A 1NJIR 1B3QA 1R0BG 1X2QA 1EFNA 3CCLT 1OV3A 1OI1A 3C0CA 1TXQA 1XTDA 1Q86C 3P8HA 3H41A 3HRSA 3LW5E 2DJQA 1PCXA 5IXBA 4XTZA 1CSKA 2LX9A 2DTIA 1Q82U 2HSPA 3MP1A 2HQXA 4XU1A 2RB6A 3PIOA 1BIAA 3I55T 3NMZC 1WHLA 2HSEB 1N5ZA 5CO7A 3CMAQ 1UJ0A 3G6EA 1RI0A 4J9FA 3SEMA 2EGAA 4OGCA 5GMKi 5LJ5d 1RAIB 5KYUA 3SFMA 1VQPQ 1D1AA 1Z9ZA 2QXFA 3CMEA 1M4ZA 1QLYA 1FWZA 3CCRT 2CUBA 4XK8E 2YHTA 3M59A 1VQ7T 1FXXA 3FC3A 1JXOA 1BI3A 2RJFA 3PTAA 3OYIA 2KYMA 2YUOA 1VQ4T 2OX7A 4RTZA 2VYTA 1K0XA 4JZ3A 5GANj 5CKBA 4C8QA 3OYHA 3CC7T 2O4XA 1Q82C 1Y96B 4ZTFA 3ZL7C 1W2BP 2DYBA 4N4GA 7AT1B 1ZA1B 4N0AC 2CS7A 4XTYA 2KK4A 1MMDA 3OYNA 1PKTA 2PNIA 1WHHA 1GL5A 1QVFP 1RLQC 4MZPA 1OULA 2HCKA 2JVVA 4C92A 4P5NA 4L5GA 2L0AA 2VXEA 4R55A 4RTTA 4F7UG 1N9SA 1OEBA 1GRIA 3AHUA 4M7AG 1M1GA 1TSFA 2DKGA 1K9MC 4MDWA 2K6DA 1AWWA 1IZ6A 4XAXB 1VQLA 4IUQA 4MMLA 5KCOA 1VYUA 4EMKC 2F2XA 3HP9A 4FYVB 3QKJA 5A2QE 3G71T 2FB7A 4NL3A 2AIRB 1W2BA 3S3OA 4C92C 3H9NA 4DEXA 4OMMA 1K1ZA 1W2BS 2QTVA 1WA7A 3EFSA 5CIUA 3UA6A 3UATA 4RG8A 5KYUB 2M9UA 1E6GA 2W0ZA 1RLPC 1K8AR 1YWOA 3M54A 1WDXA 1IO6A 1ZX6A 2GTJA 2SEMA 2GGRA 5D6WA 1OZ2A 2QA4Q 1JO8A 4IUTA 3R6OA 2KXCA 3HL8A 3S3MA 2COZA 2LQNA 1BI1A 1M1KU 2LC4A 3OS0A 1YWPA 4RCCA 3UA7A 3VS7A 4BD3A 3PE0A 2VXFA 1UUEA 3SWNB 1HK9A 3WXMB 4BB7A 5GAN4 1S1NA 4OB3B 3I55Q 3M0RA 3MEAA 2DK3A 5IHKA 1S72Q 2BIVA 2Y4XA 4M77E 1H92A 1BCMA 2CH4A 1LCKA 1SKUB 2FHDA 2COWA 2KMTA 3UWNA 2KGTA 1SG5A 2JMAA 1MMNA 2DD5A 1YITA 1VQ7Q 2RM4A 4M7DD 4WTOB 2J7IA 2KROA 1YJ9Q 3ME9A 1OX8A 1VQ4Q 1K73R 1M1FA 2AZSA 4HCBA 2E64A 4F04B 5GANe 2BUDA 1JU5C 2RH2A 4OF1A 5GANh 4PJJA 1WHMA 2LZ6B 3MP8A 2X51A 2GBQA 2HEQA 4J6WA 2XDBA 2C06A 4Y28E 3JB9G 3ZFJA 1VQ9Q 1RAFB 1VOMA 3QWXX 3TQ7P 2DZ9A 4C0ZA 1UGSB 5FU7C 4Y92A 4N4IA 2B86A 3VRZA 3RESA 2KRMA 2ZPFB 4C8QE 2KR3A 4ZN3A 4A4HA 2XIDA 3OSVA 3L2UA 2ED1A 3DB4A 2CSIA 5FW9A 3G4SA 1TUGB 5CKDA 1WJQA 5LJ3f 2MMPA 3I5SA 2YUNA 2JW4A 2RD1A 1TH7A 1I07A 2EWNA 1VQ5T 2QI2A 1YI2T 4O5VA 2AHJB 3I56T 2DERA 1M3CA 3OYCA 1ZUUA 1VQOT 1U1SA 5IH2A 2VWFA 4WF2A 1U06A 2NUTA 1ABOA 4M78A 1QP3A 3BE3A 1QVGA 2C0OA 2LCSA 2JOYA 5GMKj 1QP2A 4M7AD 1OPKA 4KULA 2YT6A 4RTXA 1T0JA 3PT9A 2LVMA 2RJDA 1GBQA 1X01A 2GFAA 2HQEA 2KVQG 1VYVA 3VYHB 1M9SA 4M77F 1YHQT 5FU7B 3L2ZA 2MIOA 3EAEA 2CZ1B 5CQXA 3CCQT 4JRKA 4NL2A 5LJ5j 3OYKA 2QDYB 3V8JA 2EQIA 2KQWA 4E7SA 5CR2A 2EBPA 4IIOA 4M77G 4LE9A 2GCXA 4KGXB 1Y71A 3VS4A 4OMOA 4M7DA 1Q81U 2NLUA 4AT1B 3CMAA 1YJNT 2AKLA 4E47A 1ZUKA 4A54A 3N5BB 5FU6C 3HTRA 2J6KA 3INZA 1JQQA 2NUPA 3J7AF 2RNAA 1QKXA 3JCMJ 4PFPA 1LJOA 2OTLA 1VQ8T 1HJDA 4PJOA 4JDSA 5D7UA 2PQWA 3OS5A 4JJDA 4RMOA 1R8OB 1H641 5KE3A 4E7JA 5LJ3j 4L6V5 3DB3A 3HRUA 3OW2A 3H6ZA 5EC7A 1N8RC 2CP7A 1D0XA 2LT4A 3UT1A 5GMKl 2DL4A 2QEXQ 1X75C 2QG9B 2ESWA 3H0FA 3TCJA 3O8VA 4F17A 1HSQA 4M7AC 2GTOA 5GAN6 3BY7A 4IUVA 1R0CB 5DLOA 1HYOA 3GOXA 1F1BB 4M7DG 5LJ3g 2A37A 2QDLA 3LH5A 3VU3C 2FVUA 2J06A 2EYZA 3FDRA 3ER0A 2H8HA 1WXUA 3QWYA 3MEUA 1NPRA 3VKIA 4AMCA 1X6OA 3T9NA 3VUBA 3CCLA 2K5FA 4C0DC 2RO0A 1NYFA 4QT7A 3CCUQ 2QTXA 4M75E 3VJPA 3PVQA 3X24B 4QVCA 2O9VA 1VQNQ 2OAWA 2H3EB 3M0SA 1GBRA 3C95A 1HXDA 2XU8A 4A4EA 1AWJA 1YJNQ 3G6ET 4E7LA 1Y0MA 1I0CA 2EQKA 4FT2A 1KQ1A 1H3ZA 2EJ9A 3E9GA 4J9CA 1ZSZA 3OYFA 2KAFA 2RMOA 2VVKA 1KG1A 5LJ3d 2LCLA 5FLXE 1M5Q1 2MK5A 2LQWA 5IN1A 3JCMe 2E5QA 2HAXA 5GAOr 1X6GA 1JRIA 3M4YA 1YITQ 1VQ7A 3VS6A 1NLOC 4FL6A 1T3SA 2COYA 2QQ9A 3QPHA 1G3TA 1VYTA 3JB9J 3ZBDA 2FPFA 5J26A 1VQPA 1TS9A 1KC8R 1PWTA 1HD3A 3CC7A 4MMKA 2M02A 1QQJA 3OMCA 5GAMg 2YRVA 4DBRA 5GAMj 3CXCA 1E7OA 1WQ7A 1WXTA 3FB9A 3HFOA 1YP5A 3M57A 4HT9A 2CDTA 1VQ8Q 1B07A 1PRMC 4M77B 2LMJA 1U8RA 4BE2A 2CZ7B 1BCOA 1ZLMA 3CEYA 3EFOA 4JS5A 1LNXA 9ATCB 1K73C 3MCAB 1WPYA 3MHXA 5LJ3e 2O88A 4A4FA 4FCYA 2HL3A 4DBHA 5GAOq 1TG0A 5A0GA 2CT3A 1G3WA 2DIQA 1MNEA 2C0IA 2CH4W 3OS1A 2NYSA 4ME7A 3M55A 5FWCA 1RAHB 4JJNK 3L2QA 2VC8A 1I5LA 5FROA 2EYYA 2K2VA 2K3XA 4HKEA 2E3HA 1X27A 1SHFA 1RAAB 2JM8A 4A53A 1LVKA 4BE1A 4PFOA 1D0ZA 1UDLA 3RMQA 3OY9A 4OB0B 3CD6Q 5GAN3 2PZ1A 4Y91A 1I4K1 4KRTA 2A08A 2XHCA 2ZCFB 2O31A 1Q86R 3LLRA 1JJ2P 1D09B 3JAME 4M75A 3JSCA 4TVRA 3CPWA 1VQ9T 3M0PA 5I21A 1EX4A 4F16A 1AD5A 3RNJA 2VV5A 2ZPBB 3CCMA 1XNIA 2KI7A 3MKDA 1M8MA 4DEYA 2DEQA 5DLQE 2SRCA 4BI3A 4XTUA 3JCMh 3OYMA 2QA4A 1WX6A 1UGRB 2DM1A 2E65A 4EMGA 2DE0X 3JCMb 5KYNA 1WHKA 4ORZA 4FM4B 4M7AF 3E19A 4HA8A 3VS3A 1PG5B 4XTWA 1UTIA 2LNHB 2EFIA 1X6BA 2V1QA 1NE8A 4BI8B 2X3WD 2EW3A 5I2MA 2BZXA 2K57A 1MMGA 2KRSA 1TOVA 1YITT 2G6FX 1GXIE 4FIBA 4II1A 1OOTA 2XK0A 3RKXA 1UFFA 3CBPA 4EPCA 4M78B 4ZGDB 3HSBA 1QMCA 5KYWB 3QBYA 3E1SA 1KHCA 1W1FA 2YSQA 4J9HA 2ZGWA 1WNLA 4QQGA 2DX1A 2JZ2A 2HQHA 2F2WA 4PJOB 4JPBW 2RI5A 1WFWA 2X35A 3REBB 3H8ZA 5KYXB 2R58A 3RERA 1W4SA 3UPUA 3V8KA 5IXFA 1FMWA 2DMOA 2A36A 5KYYA 3MP6A 1KD1C 2RJCA 1VUBA 4ELZC 4NS5A 2YWWA 2WSCE 2KEAA 5FU6B 4C5HA 4IUUA 4R56A 3CC4Q 2M0YA 1RI9A 1UEBA 1M2VB 3SDZA 2JS2A 2QK0A 2MCNA 2DL8A 1JXMA 2R57A 5GAN5 4HCCA 2EPDA 3OYJA 2L2PA 1SEMA 4QVZA 3CCSQ 2XG8D 1AWXA 3G7ZA 1YI2A 2A3LA 5FWBA 3RR6A 3OYEA 3FRNA 1YJ9T 2RHIA 3VS2A 1U5SA 3G4SQ 1KFZA 3JB9I 4M78E 1ARKA 4EMKA 1WJSA 1M90U 2K79A 3MEWA 1T3LA 2YDLA 4XU0A 4C92B 2E1HA 4XQ3A 3OYAA 1M8VA 5GAN7 2YLCA 3H0HA 2CZ6B 1GFCA 3CBOA 2KE9A 5L8RE 3BFMA 5I22A 3EHRA 2MF2A 3JB9F 3ZEHA 2DTOA 3H0IA 3OBYA 1YHQA 3RBBB 4C8QB 5GAMf 2DVEA 4M7AE 3CCQA 3P8DA 1VQNT 1P92A 5J3BA 3VV0A 1FMVA 2CP3A 1ABQA 2V1RA 2FPDA 4OB1B 2JUFA 4J7FA 3GF5A 2QASA 4FT4A 2VGNA 2HNIA 3HHTB 5HY6A 3BDLA 2X3XD 5GANd 1QVPA 1VQKT 2J6FA 3X28B 5I2SA 3E2UA 3GBQA 4HVVA 4AFSC 1VQ5Q 2RQRA 5GAOl 1IB8A 3M0TA 3EFRA 1VQ6Q 5IHIA 2EAYA 3FEOA 3PMTA 3V7CA 2KT1A 3OB9A 3F70A 1VQ6T 2A28A 4HVWA 4OGEA 4RTYA 2F5TX 4PJMA 5CKFA 3JCMV 4CC4B 4AFZC 2GQIA 4BE0A 4E7IA 3JCMc 2DJZA 4J9DA 1I5OB 3OMGA 1BK2A 4PJOE 1PSEA 1D3BA 1BI2A 1N27A 2LP5A 3RUXA 1D1CA 1V1CA 4VUBA 4BDYA 3FJPA 4ESRA 1MMAA 3LGFA 3LWIA 1QWFA 2LTOA 3CCRQ 2QYZA 4Q5WA 5EG2A 1CKAA 1SSFA 3CPFA 3FIFA 5CKHA 5A0LA 4AFQC 1JJ2S 3M9QA 1ACMB 3EH1A 2PVOB 1YJWA 1PM3A 4XU3A 2IVWA 2EQUA 2VKNA 3QUIA 2Z0WA 4PNOA 1YBYA 3QIIA 4KH1B 2P84A 1RADB 2B8AA 4ELYC 4Z8AA 2YRCA 3EGXB 4EIKA 1D1BA 1TU0B 1VQMT 4HVUA 3A8OB 4IUPA 3M0QA 3S3NA 3LYIA 