2LRQA

Chemical shift assignment and solution structure of fr822a from drosophila melanogaster. northeast structural genomics consortium target fr822a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
85
structure length
85
Chain Sequence
MNYSTGTDANTLFVDGERVLCFHGPLIYEAKVLKTKPDATPVEYYIHYAGWSKNWDEWVPENRVLKYNDDNVKRRQELARQCGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NuA4 complex subunit EAF3 homolog
publication title Solution Structure of Fr822A from Drosophila melanogaster.
rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 11
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lrqA00
1MHNA 3FLGA 3M9QA 4CRIA 3P8HA 3QBYA 3DLMA 4C5IA 3PNWC 3CEYA 2YRVA 3DB4A 5J26A 4BACA 4ZTFA 4IUTA 3LH0A 2G3RA 3L2RA 4N4IA 2BUDA 4PLLA 4OVAA 3OMGA 2EQJA 2L89A 3OQ5A 2VYTA 2X4YA 4IURA 3ME9A 1N27A 3OY9A 4B9XA 2M16A 1KHCA 2LTOA 2RHZA 3H6ZA 4BDYA 3H8ZA 4IKFA 2D9TA 5M9OA 2LDMA 3MP8A 5C0MA 1G5VA 5D6XA 4LD6A 3LX7A 4BD3A 3S6WA 3O8VA 3F70A 5CIUA 4QQGA 2FHDA 3SD4A 1WJQA 2XDPA 5KCHA 3L2VA 2M1HA 3E9FA 3MO8A 2CKKA 2QQSA 3ASKA 3BDLA 2X35A 3LLRA 3PFSA 4E7HA 2K3XA 3S3OA 2RJDA 2RI3A 3OYHA 3QIIA 1WJRA 2R57A 3OS2A 3FEOA 1WJSA 2BKDN 4N4HA 1XNIA 5IN1A 3OYDA 2RJCA 5FROA 2RI5A 2B8AA 2RHUA 3NTHA 4HCZA 3MEAA 2GF7A 4ZTJA 3OB9A 4E7KA 3OYJA 4QQ6A 3OMCA 2MWOA 3L42A 2X4XA 3P8DA 4PL6A 5KH6A 3L2QA 5FRMA 2L8DA 3META 3PMIA 4GY5A 2E5QA 4E7LA 2M0OA 3UT1A 4NS5A 3S3MA 3L2UA 2PQWA 5D6YA 3OYEA 2K3YA 2LVMA 3C4SA 3OYKA 3MEWA 3OS0A 4E7JA 3OYCA 4A4HA 3NTIA 3LGFA 5KE2A 4PLIA 4C5EA 3OYLA 2HQEA 3OYGA 1RI0A 3Q1JA 3E9GA 3OS1A 2RO0A 5J39A 2RJEA 2R58A 3OYFA 5D6WA 3DB3A 4A4EA 2O4XA 4QW2A 3OA6A 1OZ3A 3LYIA 3PMTA 4EDUA 2WACA 2E6NA 1SSFA 3MP6A 4C5HA 3MEUA 3OYMA 4BDZA 2HQXA 5C6SA 2GFUA 1OI1A 4Z02A 3UWNA 4IUPA 5IAYA 3LGLA 3FDRA 2RJFA 4QVZA 2DIGA 2L3RA 