1ZSZB 2V26A 2HL5C 2ATCB 3CCJQ 1UG1A 3S6WA 3OW2P 4K11A 4JZ4A 1I1JA 1YCYA 2K3BA 4KT0E 1M90C 1RACB 4IIMA 1H8KA 2K5IA 2DXCA 3CXCS 2D1XA 1K0SA 5C6SA 4B6MA 1AOJA 2VGMA 4JJCA 1XJWB 2D9TA 1QVFS 2QGFB 3CD6A 4LD6A 1NJIC 3P8BB 5GJWB 1PD0A 2XI9A 2R5MA 4C8QD 1VQPT 2FZGB 2KBTA 1TWBA 3THKA 2FRYA 5KH6A 4KBMB 2H3JA 2DXUA 3QYHB 1BIBA 2ZPEB 1WZOA 1PHTA 2E3IA 2F69A 4LDYA 2DL7A 1M1KC 5GAN8 1Q86U 3L2WA 1DJ7B 2NUZA 4OVAA 3J80E 1IHVA 2K3YA 2XDDA 2RPNA 2YXYA 3HFNA 4PJOG 3LGLA 3META 5AT1B 1AZEA 3V7SA 4EMKB 2DLPA 1ZUYA 3EGUA 3URGA 3LH0A 1IGUA 1KJWA 2L5QA 2P0PA 1SRMA 2ROTA 3X25B 1S72A 5GJVB 4CI0C 3A98A 4PJOF 1Q95G 3G6EQ 1NEGA 8ATCB 4LNPA 2RQVA 1G3SA 2O01E 3OYYA 1BI0A 4M7DE 1XQHA 2ED0A 2FZCB 4M7DB 3EGXA 1NM7A 2ZPHB 3FLGA 1G3YA 2FPEA 1Z9QA 4AG1C 3QO3A 4KUIA 1VQMQ 1QWEA 4GBQA 1MNDA 1WI7A 1OU9A 1AT1B 3CCEQ 3JCMW 1YIJQ 4D6WA 2DTHA 4AG2C 2VB6A 2NUPB 1KIKA 2E6ZA 4FYXB 2WSFE 2E4HA 4M77D 3QG1A 3OYGA 4LD9K 4ANJA 2E6NA 4MZTA 3TEEA 1V29B 2QEXA 3SD4A 4MDXA 2EYXA 1ZBXA 4X9DA 4LUDA 1KHIA 2Y90A 2LNVA 1VQ9A 2C0TA 2EIFA 3JB9H 4L59A 3WVEB 4BDZA 3RKYA 4C5EA 1KC8U 1NBEB 3CXCP 3CCMT 3D7SB 4M78D 5LL6S 2FZKB 3GP8A 3KBGA 1TTHB 4IURA 1IHWA 2EYWA 5LJ5e 1OYXA 2BE7D 2HKQB 1M3BA 3QJYA 4DQ2A 2PTKA 2QA4T 1OQKA 3OW2S 4RCBA 3VUZA 1TUCA 4QW2A 1EIFA 1NJIU 2O9SA 2XKOC 1EZZB 1OU8A 1R77A 3CCUA 1VQKQ 2PVGB 5A0DA 1H3HA 4E7HA 4PK4A 8AT1B 4DOVA 2NWMA 5HCKA 1PRLC 2CUDA 2K7AA 1UJYA 1Q81R 3EGDA 1N9RA 1SPKA 5GAMd 3M56A 3CPWP 2ZZDA 3QZ9B 3VRYA 2RI2A 3LX7A 1QCOA 3PFSA 2X4WA 5KYWA 1B34B 3EFOB 4OP0A 3CCVQ 1JEGA 1FYNA 3O5ZA 3M0UA 4OMFB 3V8LA 3CC4A 1UECA 4RG2A 4X1VA 4C8QC 4KH0B 2MOXA 1QVGP 4FW1A 1K8AU 1U3OA 2P0QA 5DM7R 3SHWA 1M27C 4ZGJB 4C8QF 1YHQQ 1I8FA 2M1HA 3VS0A 3HRTA 2DNUA 1RAGB 1O75A 2FRWA 4GLKA 2DBKA 3EG9A 4PLLA 4HXJA 2WSEE 1KD1R 4XU2A 2OI3A 2NUTB 2EJGA 4C8QG 4M75F 2LJ3A 3MJXA 1M30A 4C92F 2EGCA 1VIEA 2X9HA 2F5KA 2HBPA 1KC8C 4DBQA 2OTJQ 1WHGA 1YIJT 2OJ2A 4JRIA 4FW2A 4C92G 4PJOD 3MPUB 1VIFA 1N8RR 3BDUA 2LJ1A 4HCKA 5CQYA 1YJ9A 2EQJA 2EVRA 3I5RA 4KUDK 5CKEA 2RK2A 4V2SA 1X43A 4E7KA 3EGDB 2ZPGB 1NZ9A 2CP2A 3C94A 5FRMA 1XOVA 3A8LB 3A8GB 1YCSB 4CC7A 4XTXA 4RUGA 4F7UE 3DKMA 2RF0A 5J39A 4BY6B 4UC4A 2DL5A 2RHUA 5CCAA 3CC2T 1FMKA 3EG2A 1QVFA 3G1JA 3R6NA 3A1PA 4C5GA 1PSFA 1VQNA 2P4TA 2EKOA 2VUBA 2OTJT 3VYGA 5D6XA 3CCMQ 2DEUA 4BI4A 3QJ6A 5HKCA 2JMCA 2AT1B 2FEIA 1VA7A 5GAOm 1SF9A 2K4YA 4CC3A 2K5LA 4FSXA 4ZGEB 1PD1A 4JRPA 1UE9A 1YFNA 2M16A 1M3AA 4RTWA 5D6YA 5IHNA 1VQKA 2V8IA 1QKWA 2MAMA 4E2FB 1WQWA 1IREB 3C12A 4C92E 3M5AA 2XDPA 3CCST 2E10A 1SHGA 4OMPA 1K8AC 4Z89A 4JJBA 3CCEA 4A4GA 2PUKB 2HBWA 2D6FA 2ABLA 1G5VA 1VQ6A 1VQOQ 2O4XB 4F7UA 1GCQA 1WJRA 1VQLQ 3CCJA 3CCVT 4KGVB 2M51A 2BZ8A 3L1AA 4C5IA 3SWNC 2PU9B 3SB2A 3PIPA 2YLBA 4A63B 1BU1A 2BZYA 3KUFA 2VASA 3JCMd 4B9WA 2GFUA 2QQBA 3OBWA 1QCFA 1K9MR 3EH2A 3OA6A 3WVDB 4M75B 2F2VA 4N0AA 3OYBA 2FYKA 3J81E 4XTVA 4LXCA 1YJWT 1UGPB 3ASKA 2A7YA 2CSQA 1Q81C 1Y96A 4PLIA 1W6XA 2L3SA 3BW1A 5GMKh 4OB2B 4IKFA 2DF6A 3CC2Q 3MO8A 2RK1A 3RKWA 1RABB 4J6XA 1X69A 2P0KA 3JB9D 1E6HA 4BY6C 1K73U 1VQMA 2CP0A 2E5KA 4F7UF 4FYWB 3I55A 2JJ9A 3U23A 3JCMP 1QW1A 4J6YA 5KYXA 4LDVA 5GMKe 4D8DA 2AZVA 5KYYB 4LDWA 5GAOn 2V8KA 2RQUA 1T0HA 2QQSA 1PNJA 4RKUE 5KE2A 2RHYA 1M90R 2XICA 5KCHA 1BKBA 4QQ6A 5GMKm 1BB9A 1AZGB 2J6OA 3CMET 2BTTA 2D8HA 4M77C 2LX7A 4FU6A 3I56Q 5LJ5f 5LJ5h 3CCRA 3VS1A 4J5YA 2K2MA 4M75C 3CD6T 3V7RA 2BKDN 5GAOp 3QDRB 3NFCA 1ZSGA 3TSWA 3EG1A 1Q7YR 1BBZA 1VQ4A 2CP5A 2JTMA 4E6RA 2DD4A 2DA9A 2HDAA 1Y57A 2M0OA 2FG0A 1K9MU 2GNCA 2X4JA 3X26B 1NG2A 2CGHA 1K76A 1UHFA 2FO0A 1QCNA 1ZBJA 1WIEA 2QGGA 1KQSS 2L3QA 2AKKA 4M7DC 2GF7A 1IRXA 3NTKA 1JBMA 4LUEA 3IQLA 2WACA 2MWOA 1WLPB 1M2OA 1UGQB 4DA4A 2OTLQ 2XD0A 2AK5A 2LQ8A 2G3RA 1S72T 3KXTA 2O2OA 3HPWA 2L89A 2X4XA 1LOJA 2W10A 2QQRA 4C0FA 1I81A 4NOYA 3JCMX 2DZCA 1WHJA 3JCMf 3QSUA 4RTUA 2DXBA 2JM9A 4JUVA 3OS2A 5HK0A 1VQLT 1OX9A 3QZ5B 3QXEB 2KYBA 2ZAEA 5C0MA 3A8HB 2ECZA 2QQAA 2DILA 3OSSC 4M78C 3G71A 2LJ0A 2KT8A 2LRQA 3GNGA 2IG0A 1IGQA 2RQWA 4N4HA 2R5AA 3DLLA 3EG3A 4J9GA 1K9AA 2QEXT 4M75D 4Z88A 4BUGA 4DBFA 2I2LA 2LQKA 2MPXC 3CC7Q 1KK7A 2CT4A 5DY9A 1RAEB 2I0NA 2PUOB 5FRNA 4GY5A 2YRDA 2JN0A
chains in the Genus database with same CATH topology
1AHJB 2EIFA 1BI1A 5I21A 4JLGA 2LC4A 4L59A 1M1KU 3JB9H 3E9FA 4MZMA 3WVEB 4BDZA 2CYZB 3GIBA 3RKYA 4C5EA 5CK9A 3OS0A 3SWNA 2VV5A 1KC8U 4RCCA 2ZPBB 5CVIA 4BD3A 2VXFA 3CCMT 1XNIA 3CCMA 2OAUA 4M78D 1HK9A 3SWNB 3WXMB 4BB7A 5LL6S 5GAN4 3GP8A 3KBGA 2DEQA 4IURA 5DLQE 2Y4YA 4BI3A 5LJ5e 3LWHA 4OB3B 1OYXA 3QJYA 4XTUA 4DQ2A 3MEAA 2DK3A 2KDSA 2HD0A 3JCMh 3OYMA 2QA4T 2QA4A 2BIVA 2PVDB 2Y4XA 3OW2S 4RCBA 1UGRB 2EYQA 2E65A 4M77E 4EMGA 3VUZA 4M77A 3JCMb 4QW2A 1EIFA 1NJIU 4FM4B 3X20B 4M7AF 3CMAT 3E19A 4HA8A 2XKOC 3Q1JA 4XTWA 1KD1U 4ATOA 2DAQA 2FHDA 2EFIA 3C4SA 3RMSA 3CCUA 3CCUT 3PMIA 2PVGB 1Y07A 1NE8A 5A0DA 5GAMh 4LDUA 4BI8B 4E7HA 2KMTA 4PJOC 3UWNA 5I2MA 2K57A 2KSSA 4DOVA 2DD5A 1YITT 1YITA 2RM4A 4M7DD 1GXIE 4FIBA 4II1A 1N9RA 2XK0A 3RKXA 5GAMd 3M56A 2JTFA 2MI6A 3A5ZB 1B34A 4QQDA 4A54A 2LCCA 3M53A 2D0QB 3CBPA 2ZZDA 3QZ9B 3ME9A 2X4YA 4EPCA 4M78B 1JJ2A 4ZGDB 3HSBA 3JRZA 1M1FA 2RI2A 3LX7A 3QBYA 3S3MA 3E1SA 4HCBA 1KHCA 3PFSA 2E64A 2X4WA 5GANe 1B34B 2BUDA 4OP0A 2RH2A 2MWPA 4OF1A 1WGSA 5GANh 5GANf 3TU4K 3NTIA 3CPWA 3MP8A 3QYGB 3OQ5A 4A4KA 2ZGWA 1WNLA 2ZPIB 4QQGA 5GAMe 4LDXA 4OMFB 4J6WA 4JRPA 2C06A 3V8LA 1JB0E 4Y28E 3CC4T 4RG2A 3JB9G 2DPPB 2JZ2A 3ZFJA 4C8QC 3QHSA 3CC4A 2GQVA 4PJOB 2RI5A 2DZ9A 1K8AU 2X35A 2P0QA 5DM7R 1N6AA 3H8ZA 4C0ZA 4ZGJB 4C8QF 3RERA 2R58A 1UGSB 5FU7C 1Y7XA 1I8FA 1W4SA 2M1HA 5GAN2 3UPUA 4N4IA 1Q7YC 3V8KA 3HRTA 3RESA 2E12A 3MP6A 1O75A 4GLKA 1KD1C 2ZPFB 4C8QE 4ZN3A 2RJCA 4A4HA 2XIDA 1VUBA 3OSVA 2WSEE 4NS5A 4PLLA 4O6JA 4XU2A 5AYFA 4ELZC 3L2UA 4JS4A 4M7AA 2RJEA 2DXTA 2WSCE 3L2RA 4C0DB 2EJGA 4C8QG 3DB4A 5FU6B 4C5HA 4IUUA 4R56A 4M75F 1RL2A 3G4ST 3CBMA 3G4SA 1UEBA 4ZTJA 5CKDA 3SDZA 1WJQA 5LJ3f 1MGQA 4C92F 4M78G 4JLIA 3M4GA 1VIEA 2MMPA 4HCZA 5GAN5 2R57A 4HCCA 3PNWC 2F5KA 4PL6A 2HBPA 3OYJA 3JCMQ 2RD1A 1TH7A 1KC8C 4QVZA 2EWNA 2DO3A 4ZN1A 1D3BB 1VQ5T 1VQ5A 1YIJT 2QI2A 2XG8D 5CAIA 2CKKA 3G7ZA 4JRIA 1YIJA 1YI2T 4O5VA 1YI2A 2A3LA 2AHJB 2KY9A 3I56T 4C92G 3I56A 4PJOD 4M78F 1VIFA 3OYCA 3OYEA 3BDUA 3FRNA 1VQOT 1VQOA 1U1SA 5CQYA 1YJ9T 1YJ9A 4J83A 4WF2A 2RHIA 4M78A 2EQJA 2V8JA 4KUDK 1QP3A 3JB9I 1QVGA 4M78E 5CKEA 2RK2A 4EMKA 1WJSA 4V2SA 4E7KA 1M90U 2JOYA 5GMKj 1QP2A 3MEWA 4XU0A 4C92B 5LJ5g 2ZPGB 1NZ9A 2E1HA 3C94A 1XOVA 5FRMA 2EJFA 2L8DA 4Z02A 4CRIA 3L2VA 4M7AD 3A8LB 3A8GB 4KULA 4XQ3A 4XTXA 3OYAA 3TREA 1M8VA 4F7UE 3PT9A 5GAN7 3DKMA 2YLCA 5J39A 2LVMA 2RJDA 2CZ6B 1X01A 2GFAA 2HQEA 4BY6B 1KQ2A 2KVQG 3CBOA 4UC4A 4EMHA 5L8RE 3DLMA 3BFMA 3VYHB 1N8RU 1M9SA 2MF2A 2RHUA 3ZEHA 3JB9F 4X34A 5CCAA 3CC2A 3CC2T 4M77F 5HK3A 2DTOA 1YHQT 3OBYA 1YHQA 4M7DF 2RHZA 2LT1A 3L2ZA 5FU7B 1QVFA 4J7IA 4C8QB 5GAMf 2DVEA 2LDMA 2CZ1B 3EAEA 5CQXA 3CCQT 3CCQA 4M7AE 4JRKA 4YTLA 4C5GA 1QVGS 3P8DA 2FL7A 4NL2A 1PSFA 5LJ5j 1VQNA 2P4TA 1P92A 2QDYB 2EKOA 2VUBA 5J3BA 3VV0A 2DIGA 3V8JA 3OYKA 2OTJA 2OTJT 3VYGA 2KQWA 2RHXA 5D6XA 4EDUA 5CR2A 4M77G 4BI4A 3QJ6A 5HKCA 2GCXA 4B9XA 4QVDA 5M9OA 1NPPA 1Y71A 4OB1B 2JUFA 4J7FA 4M7DA 5GAOm 1Q81U 1BYMA 2NLUA 2K4YA 2E70A 3CMAA 2K5LA 1YJNT 3GF5A 4FSXA 4M75G 4E47A 2VGNA 2JNGA 2HNIA 3HHTB 4FT4A 1FX7A 3N5BB 1O9SA 2M16A 5FU6C 5HY6A 3BDLA 5LJ3h 1KQSA 3INZA 1MHNA 5GANd 4M7AB 4BACA 3J7AF 1VQ9A 1QVPA 5D6YA 1VQKT 1VQKA 2V8IA 3M58A 2MAMA 4HT8A 1WQWA 1IREB 3X28B 5I2SA 1Q7YU 3JCMJ 3C12A 1OZ3A 3L42A 3CPWS 4C92E 3M5AA 5IT9E 4X9CA 3OYDA 2XDPA 1LJOA 2OTLT 2OTLA 3CCSA 3CCST 2E10A 5GAOl 1VQ8T 1VQ8A 4PJOA 4JDSA 1K8AC 5GANg 3JCMg 2CZ0B 4C0GA 1UB4A 4JRQA 3CCEA 3CCET 3EFRA 3HKSA 4A4GA 2EAYA 2PUKB 3RIRA 4DOWA 3FEOA 3PMTA 2PQWA 3OS5A 3V7CA 4RMOA 2RI3A 3OB9A 5IAYA 3PGGA 2D6FA 1G5VA 1H641 1R8OB 2L3RA 3F70A 5KE3A 1VQ6T 1VQ6A 4E7JA 4OGEA 5LJ3j 4L6V5 2O4XB 4F7UA 3UDCA 2F5TX 3DB3A 3HRUA 3OW2A 5CKFA 2EQMA 1WJRA 3H6ZA 3JCMV 3CCJA 3CCJT 3CCVA 3CCVT 1N8RC 2LT4A 3UT1A 5GMKl 4BE0A 4J8OA 4E7IA 3JCMc 3A8MB 2DJZA 3GNFB 3L1AA 4C5IA 4C92D 1X75C 3OMGA 3TCJA 3OYLA 3O8VA 4F7UB 3SWNC 4PJOE 1PSEA 2PU9B 1D3BA 1BI2A 1N27A 2YLBA 3SB2A 3PIPA 3RUXA 4VUBA 4BDYA 1ZHIA 3KUFA 4M7AC 5GAN6 3JCMd 1ZQ1A 3BY7A 3FJPA 4IUVA 5DLOA 4PKCC 4B9WA 3LGFA 3LWIA 2GFUA 2QQBA 3OBWA 3GOXA 2LTOA 1U1TA 3GPLA 4M7DG 5LJ3g 3MEVA 4Q5WA 3OA6A 3GLXA 2RA2A 3WVDB 4M75B 5EG2A 1SSFA 3CPFA 2E41A 3NTHA 4N0AA 3FIFA 3VU3C 5CKHA 5A0LA 2FVUA 3OYBA 2FYKA 1JJ2S 3M9QA 3FDRA 3J81E 3ER0A 4XTVA 2PVOB 1YJWA 1YJWT 4XU3A 3MEUA 1NPRA 1UGPB 3ASKA 2A7YA 3VKIA 1X6OA 1Y96A 2EQUA 2IVWA 4PLIA 3BW1A 3T9NA 3QUIA 3VUBA 5GMKh 3CCLT 3CCLA 1OI1A 4OB2B 2K5FA 4C0DC 2RO0A 4IKFA 1XTDA 3MO8A 1Q86C 2RK1A 3P8HA 4PNOA 1YBYA 3QIIA 3HRSA 3RKWA 4J6XA 3LW5E 2QTXA 2P0KA 2B8AA 4M75E 4XTZA 4ELYC 2LX9A 3VJPA 2DTIA 3JB9D 3X24B 4QVCA 1Q82U 3MP1A 4BY6C 2HQXA 1K73U 4XU1A 1VQMT 2RB6A 1VQMA 3PIOA 1BIAA 4F7UF 3A8OB 4IUPA 3I55A 3I55T 3C95A 1HXDA 2XU8A 3S3NA 3LYIA 4A4EA 3JCMP 1QW1A 4J6YA 5CO7A 3G6EA 3G6ET 1RI0A 4LDVA 4E7LA 5GMKe 5GAOn 4LDWA 2V8KA 3S6WA 4OGCA 5GMKi 2EQKA 4FT2A 2QQSA 1KQ1A 4RKUE 5LJ5d 1H3ZA 2EJ9A 3E9GA 3SFMA 5KE2A 2RHYA 3OYFA 2XICA 1YCYA 5KCHA 1BKBA 4KT0E 4QQ6A 2KAFA 1M90C 5GMKm 2QXFA 3CMEA 3CMET 1KG1A 5LJ3d 2LCLA 5FLXE 1M4ZA 1M5Q1 2K5IA 4M77C 2DXCA 2E5QA 5IN1A 4FU6A 3JCMe 3CXCS 2HAXA 5GAOr 1FWZA 1JRIA 3M4YA 5C6SA 2VGMA 5LJ5f 4XK8E 5LJ5h 3CCRT 2YHTA 3M59A 3CCRA 4J5YA 1VQ7T 1VQ7A 1FXXA 3FC3A 2D9TA 1BI3A 2RJFA 3PTAA 1QVFS 4FL6A 4M75C 3OYIA 3CD6A 3CD6T 3QPHA 4LD6A 2BKDN 2QQ9A 1G3TA 3P8BB 3QDRB 3V7RA 5GAOp 3NFCA 1NJIC 3JB9J 2XI9A 3ZBDA 2R5MA 1VQ4T 1VQ4A 5J26A 2JTMA 4C8QD 1VQPA 1VQPT 2VYTA 2DD4A 5KH6A 4KBMB 2M0OA 5GANj 2H3JA 5CKBA 2DXUA 4C8QA 3OYHA 3QYHB 1K9MU 3CC7A 3CC7T 4MMKA 2O4XA 1Q82C 1Y96B 2X4JA 5GAMg 3OMCA 3X26B 1BIBA 2YRVA 2CGHA 2ZPEB 4ZTFA 4ZGEB 2F69A 4N4GA 5GAMj 4LDYA 2XDBA 4N0AC 2CS7A 4XTYA 3CXCA 2KK4A 5GAN8 3OYNA 1Q86U 1M1KC 1KQSS 3L2WA 1DJ7B 3J80E 4OVAA 1WQ7A 3FB9A 4M7DC 2GF7A 3NTKA 1Q81C 2K3YA 1JBMA 3HFOA 2XDDA 3M57A 3HFNA 2WACA 4MZPA 4PJOG 2MWOA 4HT9A 3LGLA 1UGQB 3META 4M77B 4DA4A 3V7SA 4EMKB 2XD0A 2JVVA 4C92A 1U8RA 4BE2A 3URGA 2LQ8A 4P5NA 4L5GA 3LH0A 2L5QA 2CZ7B 2P0PA 3CEYA 4JS5A 1LNXA 1K73C 3MCAB 3X25B 2G3RA 2VXEA 1WPYA 4R55A 1S72T 1S72A 4CI0C 4F7UG 1N9SA 3MHXA 4PJOF 5LJ3e 4A4FA 3AHUA 3KXTA 3HPWA 4M7AG 5GAOq 1M1GA 2L89A 2X4XA 5A0GA 1G3WA 2DKGA 1LOJA 1K9MC 4MDWA 2QQRA 4C0FA 1I81A 2DIQA 4NOYA 2DZCA 1G3SA 3JCMX 2O01E 3OYYA 3JCMf 1BI0A 3QSUA 4M7DE 1XQHA 1IZ6A 4XAXB 2DXBA 4M7DB 4JUVA 3OS2A 3OS1A 5HK0A 2ZPHB 3FLGA 1G3YA 1VQLA 1VQLT 4IUQA 3QZ5B 4ME7A 4MMLA 3QXEB 3M55A 5KCOA 3QO3A 5C0MA 4KUIA 4JJNK 3L2QA 2VC8A 3A8HB 1I5LA 2QQAA 5FROA 4EMKC 3HP9A 3JCMW 2K2VA 2DTHA 3OSSC 3QKJA 4D6WA 5A2QE 2K3XA 4HKEA 4M78C 3G71T 3G71A 2FB7A 2E6ZA 4NL3A 1W2BA 2WSFE 3S3OA 1YJNA 2LRQA 4A53A 4C92C 1VQNT 3GNGA 4M77D 3QG1A 4BE1A 3OYGA 4LD9K 3RMQA 1W2BS 2IG0A 3OY9A 3EFSA 2E6NA 4N4HA 4OB0B 4MZTA 5GAN3 5CIUA 2R5AA 3DLLA 4Y91A 4RG8A 2M9UA 1I4K1 3TEEA 1V29B 2XHCA 3M54A 4M75D 3SD4A 4BUGA 2QEXA 2QEXT 4MDXA 2ZCFB 2I2LA 2LQKA 1ZBXA 4X9DA 3LLRA 5D6WA 1OZ2A 4IUTA 5DY9A 1KHIA 4M75A 3JAME 2Y90A 3R6OA 3JSCA 4TVRA 2LNVA 2PUOB 5FRNA 3HL8A 1VQ9T 4GY5A 2JN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3R A;  3F70 A;  5KE3 A;  2D9T A;  2RJF A;  4ZTJ A;  1WJQ A;  4L59 A;  4FL6 A;  4E7J A;  2O4X B;  3E9F A;  3OYI A;  4LD6 A;  4BDZ A;  2BKD N;  3DB3 A;  4C5E A;  3OS0 A;  4HCZ A;  2EQM A;  1WJR A;  2R57 A;  3H6Z A;  3PNW C;  2F5K A;  1XNI A;  2R5M A;  4PL6 A;  4BD3 A;  5J26 A;  3OYJ A;  3UT1 A;  2VYT A;  4BE0 A;  4IUR A;  4QVZ A;  4E7I A;  5KH6 A;  4C5I A;  2M0O A;  3OYL A;  3OMG A;  1OYX A;  3O8V A;  2CKK A;  3OYH A;  3MEA A;  2O4X A;  1N27 A;  3OYM A;  2BIV A;  3OMC A;  2YRV A;  4ZTF A;  3OYC A;  3OYE A;  4BDY A;  3KUF A;  4IUV A;  4N4G A;  4QW2 A;  2RHI A;  4B9W A;  2EQJ A;  3LGF A;  2GFU A;  3OYN A;  3GOX A;  2LTO A;  3Q1J A;  3L2W A;  1WJS A;  4OVA A;  4E7K A;  2DAQ A;  2FHD A;  2EFI A;  2GF7 A;  3C4S A;  3MEV A;  2K3Y A;  3NTK A;  4Q5W A;  5IAY A;  3OA6 A;  3PMI A;  3MEW A;  2WAC A;  2MWO A;  4E7H A;  1SSF A;  5FRM A;  2L8D A;  4Z02 A;  3NTH A;  4CRI A;  3LGL A;  3MET A;  3UWN A;  3L2V A;  3OYA A;  3OYB A;  4BE2 A;  3LH0 A;  3M9Q A;  3FDR A;  3CEY