3QJ6A 5KCOA 4FL6A 4BE0A 2O4XB 4IUQA 4UC4A 3MP1A 3MEVA 3L2WA 3NTKA 4II1A 2EQMA 2R5MA 2P0KA 4A4GA 2BIVA 2JTFA 2XK0A 4B9WA 4RG2A 4FU6A 2IG0A 4IUVA 2JZ2A 2F5KA 3EAEA 3GOXA 1OZ2A 1WGSA 2RHYA 3FC3A 2GFAA 5KE3A 4BE1A 3OYIA 2EQKA 1OYXA 2EKOA 2QQRA 2NLUA 2R5AA 3QKJA 4X34A 4L59A 2EQUA 4A4FA 4Q5WA 3S3NA 1H3ZA 3OYNA 3OYBA 2DAQA 2RI2A 4BE2A 2MWPA 2LRQA 2DIQA 2RHIA 4IUUA 4E7IA 2X4WA 4QQDA 4N4GA 3KUFA 3OYAA 5FRNA 2EFIA 2RHXA 4C5GA 2LCCA 3ZEHA
chains in the Genus database with same CATH superfamily
1NLPC 4M7DD 3QWXX 1PWTA 1PHTA 3RMQA 2C0OA 2CP2A 2YRVA 1VQOQ 5J26A 1WI7A 3OBWA 3L2RA 3X28B 2NUPA 1QWFA 1ACMB 1PM3A 4BDYA 3MP8A 3PT9A 3O8VA 5I22A 5KCHA 1JBMA 1KD1C 5FW9A 4R56A 2JTEA 1VQKA 2JMAA 2LX7A 4XTZA 2DFUA 4WF2A 4J7IA 4X9DA 1LOJA 4J7FA 4HCBA 2F2WA 4C92B 2X4XA 4HCKA 3EG9B 1YN8A 1VQNT 1AT1B 1VQ7Q 1X27A 3M58A 1GCQA 5D6YA 2K3YA 2FPEA 2DRMA 2XICA 3JCMb 3MHXA 1MMDA 1SPKA 4A4HA 2LP5A 4KRTA 1WFWA 5HY6A 4OMNA 2H3JA 2CP3A 2V1RA 2ECZA 3LW5E 3EFSA 2Y4XA 1VQNQ 5C6SA 1D0ZA 2FYKA 4DOWA 1VQ8Q 1BCOA 2E65A 3CC7Q 4JDSA 4BE0A 2O2OA 4ORZA 1UB4A 2LQ8A 3CCQA 3THKA 1KJWA 2D0NA 2KI7A 2PVOB 2X3XD 1NPRA 1KG1A 2CH4A 2GFAA 5KE3A 2JM8A 1UFFA 2QQRA 4XTWA 2L3PA 3SDZA 2VVKA 1VIEA 2RI2A 1OPLA 1U1TA 4XTVA 2KXDA 2KYBA 1W70A 2DRKA 3NMZC 1MNEA 3TQ7P 1K1ZA 4RG8A 5ECAA 2ZPIB 1TUGB 2HBPA 4HVWA 4C0ZA 2X4JA 2RH2A 1XTDA 3CCJT 4OMMA 1WQWA 3JB9H 2AIRB 3JCMJ 3H6ZA 5FWCA 5A0DA 2GTJA 5L8RE 4D8KA 2V1QA 1K8AU 3A1PA 1WHMA 2A0FB 2VGNA 4FW1A 2IPOB 2K6DA 3CCLA 2F69A 3E9FA 1Y07A 2P4RA 3CCJQ 4FYWB 2GNCA 1ZQ1A 3FEOA 1PNJA 2A3LA 2CREA 4EMHA 2DTHA 1T3LA 1M90R 5CVIA 1S72Q 2M9UA 4QQ6A 2MWOA 5GAOl 1MUZA 2E5QA 2QDYB 4RTTA 4ME7A 4KT0E 2RNAA 4M77A 3QYGB 3C4SA 1J3TA 2EBPA 1VQKT 1NYFA 4OMLA 1QVFP 6AT1B 5GANd 1UTIA 3FIFA 1VQMA 1VQ9A 4A4EA 3VS3A 4ZGDB 3SB2A 3LYIA 1V29B 1WHLA 