A;  5J39 A;  2LVM A;  2RJD A;  2G3R A;  2GFA A;  2HQE A;  4II1 A;  2XK0 A;  3MEU A;  3ASK A;  4UC4 A;  2JTF A;  2EQU A;  4PLI A;  3DLM A;  4QQD A;  4A4F A;  2LCC A;  2RHU A;  3ZEH A;  1OI1 A;  4X34 A;  2L89 A;  2X4X A;  4IKF A;  2RO0 A;  3MO8 A;  3ME9 A;  3P8H A;  2X4Y A;  2RHZ A;  3QII A;  2QQR A;  2DIQ A;  3EAE A;  2LDM A;  2P0K A;  2B8A A;  2RI2 A;  3LX7 A;  3QBY A;  4C5G A;  3S3M A;  1KHC A;  3P8D A;  3PFS A;  2X4W A;  3OYK A;  2EKO A;  2BUD A;  2DIG A;  3MP1 A;  3OS1 A;  3OS2 A;  2RHX A;  2MWP A;  2HQX A;  3FLG A;  5D6X A;  4EDU A;  4IUQ A;  1WGS A;  3NTI A;  5KCO A;  3QJ6 A;  3MP8 A;  5C0M A;  3OQ5 A;  3L2Q A;  4B9X A;  5M9O A;  5FRO A;  4QQG A;  4IUP A;  3S3N A;  3QKJ A;  2NLU A;  3LYI A;  2K3X A;  4A4E A;  4RG2 A;  2JZ2 A;  3S3O A;  1RI0 A;  2LRQ A;  4E7L A;  2RI5 A;  2M16 A;  3BDL A;  1MHN A;  2X35 A;  4BAC A;  3S6W A;  4BE1 A;  5D6Y A;  3OYG A;  2EQK A;  3H8Z A;  2IG0 A;  3OY9 A;  2QQS A;  2R58 A;  2E6N A;  4N4H A;  1H3Z A;  3E9G A;  2M1H A;  5CIU A;  1OZ3 A;  3L42 A;  4N4I A;  5KE2 A;  2R5A A;  2RHY A;  3OYF A;  3OYD A;  5KCH A;  2XDP A;  4QQ6 A;  3MP6 A;  3SD4 A;  2RJC A;  4A4H A;  4PLL A;  4NS5 A;  3L2U A;  3LLR A;  5D6W A;  1OZ2 A;  2RJE A;  5IN1 A;  2E5Q A;  4FU6 A;  4IUT A;  3L2R A;  4A4G A;  5C6S A;  3FEO A;  3DB4 A;  2PQW A;  3PMT A;  4C5H A;  4IUU A;  2RI3 A;  3OB9 A;  5FRN A;  1G5V A;  4GY5 A;  3FC3 A; 
#chains in the Genus database with same CATH topology
 1AHJ B;  4JLG A;  3E9F A;  4MZM A;  2CYZ B;  3GIB A;  5CK9 A;  3SWN A;  1PKS A;  5CVI A;  2CRE A;  2OAU A;  4FYY B;  2Y4Y A;  3EG0 A;  1M2V A;  3LWH A;  3REA B;  1B7T A;  4KGZ B;  2QAZ A;  2KDS A;  2HD0 A;  3EG9 B;  2ENM A;  2PVD B;  1GFD A;  2EYQ A;  4OMN A;  4M77 A;  4FSS A;  1PC0 A;  4OMQ A;  3X20 B;  4E7Z A;  3Q1J A;  1ZSZ C;  1KD1 U;  2DRM A;  4ATO A;  2DAQ A;  3C4S A;  3RMS A;  3CCU T;  3PMI A;  1KSW A;  5L23 A;  1Y07 A;  5GAM h;  1G83 A;  4PJO C;  4LDU A;  4R0K A;  3KFV A;  1SRL A;  2KSS A;  2JTE A;  4D8K A;  3CME Q;  2JTF A;  2MI6 A;  3A5Z B;  1B34 A;  4QQD A;  2LCC A;  3M53 A;  1GCP A;  2D0Q B;  2DYI A;  2X4Y A;  1JJ2 A;  3QDF A;  3JRZ A;  1G8X A;  4WCI A;  2D0N A;  5I11 A;  2MWP A;  2P4R A;  1WGS A;  3TU4 K;  5GAN f;  3NTI A;  3QYG B;  3OQ5 A;  1M1K R;  4A4K A;  2ZPI B;  5GAM e;  2DFU A;  4LDX A;  2BE9 B;  1G2B A;  1JB0 E;  3CC4 T;  2DPP B;  3QHS A;  2GQV A;  1ZA2 B;  1AWO A;  4J9E A;  1NLP C;  3VS5 A;  2EKH A;  2YUP A;  1N6A A;  1IXD A;  1C6V X;  1Y7X A;  5GAN 2;  1Q7Y C;  1UGV A;  2E12 A;  4JS4 A;  5AYF A;  4O6J A;  4M7A A;  1AVZ C;  1A0N B;  1AEY A;  2RJE A;  2DXT A;  3TSZ A;  3L2R A;  4C0D B;  6AT1 B;  2J05 A;  1RL2 A;  3G4S T;  3CBM A;  4ZTJ A;  1MUZ A;  1MGQ A;  4M78 G;  4JLI A;  3M4G A;  4HCZ A;  4OML A;  4CC2 A;  1Q82 R;  3PNW C;  1GCQ C;  4PL6 A;  2ROL A;  3JCM Q;  1WXB A;  3NGP A;  3UF4 A;  2DO3 A;  4ZN1 A;  1D3B B;  1VQ5 A;  2IPO B;  2L3P A;  1YIJ A;  5CAI A;  2CKK A;  1W70 A;  1YI2 Q;  2KY9 A;  3I56 A;  4M78 F;  3I9Q A;  3NHN A;  3EHQ A;  1VQO A;  3NPF A;  4J83 A;  4F14 A;  2V8J A;  1YN8 A;  4GLM A;  1YNZ A;  4PJN A;  3JV3 A;  5LJ5 g;  1V76 A;  2EJF A;  2L8D A;  4Z02 A;  4CRI A;  3L2V A;  3TRE A;  3FJ5 A;  3AT1 B;  1C1A A;  2F1L A;  4J9I A;  2DBM A;  1KQ2 A;  4EMH A;  3DLM A;  1N8R U;  2KXD A;  4X34 A;  3I35 A;  3CC2 A;  5HK3 A;  4M7D F;  2RHZ A;  2LT1 A;  4J7I A;  3CCQ Q;  2LDM A;  1KQS P;  4YTL A;  1NYG A;  1QVG S;  2FL7 A;  3RDV A;  2DET A;  2DIG A;  2OTJ A;  2RHX A;  2KRN A;  4EDU A;  1LPL A;  2YUQ A;  4B9X A;  4QVD A;  1YJW Q;  5M9O A;  1MV0 B;  2JXB A;  1NPP A;  2RN8 A;  3CQT A;  4J9B A;  1BYM A;  2E70 A;  3TVT A;  1YJN A;  3CMA T;  4M75 G;  2JNG A;  2XMF A;  1FX7 A;  1O9S A;  5LJ3 h;  1KQS A;  2A0F B;  1TUD A;  1MHN A;  4BAC A;  4M7A B;  2DVJ A;  1OPL A;  4AFU C;  1CKB A;  3M58 A;  4HT8 A;  1Q7Y U;  1X2K A;  1OZ3 A;  3L42 A;  3CPW S;  1K4U S;  5IT9 E;  4X9C A;  3OYD A;  2OTL T;  3CCS A;  2JT4 A;  1VQ8 A;  2CP6 A;  5GAN g;  3JCM g;  2CZ0 B;  4C0G A;  1UB4 A;  4JRQ A;  3CCE T;  3HKS A;  2KNB B;  3RIR A;  2K9G A;  4DOW A;  2RI3 A;  5IAY A;  3PGG A;  3CCL Q;  2L3R A;  4M4Z A;  1D0Y A;  3UDC A;  1SSH A;  2EQM A;  3CCJ T;  2EGE A;  3CCV A;  2HKN A;  2DL3 A;  4J8O A;  3A8M B;  4PJL A;  3GNF B;  4QKU A;  4C92 D;  3OYL A;  2HZY A;  4F7U B;  2D8J A;  2DRK A;  2IIM A;  3ULR B;  4RTV A;  1ZHI A;  1WYX A;  1ZQ1 A;  1RUW A;  4PKC C;  2MYS A;  1U1T A;  3GPL A;  1MV3 A;  1J3T A;  3G71 Q;  2RQT A;  3MEV A;  3GLX A;  2RA2 A;  2HMA A;  2E41 A;  3NTH A;  1UHC A;  1C0M A;  5ECA A;  1NEB A;  4PFZ A;  4ZNX A;  2JS0 A;  3PVL A;  4LN2 A;  1NJI R;  1B3Q A;  1R0B G;  1X2Q A;  1EFN A;  3CCL T;  1OV3 A;  1OI1 A;  3C0C A;  1TXQ A;  1XTD A;  1Q86 C;  3P8H A;  3H41 A;  3HRS A;  3LW5 E;  2DJQ A;  1PCX A;  5IXB A;  4XTZ A;  1CSK A;  2LX9 A;  2DTI A;  1Q82 U;  2HSP A;  3MP1 A;  2HQX A;  4XU1 A;  2RB6 A;  3PIO A;  1BIA A;  3I55 T;  3NMZ C;  1WHL A;  2HSE B;  1N5Z A;  5CO7 A;  3CMA Q;  1UJ0 A;  3G6E A;  1RI0 A;  4J9F A;  3SEM A;  2EGA A;  4OGC A;  5GMK i;  5LJ5 d;  1RAI B;  5KYU A;  3SFM A;  1VQP Q;  1D1A A;  1Z9Z A;  2QXF A;  3CME A;  1M4Z A;  1QLY A;  1FWZ A;  3CCR T;  2CUB A;  4XK8 E;  2YHT A;  3M59 A;  1VQ7 T;  1FXX A;  3FC3 A;  1JXO A;  1BI3 A;  2RJF A;  3PTA A;  3OYI A;  2KYM A;  2YUO A;  1VQ4 T;  2OX7 A;  4RTZ A;  2VYT A;  1K0X A;  4JZ3 A;  5GAN j;  5CKB A;  4C8Q A;  3OYH A;  3CC7 T;  2O4X A;  1Q82 C;  1Y96 B;  4ZTF A;  3ZL7 C;  1W2B P;  2DYB A;  4N4G A;  7AT1 B;  1ZA1 B;  4N0A C;  2CS7 A;  4XTY A;  2KK4 A;  1MMD A;  3OYN A;  1PKT A;  2PNI A;  1WHH A;  1GL5 A;  1QVF P;  1RLQ C;  4MZP A;  1OUL A;  2HCK A;  2JVV A;  4C92 A;  4P5N A;  4L5G A;  2L0A A;  2VXE A;  4R55 A;  4RTT A;  4F7U G;  1N9S A;  1OEB A;  1GRI A;  3AHU A;  4M7A G;  1M1G A;  1TSF A;  2DKG A;  1K9M C;  4MDW A;  2K6D A;  1AWW A;  1IZ6 A;  4XAX B;  1VQL A;  4IUQ A;  4MML A;  5KCO A;  1VYU A;  4EMK C;  2F2X A;  3HP9 A;  4FYV B;  3QKJ A;  5A2Q E;  3G71 T;  2FB7 A;  4NL3 A;  2AIR B;  1W2B A;  3S3O A;  4C92 C;  3H9N A;  4DEX A;  4OMM A;  1K1Z A;  1W2B S;  2QTV A;  1WA7 A;  3EFS A;  5CIU A;  3UA6 A;  3UAT A;  4RG8 A;  5KYU B;  2M9U A;  1E6G A;  2W0Z A;  1RLP C;  1K8A R;  1YWO A;  3M54 A;  1WDX A;  1IO6 A;  1ZX6 A;  2GTJ A;  2SEM A;  2GGR A;  5D6W A;  1OZ2 A;  2QA4 Q;  1JO8 A;  4IUT A;  3R6O A;  2KXC A;  3HL8 A;  3S3M A;  2COZ A;  2LQN A;  1BI1 A;  1M1K U;  2LC4 A;  3OS0 A;  1YWP A;  4RCC A;  3UA7 A;  3VS7 A;  4BD3 A;  3PE0 A;  2VXF A;  1UUE A;  3SWN B;  1HK9 A;  3WXM B;  4BB7 A;  5GAN 4;  1S1N A;  4OB3 B;  3I55 Q;  3M0R A;  3MEA A;  2DK3 A;  5IHK A;  1S72 Q;  2BIV A;  2Y4X A;  4M77 E;  1H92 A;  1BCM A;  2CH4 A;  1LCK A;  1SKU B;  2FHD A;  2COW A;  2KMT A;  3UWN A;  2KGT A;  1SG5 A;  2JMA A;  1MMN A;  2DD5 A;  1YIT A;  1VQ7 Q;  2RM4 A;  4M7D D;  4WTO B;  2J7I A;  2KRO A;  1YJ9 Q;  3ME9 A;  1OX8 A;  1VQ4 Q;  1K73 R;  1M1F A;  2AZS A;  4HCB A;  2E64 A;  4F04 B;  5GAN e;  2BUD A;  1JU5 C;  2RH2 A;  4OF1 A;  5GAN h;  4PJJ A;  1WHM A;  2LZ6 B;  3MP8 A;  2X51 A;  2GBQ A;  2HEQ A;  4J6W A;  2XDB A;  2C06 A;  4Y28 E;  3JB9 G;  3ZFJ A;  1VQ9 Q;  1RAF B;  1VOM A;  3QWX X;  3TQ7 P;  2DZ9 A;  4C0Z A;  1UGS B;  5FU7 C;  4Y92 A;  4N4I A;  2B86 A;  3VRZ A;  3RES A;  2KRM A;  2ZPF B;  4C8Q E;  2KR3 A;  4ZN3 A;  4A4H A;  2XID A;  3OSV A;  3L2U A;  2ED1 A;  3DB4 A;  2CSI A;  5FW9 A;  3G4S A;  1TUG B;  5CKD A;  1WJQ A;  5LJ3 f;  2MMP A;  3I5S A;  2YUN A;  2JW4 A;  2RD1 A;  1TH7 A;  1I07 A;  2EWN A;  1VQ5 T;  2QI2 A;  1YI2 T;  4O5V A;  2AHJ B;  3I56 T;  2DER A;  1M3C A;  3OYC A;  1ZUU A;  1VQO T;  1U1S A;  5IH2 A;  2VWF A;  4WF2 A;  1U06 A;  2NUT A;  1ABO A;  4M78 A;  1QP3 A;  3BE3 A;  1QVG A;  2C0O A;  2LCS A;  2JOY A;  5GMK j;  1QP2 A;  4M7A D;  1OPK A;  4KUL A;  2YT6 A;  4RTX A;  1T0J A;  3PT9 A;  2LVM A;  2RJD A;  1GBQ A;  1X01 A;  2GFA A;  2HQE A;  2KVQ G;  1VYV A;  3VYH B;  1M9S A;  4M77 F;  1YHQ T;  5FU7 B;  3L2Z A;  2MIO A;  3EAE A;  2CZ1 B;  5CQX A;  3CCQ T;  4JRK A;  4NL2 A;  5LJ5 j;  3OYK A;  2QDY B;  3V8J A;  2EQI A;  2KQW A;  4E7S A;  5CR2 A;  2EBP A;  4IIO A;  4M77 G;  4LE9 A;  2GCX A;  4KGX B;  1Y71 A;  3VS4 A;  4OMO A;  4M7D A;  1Q81 U;  2NLU A;  4AT1 B;  3CMA A;  1YJN T;  2AKL A;  4E47 A;  1ZUK A;  4A54 A;  3N5B B;  5FU6 C;  3HTR A;  2J6K A;  3INZ A;  1JQQ A;  2NUP A;  3J7A F;  2RNA A;  1QKX A;  3JCM J;  4PFP A;  1LJO A;  2OTL A;  1VQ8 T;  1HJD A;  4PJO A;  4JDS A;  5D7U A;  2PQW A;  3OS5 A;  4JJD A;  4RMO A;  1R8O B;  1H64 1;  5KE3 A;  4E7J A;  5LJ3 j;  4L6V 5;  3DB3 A;  3HRU A;  3OW2 A;  3H6Z A;  5EC7 A;  1N8R C;  2CP7 A;  1D0X A;  2LT4 A;  3UT1 A;  5GMK l;  2DL4 A;  2QEX Q;  1X75 C;  2QG9 B;  2ESW A;  3H0F A;  3TCJ A;  3O8V A;  4F17 A;  1HSQ A;  4M7A C;  2GTO A;  5GAN 6;  3BY7 A;  4IUV A;  1R0C B;  5DLO A;  1HYO A;  3GOX A;  1F1B B;  4M7D G;  5LJ3 g;  2A37 A;  2QDL A;  3LH5 A;  3VU3 C;  2FVU A;  2J06 A;  2EYZ A;  3FDR A;  3ER0 A;  2H8H A;  1WXU A;  3QWY A;  3MEU A;  1NPR A;  3VKI A;  4AMC A;  1X6O A;  3T9N A;  3VUB A;  3CCL A;  2K5F A;  4C0D C;  2RO0 A;  1NYF A;  4QT7 A;  3CCU Q;  2QTX A;  4M75 E;  3VJP A;  3PVQ A;  3X24 B;  4QVC A;  2O9V A;  1VQN Q;  2OAW A;  2H3E B;  3M0S A;  1GBR A;  3C95 A;  1HXD A;  2XU8 A;  4A4E A;  1AWJ A;  1YJN Q;  3G6E T;  4E7L A;  1Y0M A;  1I0C A;  2EQK A;  4FT2 A;  1KQ1 A;  1H3Z A;  2EJ9 A;  3E9G A;  4J9C A;  1ZSZ A;  3OYF A;  2KAF A;  2RMO A;  2VVK A;  1KG1 A;  5LJ3 d;  2LCL A;  5FLX E;  1M5Q 1;  2MK5 A;  2LQW A;  5IN1 A;  3JCM e;  2E5Q A;  2HAX A;  5GAO r;  1X6G A;  1JRI A;  3M4Y A;  1YIT Q;  1VQ7 A;  3VS6 A;  1NLO C;  4FL6 A;  1T3S A;  2COY A;  2QQ9 A;  3QPH A;  1G3T A;  1VYT A;  3JB9 J;  3ZBD A;  2FPF A;  5J26 A;  1VQP A;  1TS9 A;  1KC8 R;  1PWT A;  1HD3 A;  3CC7 A;  4MMK A;  2M02 A;  1QQJ A;  3OMC A;  5GAM g;  2YRV A;  4DBR A;  5GAM j;  3CXC A;  1E7O A;  1WQ7 A;  1WXT A;  3FB9 A;  3HFO A;  1YP5 A;  3M57 A;  4HT9 A;  2CDT A;  1VQ8 Q;  1B07 A;  1PRM C;  4M77 B;  2LMJ A;  1U8R A;  4BE2 A;  2CZ7 B;  1BCO A;  1ZLM A;  3CEY A;  3EFO A;  4JS5 A;  1LNX A;  9ATC B;  1K73 C;  3MCA B;  1WPY A;  3MHX A;  5LJ3 e;  2O88 A;  4A4F A;  4FCY A;  2HL3 A;  4DBH A;  5GAO q;  1TG0 A;  5A0G A;  2CT3 A;  1G3W A;  2DIQ A;  1MNE A;  2C0I A;  2CH4 W;  3OS1 A;  2NYS A;  4ME7 A;  3M55 A;  5FWC A;  1RAH B;  4JJN K;  3L2Q A;  2VC8 A;  1I5L A;  5FRO A;  2EYY A;  2K2V A;  2K3X A;  4HKE A;  2E3H A;  1X27 A;  1SHF A;  1RAA B;  2JM8 A;  4A53 A;  1LVK A;  4BE1 A;  4PFO A;  1D0Z A;  1UDL A;  3RMQ A;  3OY9 A;  4OB0 B;  3CD6 Q;  5GAN 3;  2PZ1 A;  4Y91 A;  1I4K 1;  4KRT A;  2A08 A;  2XHC A;  2ZCF B;  2O31 A;  1Q86 R;  3LLR A;  1JJ2 P;  1D09 B;  3JAM E;  4M75 A;  3JSC A;  4TVR A;  3CPW A;  1VQ9 T;  3M0P A;  5I21 A;  1EX4 A;  4F16 A;  1AD5 A;  3RNJ A;  2VV5 A;  2ZPB B;  3CCM A;  1XNI A;  2KI7 A;  3MKD A;  1M8M A;  4DEY A;  2DEQ A;  5DLQ E;  2SRC A;  4BI3 A;  4XTU A;  3JCM h;  3OYM A;  2QA4 A;  1WX6 A;  1UGR B;  2DM1 A;  2E65 A;  4EMG A;  2DE0 X;  3JCM b;  5KYN A;  1WHK A;  4ORZ A;  4FM4 B;  4M7A F;  3E19 A;  4HA8 A;  3VS3 A;  1PG5 B;  4XTW A;  1UTI A;  2LNH B;  2EFI A;  1X6B A;  2V1Q A;  1NE8 A;  4BI8 B;  2X3W D;  2EW3 A;  5I2M A;  2BZX A;  2K57 A;  1MMG A;  2KRS A;  1TOV A;  1YIT T;  2G6F X;  1GXI E;  4FIB A;  4II1 A;  1OOT A;  2XK0 A;  3RKX A;  1UFF A;  3CBP A;  4EPC A;  4M78 B;  4ZGD B;  3HSB A;  1QMC A;  5KYW B;  3QBY A;  3E1S A;  1KHC A;  1W1F A;  2YSQ A;  4J9H A;  2ZGW A;  1WNL A;  4QQG A;  2DX1 A;  2JZ2 A;  2HQH A;  2F2W A;  4PJO B;  4JPB W;  2RI5 A;  1WFW A;  2X35 A;  3REB B;  3H8Z A;  5KYX B;  2R58 A;  3RER A;  1W4S A;  3UPU A;  3V8K A;  5IXF A;  1FMW A;  2DMO A;  2A36 A;  5KYY A;  3MP6 A;  1KD1 C;  2RJC A;  1VUB A;  4ELZ C;  4NS5 A;  2YWW A;  2WSC E;  2KEA A;  5FU6 B;  4C5H A;  4IUU A;  4R56 A;  3CC4 Q;  2M0Y A;  1RI9 A;  1UEB A;  1M2V B;  3SDZ A;  2JS2 A;  2QK0 A;  2MCN A;  2DL8 A;  1JXM A;  2R57 A;  5GAN 5;  4HCC A;  2EPD A;  3OYJ A;  2L2P A;  1SEM A;  4QVZ A;  3CCS Q;  2XG8 D;  1AWX A;  3G7Z A;  1YI2 A;  2A3L A;  5FWB A;  3RR6 A;  3OYE A;  3FRN A;  1YJ9 T;  2RHI A;  3VS2 A;  1U5S A;  3G4S Q;  1KFZ A;  3JB9 I;  4M78 E;  1ARK A;  