3V7SA 1M1GA 4PFPA 1VYUA 3UA6A 2AZSA 2DXUA 2KSSA 4QVDA 5GANe 1Q7YR 3JCMh 2KT1A 2K5FA 3FDRA 1JXMA 5CQYA 4LXCA 1SRMA 1D3BA 4FL6A 2E64A 4KGVB 1IREB 1FMVA 3I56A 1QVGS 1VUBA 2RA2A 2XK0A 2W10A 4GLKA 3OW2S 2JUFA 3EAEA 3GOXA 2VGMA 3CCSA 1YIJA 2NLUA 1X6BA 2R5AA 4A4FA 4LDXA 2QGGA 1QKXA 4ZNXA 3CCQT 4BE2A 2MWPA 1N8RU 1KQSA 2FO0A 2LRQA 3QZ9B 1T0JA 1UHCA 1X2QA 2CSQA 1MHNA 5FWBA 3M9QA 2F1LA 5EG2A 2FB7A 1D09B 2ZCFB 2COYA 4AMCA 2G3RA 5CCAA 2BUDA 2DL5A 2G6FX 4M7AE 1WXTA 1AZGB 2HZYA 2L89A 4RCCA 1Q81R 4MMKA 4B9XA 1QCFA 1C1AA 3OYYA 5M9OA 3SFMA 4M78E 1BB9A 2CSIA 4RTZA 4HCCA 5CIUA 1XQHA 3CXCP 2QQSA 2ZPFB 1NEGA 1WJRA 3CC2T 3NHNA 4KGZB 4N4HA 3I9QA 1AD5A 5GMKe 3QZ5B 3CPWS 4Y91A 1YJNQ 2IVWA 3OBYA 2QGFB 1RLPC 5EC7A 3QHSA 1M2VB 4JRIA 3V8LA 2XG8D 2WSEE 3QYHB 4PJJA 4BY6B 3OS5A 4FIBA 5DM7R 5LJ3h 3VYHB 3OYLA 2ABLA 2VC8A 2RO0A 4PJMA 2KEAA 1NG2A 5IHKA 4M78B 3CCLQ 1G3TA 2HBWA 2V8IA 1X01A 4Z02A 5IAYA 3DLLA 1RAIB 2E1HA 4QVZA 2CH4W 1Q82C 3JCMQ 4M75G 1SSHA 4JUVA 1XJWB 3TSWA 1VQ5Q 4M4ZA 1YWPA 2F2VA 2IG0A 4C8QC 3G71A 5IHIA 4DOVA 3JCMX 4V2SA 1VQMQ 1VQ9Q 5GAMh 2J05A 2PVGB 5HK0A 2YRCA 3JCMV 4C92F 3H9NA 3FLGA 4LDUA 4J6YA 3CCST 3CEYA 3EGXB 4JZ4A 3CCMA 4E7SA 1QP2A 3V7RA 3HPWA 4LUEA 1KC8C 1NJIR 3PGGA 3I56Q 4F7UG 4M7DC 2FRYA 4B6MA 3H8ZA 2LDMA 3CCSQ 3LX7A 5KYUA 3S6WA 1YIJQ 3JCMW 2FZGB 3MO8A 3RKXA 1PD0A 2NUPB 4MZMA 1TTHB 4RUGA 4ZGJB 2R57A 2BKDN 2ZAEA 1VA7A 5LJ3g 2NUTA 3OYDA 2JN0A 4AFQC 5FROA 4ZTJA 3NTHA 1IXDA 2JXBA 2DXTA 1VQLA 4NS5A 3OYEA 4KULA 2LT1A 2CUDA 4OB0B 2HCKA 4E7JA 1OV3A 4FYXB 1N9RA 3H41A 4PLIA 2EIFA 4AG1C 1YHQA 3Q1JA 4J83A 5GJVB 1V76A 2QQ9A 4ESRA 1SF9A 1OZ3A 4BI3A 5GAN5 5LL6S 4M77G 4IUPA 1UGSB 5GANf 3JCMd 4FSSA 1H92A 4RTWA 4OB3B 1G3SA 2XHCA 2DD4A 2CT4A 5GAMg 4J9EA 4YTLA 4OMQA 4DQ2A 2DEQA 2HD0A 4FM4B 3BW1A 4JLGA 4EMKA 1K9MU 2A37A 