4EMK A;  1WJS A;  1M90 U;  2K79 A;  3MEW A;  1T3L A;  2YDL A;  4XU0 A;  4C92 B;  2E1H A;  4XQ3 A;  3OYA A;  1M8V A;  5GAN 7;  2YLC A;  3H0H A;  2CZ6 B;  1GFC A;  3CBO A;  2KE9 A;  5L8R E;  3BFM A;  5I22 A;  3EHR A;  2MF2 A;  3JB9 F;  3ZEH A;  2DTO A;  3H0I A;  3OBY A;  1YHQ A;  3RBB B;  4C8Q B;  5GAM f;  2DVE A;  4M7A E;  3CCQ A;  3P8D A;  1VQN T;  1P92 A;  5J3B A;  3VV0 A;  1FMV A;  2CP3 A;  1ABQ A;  2V1R A;  2FPD A;  4OB1 B;  2JUF A;  4J7F A;  3GF5 A;  2QAS A;  4FT4 A;  2VGN A;  2HNI A;  3HHT B;  5HY6 A;  3BDL A;  2X3X D;  5GAN d;  1QVP A;  1VQK T;  2J6F A;  3X28 B;  5I2S A;  3E2U A;  3GBQ A;  4HVV A;  4AFS C;  1VQ5 Q;  2RQR A;  5GAO l;  1IB8 A;  3M0T A;  3EFR A;  1VQ6 Q;  5IHI A;  2EAY A;  3FEO A;  3PMT A;  3V7C A;  2KT1 A;  3OB9 A;  3F70 A;  1VQ6 T;  2A28 A;  4HVW A;  4OGE A;  4RTY A;  2F5T X;  4PJM A;  5CKF A;  3JCM V;  4CC4 B;  4AFZ C;  2GQI A;  4BE0 A;  4E7I A;  3JCM c;  2DJZ A;  4J9D A;  1I5O B;  3OMG A;  1BK2 A;  4PJO E;  1PSE A;  1D3B A;  1BI2 A;  1N27 A;  2LP5 A;  3RUX A;  1D1C A;  1V1C A;  4VUB A;  4BDY A;  3FJP A;  4ESR A;  1MMA A;  3LGF A;  3LWI A;  1QWF A;  2LTO A;  3CCR Q;  2QYZ A;  4Q5W A;  5EG2 A;  1CKA A;  1SSF A;  3CPF A;  3FIF A;  5CKH A;  5A0L A;  4AFQ C;  1JJ2 S;  3M9Q A;  1ACM B;  3EH1 A;  2PVO B;  1YJW A;  1PM3 A;  4XU3 A;  2IVW A;  2EQU A;  2VKN A;  3QUI A;  2Z0W A;  4PNO A;  1YBY A;  3QII A;  4KH1 B;  2P84 A;  1RAD B;  2B8A A;  4ELY C;  4Z8A A;  2YRC A;  3EGX B;  4EIK A;  1D1B A;  1TU0 B;  1VQM T;  4HVU A;  3A8O B;  4IUP A;  3M0Q A;  3S3N A;  3LYI A;  1ZSZ B;  2V26 A;  2HL5 C;  2ATC B;  3CCJ Q;  1UG1 A;  3S6W A;  3OW2 P;  4K11 A;  4JZ4 A;  1I1J A;  1YCY A;  2K3B A;  4KT0 E;  1M90 C;  1RAC B;  4IIM A;  1H8K A;  2K5I A;  2DXC A;  3CXC S;  2D1X A;  1K0S A;  5C6S A;  4B6M A;  1AOJ A;  2VGM A;  4JJC A;  1XJW B;  2D9T A;  1QVF S;  2QGF B;  3CD6 A;  4LD6 A;  1NJI C;  3P8B B;  5GJW B;  1PD0 A;  2XI9 A;  2R5M A;  4C8Q D;  1VQP T;  2FZG B;  2KBT A;  1TWB A;  3THK A;  2FRY A;  5KH6 A;  4KBM B;  2H3J A;  2DXU A;  3QYH B;  1BIB A;  2ZPE B;  1WZO A;  1PHT A;  2E3I A;  2F69 A;  4LDY A;  2DL7 A;  1M1K C;  5GAN 8;  1Q86 U;  3L2W A;  1DJ7 B;  2NUZ A;  4OVA A;  3J80 E;  1IHV A;  2K3Y A;  2XDD A;  2RPN A;  2YXY A;  3HFN A;  4PJO G;  3LGL A;  3MET A;  5AT1 B;  1AZE A;  3V7S A;  4EMK B;  2DLP A;  1ZUY A;  3EGU A;  3URG A;  3LH0 A;  1IGU A;  1KJW A;  2L5Q A;  2P0P A;  1SRM A;  2ROT A;  3X25 B;  1S72 A;  5GJV B;  4CI0 C;  3A98 A;  4PJO F;  1Q95 G;  3G6E Q;  1NEG A;  8ATC B;  4LNP A;  2RQV A;  1G3S A;  2O01 E;  3OYY A;  1BI0 A;  4M7D E;  1XQH A;  2ED0 A;  2FZC B;  4M7D B;  3EGX A;  1NM7 A;  2ZPH B;  3FLG A;  1G3Y A;  2FPE A;  1Z9Q A;  4AG1 C;  3QO3 A;  4KUI A;  1VQM Q;  1QWE A;  4GBQ A;  1MND A;  1WI7 A;  1OU9 A;  1AT1 B;  3CCE Q;  3JCM W;  1YIJ Q;  4D6W A;  2DTH A;  4AG2 C;  2VB6 A;  2NUP B;  1KIK A;  2E6Z A;  4FYX B;  2WSF E;  2E4H A;  4M77 D;  3QG1 A;  3OYG A;  4LD9 K;  4ANJ A;  2E6N A;  4MZT A;  3TEE A;  1V29 B;  2QEX A;  3SD4 A;  4MDX A;  2EYX A;  1ZBX A;  4X9D A;  4LUD A;  1KHI A;  2Y90 A;  2LNV A;  1VQ9 A;  2C0T A;  2EIF A;  3JB9 H;  4L59 A;  3WVE B;  4BDZ A;  3RKY A;  4C5E A;  1KC8 U;  1NBE B;  3CXC P;  3CCM T;  3D7S B;  4M78 D;  5LL6 S;  2FZK B;  3GP8 A;  3KBG A;  1TTH B;  4IUR A;  1IHW A;  2EYW A;  5LJ5 e;  1OYX A;  2BE7 D;  2HKQ B;  1M3B A;  3QJY A;  4DQ2 A;  2PTK A;  2QA4 T;  1OQK A;  3OW2 S;  4RCB A;  3VUZ A;  1TUC A;  4QW2 A;  1EIF A;  1NJI U;  2O9S A;  2XKO C;  1EZZ B;  1OU8 A;  1R77 A;  3CCU A;  1VQK Q;  2PVG B;  5A0D A;  1H3H A;  4E7H A;  4PK4 A;  8AT1 B;  4DOV A;  2NWM A;  5HCK A;  1PRL C;  2CUD A;  2K7A A;  1UJY A;  1Q81 R;  3EGD A;  1N9R A;  1SPK A;  5GAM d;  3M56 A;  3CPW P;  2ZZD A;  3QZ9 B;  3VRY A;  2RI2 A;  3LX7 A;  1QCO A;  3PFS A;  2X4W A;  5KYW A;  1B34 B;  3EFO B;  4OP0 A;  3CCV Q;  1JEG A;  1FYN A;  3O5Z A;  3M0U A;  4OMF B;  3V8L A;  3CC4 A;  1UEC A;  4RG2 A;  4X1V A;  4C8Q C;  4KH0 B;  2MOX A;  1QVG P;  4FW1 A;  1K8A U;  1U3O A;  2P0Q A;  5DM7 R;  3SHW A;  1M27 C;  4ZGJ B;  4C8Q F;  1YHQ Q;  1I8F A;  2M1H A;  3VS0 A;  3HRT A;  2DNU A;  1RAG B;  1O75 A;  2FRW A;  4GLK A;  2DBK A;  3EG9 A;  4PLL A;  4HXJ A;  2WSE E;  1KD1 R;  4XU2 A;  2OI3 A;  2NUT B;  2EJG A;  4C8Q G;  4M75 F;  2LJ3 A;  3MJX A;  1M30 A;  4C92 F;  2EGC A;  1VIE A;  2X9H A;  2F5K A;  2HBP A;  1KC8 C;  4DBQ A;  2OTJ Q;  1WHG A;  1YIJ T;  2OJ2 A;  4JRI A;  4FW2 A;  4C92 G;  4PJO D;  3MPU B;  1VIF A;  1N8R R;  3BDU A;  2LJ1 A;  4HCK A;  5CQY A;  1YJ9 A;  2EQJ A;  2EVR A;  3I5R A;  4KUD K;  5CKE A;  2RK2 A;  4V2S A;  1X43 A;  4E7K A;  3EGD B;  2ZPG B;  1NZ9 A;  2CP2 A;  3C94 A;  5FRM A;  1XOV A;  3A8L B;  3A8G B;  1YCS B;  4CC7 A;  4XTX A;  4RUG A;  4F7U E;  3DKM A;  2RF0 A;  5J39 A;  4BY6 B;  4UC4 A;  2DL5 A;  2RHU A;  5CCA A;  3CC2 T;  1FMK A;  3EG2 A;  1QVF A;  3G1J A;  3R6N A;  3A1P A;  4C5G A;  1PSF A;  1VQN A;  2P4T A;  2EKO A;  2VUB A;  2OTJ T;  3VYG A;  5D6X A;  3CCM Q;  2DEU A;  4BI4 A;  3QJ6 A;  5HKC A;  2JMC A;  2AT1 B;  2FEI A;  1VA7 A;  5GAO m;  1SF9 A;  2K4Y A;  4CC3 A;  2K5L A;  4FSX A;  4ZGE B;  1PD1 A;  4JRP A;  1UE9 A;  1YFN A;  2M16 A;  1M3A A;  4RTW A;  5D6Y A;  5IHN A;  1VQK A;  2V8I A;  1QKW A;  2MAM A;  4E2F B;  1WQW A;  1IRE B;  3C12 A;  4C92 E;  3M5A A;  2XDP A;  3CCS T;  2E10 A;  1SHG A;  4OMP A;  1K8A C;  4Z89 A;  4JJB A;  3CCE A;  4A4G A;  2PUK B;  2HBW A;  2D6F A;  2ABL A;  1G5V A;  1VQ6 A;  1VQO Q;  2O4X B;  4F7U A;  1GCQ A;  1WJR A;  1VQL Q;  3CCJ A;  3CCV T;  4KGV B;  2M51 A;  2BZ8 A;  3L1A A;  4C5I A;  3SWN C;  2PU9 B;  3SB2 A;  3PIP A;  2YLB A;  4A63 B;  1BU1 A;  2BZY A;  3KUF A;  2VAS A;  3JCM d;  4B9W A;  2GFU A;  2QQB A;  3OBW A;  1QCF A;  1K9M R;  3EH2 A;  3OA6 A;  3WVD B;  4M75 B;  2F2V A;  4N0A A;  3OYB A;  2FYK A;  3J81 E;  4XTV A;  4LXC A;  1YJW T;  1UGP B;  3ASK A;  2A7Y A;  2CSQ A;  1Q81 C;  1Y96 A;  4PLI A;  1W6X A;  2L3S A;  3BW1 A;  5GMK h;  4OB2 B;  4IKF A;  2DF6 A;  3CC2 Q;  3MO8 A;  2RK1 A;  3RKW A;  1RAB B;  4J6X A;  1X69 A;  2P0K A;  3JB9 D;  1E6H A;  4BY6 C;  1K73 U;  1VQM A;  2CP0 A;  2E5K A;  4F7U F;  4FYW B;  3I55 A;  2JJ9 A;  3U23 A;  3JCM P;  1QW1 A;  4J6Y A;  5KYX A;  4LDV A;  5GMK e;  4D8D A;  2AZV A;  5KYY B;  4LDW A;  5GAO n;  2V8K A;  2RQU A;  1T0H A;  2QQS A;  1PNJ A;  4RKU E;  5KE2 A;  2RHY A;  1M90 R;  2XIC A;  5KCH A;  1BKB A;  4QQ6 A;  5GMK m;  1BB9 A;  1AZG B;  2J6O A;  3CME T;  2BTT A;  2D8H A;  4M77 C;  2LX7 A;  4FU6 A;  3I56 Q;  5LJ5 f;  5LJ5 h;  3CCR A;  3VS1 A;  4J5Y A;  2K2M A;  4M75 C;  3CD6 T;  3V7R A;  2BKD N;  5GAO p;  3QDR B;  3NFC A;  1ZSG A;  3TSW A;  3EG1 A;  1Q7Y R;  1BBZ A;  1VQ4 A;  2CP5 A;  2JTM A;  4E6R A;  2DD4 A;  2DA9 A;  2HDA A;  1Y57 A;  2M0O A;  2FG0 A;  1K9M U;  2GNC A;  2X4J A;  3X26 B;  1NG2 A;  2CGH A;  1K76 A;  1UHF A;  2FO0 A;  1QCN A;  1ZBJ A;  1WIE A;  2QGG A;  1KQS S;  2L3Q A;  2AKK A;  4M7D C;  2GF7 A;  1IRX A;  3NTK A;  1JBM A;  4LUE A;  3IQL A;  2WAC A;  2MWO A;  1WLP B;  1M2O A;  1UGQ B;  4DA4 A;  2OTL Q;  2XD0 A;  2AK5 A;  2LQ8 A;  2G3R A;  1S72 T;  3KXT A;  2O2O A;  3HPW A;  2L89 A;  2X4X A;  1LOJ A;  2W10 A;  2QQR A;  4C0F A;  1I81 A;  4NOY A;  3JCM X;  2DZC A;  1WHJ A;  3JCM f;  3QSU A;  4RTU A;  2DXB A;  2JM9 A;  4JUV A;  3OS2 A;  5HK0 A;  1VQL T;  1OX9 A;  3QZ5 B;  3QXE B;  2KYB A;  2ZAE A;  5C0M A;  3A8H B;  2ECZ A;  2QQA A;  2DIL A;  3OSS C;  4M78 C;  3G71 A;  2LJ0 A;  2KT8 A;  2LRQ A;  3GNG A;  2IG0 A;  1IGQ A;  2RQW A;  4N4H A;  2R5A A;  3DLL A;  3EG3 A;  4J9G A;  1K9A A;  2QEX T;  4M75 D;  4Z88 A;  4BUG A;  4DBF A;  2I2L A;  2LQK A;  2MPX C;  3CC7 Q;  1KK7 A;  2CT4 A;  5DY9 A;  1RAE B;  2I0N A;  2PUO B;  5FRN A;  4GY5 A;  2YRD A;  2JN0 A; 
#chains in the Genus database with same CATH homology
 1AHJ B;  2EIF A;  1BI1 A;  5I21 A;  4JLG A;  2LC4 A;  4L59 A;  1M1K U;  3JB9 H;  3E9F A;  4MZM A;  3WVE B;  4BDZ A;  2CYZ B;  3GIB A;  3RKY A;  4C5E A;  5CK9 A;  3OS0 A;  3SWN A;  2VV5 A;  1KC8 U;  4RCC A;  2ZPB B;  5CVI A;  4BD3 A;  2VXF A;  3CCM T;  1XNI A;  3CCM A;  2OAU A;  4M78 D;  1HK9 A;  3SWN B;  3WXM B;  4BB7 A;  5LL6 S;  5GAN 4;  3GP8 A;  3KBG A;  2DEQ A;  4IUR A;  5DLQ E;  2Y4Y A;  4BI3 A;  5LJ5 e;  3LWH A;  4OB3 B;  1OYX A;  3QJY A;  4XTU A;  4DQ2 A;  3MEA A;  2DK3 A;  2KDS A;  2HD0 A;  3JCM h;  3OYM A;  2QA4 T;  2QA4 A;  2BIV A;  2PVD B;  2Y4X A;  3OW2 S;  4RCB A;  1UGR B;  2EYQ A;  2E65 A;  4M77 E;  4EMG A;  3VUZ A;  4M77 A;  3JCM b;  4QW2 A;  1EIF A;  1NJI U;  4FM4 B;  3X20 B;  4M7A F;  3CMA T;  3E19 A;  4HA8 A;  2XKO C;  3Q1J A;  4XTW A;  1KD1 U;  4ATO A;  2DAQ A;  2FHD A;  2EFI A;  3C4S A;  3RMS A;  3CCU A;  3CCU T;  3PMI A;  2PVG B;  1Y07 A;  1NE8 A;  5A0D A;  5GAM h;  4LDU A;  4BI8 B;  4E7H A;  2KMT A;  4PJO C;  3UWN A;  5I2M A;  2K57 A;  2KSS A;  4DOV A;  2DD5 A;  1YIT T;  1YIT A;  2RM4 A;  4M7D D;  1GXI E;  4FIB A;  4II1 A;  1N9R A;  2XK0 A;  3RKX A;  5GAM d;  3M56 A;  2JTF A;  2MI6 A;  3A5Z B;  1B34 A;  4QQD A;  4A54 A;  2LCC A;  3M53 A;  2D0Q B;  3CBP A;  2ZZD A;  3QZ9 B;  3ME9 A;  2X4Y A;  4EPC A;  4M78 B;  1JJ2 A;  4ZGD B;  3HSB A;  3JRZ A;  1M1F A;  2RI2 A;  3LX7 A;  3QBY A;  3S3M A;  3E1S A;  4HCB A;  1KHC A;  3PFS A;  2E64 A;  2X4W A;  5GAN e;  1B34 B;  2BUD A;  4OP0 A;  2RH2 A;  2MWP A;  4OF1 A;  1WGS A;  5GAN h;  5GAN f;  3TU4 K;  3NTI A;  3CPW A;  3MP8 A;  3QYG B;  3OQ5 A;  4A4K A;  2ZGW A;  1WNL A;  2ZPI B;  4QQG A;  5GAM e;  4LDX A;  4OMF B;  4J6W A;  4JRP A;  2C06 A;  3V8L A;  1JB0 E;  4Y28 E;  3CC4 T;  4RG2 A;  3JB9 G;  2DPP B;  2JZ2 A;  3ZFJ A;  4C8Q C;  3QHS A;  3CC4 A;  2GQV A;  4PJO B;  2RI5 A;  2DZ9 A;  1K8A U;  2X35 A;  2P0Q A;  5DM7 R;  1N6A A;  3H8Z A;  4C0Z A;  4ZGJ B;  4C8Q F;  3RER A;  2R58 A;  1UGS B;  5FU7 C;  1Y7X A;  1I8F A;  1W4S A;  2M1H A;  5GAN 2;  3UPU A;  4N4I A;  1Q7Y C;  3V8K A;  3HRT A;  3RES A;  2E12 A;  3MP6 A;  1O75 A;  4GLK A;  1KD1 C;  2ZPF B;  4C8Q E;  4ZN3 A;  2RJC A;  4A4H A;  2XID A;  1VUB A;  3OSV A;  2WSE E;  4NS5 A;  4PLL A;  4O6J A;  4XU2 A;  5AYF A;  4ELZ C;  3L2U A;  4JS4 A;  4M7A A;  2RJE A;  2DXT A;  2WSC E;  3L2R A;  4C0D B;  2EJG A;  4C8Q G;  3DB4 A;  5FU6 B;  4C5H A;  4IUU A;  4R56 A;  4M75 F;  1RL2 A;  3G4S T;  3CBM A;  3G4S A;  1UEB A;  4ZTJ A;  5CKD A;  3SDZ A;  1WJQ A;  5LJ3 f;  1MGQ A;  4C92 F;  4M78 G;  4JLI A;  3M4G A;  1VIE A;  2MMP A;  4HCZ A;  5GAN 5;  2R57 A;  4HCC A;  3PNW C;  2F5K A;  4PL6 A;  2HBP A;  3OYJ A;  3JCM Q;  2RD1 A;  1TH7 A;  1KC8 C;  4QVZ A;  2EWN A;  2DO3 A;  4ZN1 A;  1D3B B;  1VQ5 T;  1VQ5 A;  1YIJ T;  2QI2 A;  2XG8 D;  5CAI A;  2CKK A;  3G7Z A;  4JRI A;  1YIJ A;  1YI2 T;  4O5V A;  1YI2 A;  2A3L A;  2AHJ B;  2KY9 A;  3I56 T;  4C92 G;  3I56 A;  4PJO D;  4M78 F;  1VIF A;  3OYC A;  3OYE A;  3BDU A;  3FRN A;  1VQO T;  1VQO A;  1U1S A;  5CQY A;  1YJ9 T;  1YJ9 A;  4J83 A;  4WF2 A;  2RHI A;  4M78 A;  2EQJ A;  2V8J A;  4KUD K;  1QP3 A;  3JB9 I;  1QVG A;  4M78 E;  5CKE A;  2RK2 A;  4EMK A;  1WJS A;  4V2S A;  4E7K A;  1M90 U;  2JOY A;  5GMK j;  1QP2 A;  3MEW A;  4XU0 A;  4C92 B;  5LJ5 g;  2ZPG B;  1NZ9 A;  2E1H A;  3C94 A;  1XOV A;  5FRM A;  2EJF A;  2L8D A;  4Z02 A;  4CRI A;  3L2V A;  4M7A D;  3A8L B;  3A8G B;  4KUL A;  4XQ3 A;  4XTX A;  3OYA A;  3TRE A;  1M8V A;  4F7U E;  3PT9 A;  5GAN 7;  3DKM A;  2YLC A;  5J39 A;  2LVM A;  2RJD A;  2CZ6 B;  1X01 A;  2GFA A;  2HQE A;  4BY6 B;  1KQ2 A;  2KVQ G;  3CBO A;  4UC4 A;  4EMH A;  5L8R E;  3DLM A;  3BFM A;  3VYH B;  1N8R U;  1M9S A;  2MF2 A;  2RHU A;  3ZEH A;  3JB9 F;  4X34 A;  5CCA A;  3CC2 A;  3CC2 T;  4M77 F;  5HK3 A;  2DTO A;  1YHQ T;  3OBY A;  1YHQ A;  4M7D F;  2RHZ A;  2LT1 A;  3L2Z A;  5FU7 B;  1QVF A;  4J7I A;  4C8Q B;  5GAM f;  2DVE A;  2LDM A;  2CZ1 B;  3EAE A;  5CQX A;  3CCQ T;  3CCQ A;  4M7A E;  4JRK A;  4YTL A;  4C5G A;  1QVG S;  3P8D A;  2FL7 A;  4NL2 A;  1PSF A;  5LJ5 j;  1VQN A;  2P4T A;  1P92 A;  2QDY B;  2EKO A;  2VUB A;  5J3B A;  3VV0 A;  2DIG A;  3V8J A;  3OYK A;  2OTJ A;  2OTJ T;  3VYG A;  2KQW A;  2RHX A;  5D6X A;  4EDU A;  5CR2 A;  4M77 G;  4BI4 A;  3QJ6 A;  5HKC A;  2GCX A;  4B9X A;  4QVD A;  5M9O A;  1NPP A;  1Y71 A;  4OB1 B;  2JUF A;  4J7F A;  4M7D A;  5GAO m;  1Q81 U;  1BYM A;  2NLU A;  2K4Y A;  2E70 A;  3CMA A;  2K5L A;  1YJN T;  3GF5 A;  4FSX A;  4M75 G;  4E47 A;  2VGN A;  2JNG A;  2HNI A;  3HHT B;  4FT4 A;  1FX7 A;  3N5B B;  1O9S A;  2M16 A;  5FU6 C;  5HY6 A;  3BDL A;  5LJ3 h;  1KQS A;  3INZ A;  1MHN A;  5GAN d;  4M7A B;  4BAC A;  3J7A F;  1VQ9 A;  1QVP A;  5D6Y A;  1VQK T;  1VQK A;  2V8I A;  3M58 A;  2MAM A;  4HT8 A;  1WQW A;  1IRE B;  3X28 B;  5I2S A;  1Q7Y U;  3JCM J;  3C12 A;  1OZ3 A;  3L42 A;  3CPW S;  4C92 E;  3M5A A;  5IT9 E;  4X9C A;  3OYD A;  2XDP A;  1LJO A;  2OTL T;  2OTL A;  3CCS A;  3CCS T;  2E10 A;  5GAO l;  1VQ8 T;  1VQ8 A;  4PJO A;  4JDS A;  1K8A C;  5GAN g;  3JCM g;  2CZ0 B;  4C0G A;  1UB4 A;  4JRQ A;  3CCE A;  3CCE T;  3EFR A;  3HKS A;  4A4G A;  2EAY A;  2PUK B;  3RIR A;  4DOW A;  3FEO A;  3PMT A;  2PQW A;  3OS5 A;  3V7C A;  4RMO A;  2RI3 A;  3OB9 A;  5IAY A;  3PGG A;  2D6F A;  1G5V A;  1H64 1;  1R8O B;  2L3R A;  3F70 A;  5KE3 A;  1VQ6 T;  1VQ6 A;  4E7J A;  4OGE A;  5LJ3 j;  4L6V 5;  2O4X B;  4F7U A;  3UDC A;  2F5T X;  3DB3 A;  3HRU A;  3OW2 A;  5CKF A;  2EQM A;  1WJR A;  3H6Z A;  3JCM V;  3CCJ A;  3CCJ T;  3CCV A;  3CCV T;  1N8R C;  2LT4 A;  3UT1 A;  5GMK l;  4BE0 A;  4J8O A;  4E7I A;  3JCM c;  3A8M B;  2DJZ A;  3GNF B;  3L1A A;  4C5I A;  4C92 D;  1X75 C;  3OMG A;  3TCJ A;  3OYL A;  3O8V A;  4F7U B;  3SWN C;  4PJO E;  1PSE A;  2PU9 B;  1D3B A;  1BI2 A;  1N27 A;  2YLB A;  3SB2 A;  3PIP A;  3RUX A;  4VUB A;  4BDY A;  1ZHI A;  3KUF A;  4M7A C;  5GAN 6;  3JCM d;  1ZQ1 A;  3BY7 A;  3FJP A;  4IUV A;  5DLO A;  4PKC C;  4B9W A;  3LGF A;  3LWI A;  2GFU A;  2QQB A;  3OBW A;  3GOX A;  2LTO A;  1U1T A;  3GPL A;  4M7D G;  5LJ3 g;  3MEV A;  4Q5W A;  3OA6 A;  3GLX A;  2RA2 A;  3WVD B;  4M75 B;  5EG2 A;  1SSF A;  3CPF A;  2E41 A;  3NTH A;  4N0A A;  3FIF A;  3VU3 C;  5CKH A;  5A0L A;  2FVU A;  3OYB A;  2FYK A;  1JJ2 S;  3M9Q A;  3FDR A;  3J81 E;  3ER0 A;  4XTV A;  2PVO B;  1YJW A;  1YJW T;  4XU3 A;  3MEU A;  1NPR A;  1UGP B;  3ASK A;  2A7Y A;  3VKI A;  1X6O A;  1Y96 A;  2EQU A;  2IVW A;  4PLI A;  3BW1 A;  3T9N A;  3QUI A;  3VUB A;  5GMK h;  3CCL T;  3CCL A;  1OI1 A;  4OB2 B;  2K5F A;  4C0D C;  2RO0 A;  4IKF A;  1XTD A;  3MO8 A;  1Q86 C;  2RK1 A;  3P8H A;  4PNO A;  1YBY A;  3QII A;  3HRS A;  3RKW A;  4J6X A;  3LW5 E;  2QTX A;  2P0K A;  2B8A A;  4M75 E;  4XTZ A;  4ELY C;  2LX9 A;  3VJP A;  2DTI A;  3JB9 D;  3X24 B;  4QVC A;  1Q82 U;  3MP1 A;  4BY6 C;  2HQX A;  1K73 U;  4XU1 A;  1VQM T;  2RB6 A;  1VQM A;  3PIO A;  1BIA A;  4F7U F;  3A8O B;  4IUP A;  3I55 A;  3I55 T;  3C95 A;  1HXD A;  2XU8 A;  3S3N A;  3LYI A;  4A4E A;  3JCM P;  1QW1 A;  4J6Y A;  5CO7 A;  3G6E A;  3G6E T;  1RI0 A;  4LDV A;  4E7L A;  5GMK e;  5GAO n;  4LDW A;  2V8K A;  3S6W A;  4OGC A;  5GMK i;  2EQK A;  4FT2 A;  2QQS A;  1KQ1 A;  4RKU E;  5LJ5 d;  1H3Z A;  2EJ9 A;  3E9G A;  3SFM A;  5KE2 A;  2RHY A;  3OYF A;  2XIC A;  1YCY A;  5KCH A;  1BKB A;  4KT0 E;  4QQ6 A;  2KAF A;  1M90 C;  5GMK m;  2QXF A;  3CME A;  3CME T;  1KG1 A;  5LJ3 d;  2LCL A;  5FLX E;  1M4Z A;  1M5Q 1;  2K5I A;  4M77 C;  2DXC A;  2E5Q A;  5IN1 A;  4FU6 A;  3JCM e;  3CXC S;  2HAX A;  5GAO r;  1FWZ A;  1JRI A;  3M4Y A;  5C6S A;  2VGM A;  5LJ5 f;  4XK8 E;  5LJ5 h;  3CCR T;  2YHT A;  3M59 A;  3CCR A;  4J5Y A;  1VQ7 T;  1VQ7 A;  1FXX A;  3FC3 A;  2D9T A;  1BI3 A;  2RJF A;  3PTA A;  1QVF S;  4FL6 A;  4M75 C;  3OYI A;  3CD6 A;  3CD6 T;  3QPH A;  4LD6 A;  2BKD N;  2QQ9 A;  1G3T A;  3P8B B;  3QDR B;  3V7R A;  5GAO p;  3NFC A;  1NJI C;  3JB9 J;  2XI9 A;  3ZBD A;  2R5M A;  1VQ4 T;  1VQ4 A;  5J26 A;  2JTM A;  4C8Q D;  1VQP A;  1VQP T;  2VYT A;  2DD4 A;  5KH6 A;  4KBM B;  2M0O A;  5GAN j;  2H3J A;  5CKB A;  2DXU A;  4C8Q A;  3OYH A;  3QYH B;  1K9M U;  3CC7 A;  3CC7 T;  4MMK A;  2O4X A;  1Q82 C;  1Y96 B;  2X4J A;  5GAM g;  3OMC A;  3X26 B;  1BIB A;  2YRV A;  2CGH A;  2ZPE B;  4ZTF A;  4ZGE B;  2F69 A;  4N4G A;  5GAM j;  4LDY A;  2XDB A;  4N0A C;  2CS7 A;  4XTY A;  3CXC A;  2KK4 A;  5GAN 8;  3OYN A;  1Q86 U;  1M1K C;  1KQS S;  3L2W A;  1DJ7 B;  3J80 E;  4OVA A;  1WQ7 A;  3FB9 A;  4M7D C;  2GF7 A;  3NTK A;  1Q81 C;  2K3Y A;  1JBM A;  3HFO A;  2XDD A;  3M57 A;  3HFN A;  2WAC A;  4MZP A;  4PJO G;  2MWO A;  4HT9 A;  3LGL A;  1UGQ B;  3MET A;  4M77 B;  4DA4 A;  3V7S A;  4EMK B;  2XD0 A;  2JVV A;  4C92 A;  1U8R A;  4BE2 A;  3URG A;  2LQ8 A;  4P5N A;  4L5G A;  3LH0 A;  2L5Q A;  2CZ7 B;  2P0P A;  3CEY A;  4JS5 A;  1LNX A;  1K73 C;  3MCA B;  3X25 B;  2G3R A;  2VXE A;  1WPY A;  4R55 A;  1S72 T;  1S72 A;  4CI0 C;  4F7U G;  1N9S A;  3MHX A;  4PJO F;  5LJ3 e;  4A4F A;  3AHU A;  3KXT A;  3HPW A;  4M7A G;  5GAO q;  1M1G A;  2L89 A;  2X4X A;  5A0G A;  1G3W A;  2DKG A;  1LOJ A;  1K9M C;  4MDW A;  2QQR A;  4C0F A;  1I81 A;  2DIQ A;  4NOY A;  2DZC A;  1G3S A;  3JCM X;  2O01 E;  3OYY A;  3JCM f;  1BI0 A;  3QSU A;  4M7D E;  1XQH A;  1IZ6 A;  4XAX B;  2DXB A;  4M7D B;  4JUV A;  3OS2 A;  3OS1 A;  5HK0 A;  2ZPH B;  3FLG A;  1G3Y A;  1VQL A;  1VQL T;  4IUQ A;  3QZ5 B;  4ME7 A;  4MML A;  3QXE B;  3M55 A;  5KCO A;  3QO3 A;  5C0M A;  4KUI A;  4JJN K;  3L2Q A;  2VC8 A;  3A8H B;  1I5L A;  2QQA A;  5FRO A;  4EMK C;  3HP9 A;  3JCM W;  2K2V A;  2DTH A;  3OSS C;  3QKJ A;  4D6W A;  5A2Q E;  2K3X A;  4HKE A;  4M78 C;  3G71 T;  3G71 A;  2FB7 A;  2E6Z A;  4NL3 A;  1W2B A;  2WSF E;  3S3O A;  1YJN A;  2LRQ A;  4A53 A;  4C92 C;  1VQN T;  3GNG A;  4M77 D;  3QG1 A;  4BE1 A;  3OYG A;  4LD9 K;  3RMQ A;  1W2B S;  2IG0 A;  3OY9 A;  3EFS A;  2E6N A;  4N4H A;  4OB0 B;  4MZT A;  5GAN 3;  5CIU A;  2R5A A;  3DLL A;  4Y91 A;  4RG8 A;  2M9U A;  1I4K 1;  3TEE A;  1V29 B;  2XHC A;  3M54 A;  4M75 D;  3SD4 A;  4BUG A;  2QEX A;  2QEX T;  4MDX A;  2ZCF B;  2I2L A;  2LQK A;  1ZBX A;  4X9D A;  3LLR A;  5D6W A;  1OZ2 A;  4IUT A;  5DY9 A;  1KHI A;  4M75 A;  3JAM E;  2Y90 A;  3R6O A;  3JSC A;  4TVR A;  2LNV A;  2PUO B;  5FRN A;  3HL8 A;  1VQ9 T;  4GY5 A;  2JN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...