2XDDA 3JCMe 1W2BS 2BE7D 2EKOA 3J80E 4XU1A 2EQUA 3H0IA 4F04B 4C8QF 1Q86R 1M4ZA 3G6EQ 2EW3A 4M7AC 3ER0A 1VYVA 3G71T 1ZUUA 1O75A 4JRPA 2KXCA 2I2LA 2KDSA 4N4IA 5GJWB 2DXCA 3SWNC 1B07A 3OMGA 2ED1A 1PRLC 2DERA 3A8HB 2L0AA 5C0MA 4M77E 5IHNA 1WX6A 3GNFB 8ATCB 2LNHB 1NLOC 1WPYA 2DE0X 3CCMT 3V7CA 4LNPA 2XIDA 3AT1B 1U3OA 1I1JA 2D8HA 1QVFA 1PKTA 4ZN1A 5IN1A 2RHUA 4HCZA 2X9HA 1QP3A 3OB9A 4XTYA 3X26B 2FVUA 5HCKA 4E7LA 1M1KR 1IGQA 4A4KA 3MEWA 2VXEA 3CMAQ 1TS9A 1R0BG 3CBMA 3VS6A 1EZZB 2W0ZA 5I11A 3BFMA 3CMEA 5J39A 1H641 5LJ3d 4LUDA 1FMWA 4M77B 2B86A 1VQLT 4RTYA 1SSFA 4C5HA 1W6XA 4CC3A 2DTIA 2XI9A 5FU6C 3VV0A 1WLPB 1YHQT 2CZ0B 5KCOA 3M0QA 5LJ3e 2E10A 4IUQA 5CKDA 3NTKA 2R5MA 1VQLQ 4C0FA 2Y4YA 4XU2A 1ZSZC 1OOTA 3JB9G 4O5VA 2QEXA 4BE1A 1D3BB 4FCYA 1YHQQ 2DVJA 1WIEA 2MCNA 2VB6A 1K73U 2E3HA 1UUEA 1CKBA 3V8KA 4CC7A 2RHIA 4C8QD 3R6NA 5GAMd 4QQDA 2MI6A 2LCCA 3H0HA 1AVZC 4JLIA 1UECA 2J6FA 4CC2A 1IZ6A 5KYWA 3CXCA 4M7AF 4J5YA 5GAMe 2VYTA 5GMKi 3GPLA 4Z88A 2ZPGB 5GMKm 3M55A 4WCIA 5FU7C 3SHWA 4M78F 3VU3C 2ESWA 3P8BB 3F70A 5LJ5j 3BDLA 4MZTA 3QG1A 1KD1R 1UJYA 2PUOB 1RABB 4C0DC 3GBQA 1Q95G 2YWWA 2J6OA 2X51A 3CCEQ 1BIAA 1UJ0A 1IGUA 3L42A 3CCVQ 2ZPBB 3PMIA 2DYBA 2V8KA 4TVRA 3T9NA 3QSUA 2BZYA 3UATA 2VWFA 2D6FA 2JW4A 4NL3A 3OYCA 3RUXA 1I8FA 2LMJA 5GANg 4RTVA 2R58A 5D6WA 2DETA 3I5RA 2O9SA 1RAHB 1PRMC 4NOYA 2DD5A 2HQXA 1K4US 4Y92A 4KH0B 4MDXA 1WQ7A 2DIGA 3KBGA 4J6WA 3CMET 1RAEB 2I0NA 4LDWA 4LDVA 5A0GA 7AT1B 2LZ6B 3LH5A 2LC4A 1JRIA 4M75A 2RQWA 2DVEA 1QW1A 2LQWA 1M3CA 1WXBA 2GCXA 1OYXA 2DNUA 2KR3A 3GLXA 3S3NA 1OX9A 3JCMf 1TUCA 1ZUYA 2JTMA 4IUUA 4Y28E 1X43A 2KK4A 3M0RA 2E3IA 2CT3A 2GGRA 2QEXT 1RUWA 4R55A 2DF6A 2ZPHB 1K8AC 2KROA 4DEYA 3LH0A 1S1NA 3EFOA 3A8LB 4M7AD 4ATOA 1OU8A 4JJBA 2BZ8A 4F16A 4ZGEB 2K9GA 3TCJA 4E47A 4LD9K 4F7UA 4M78D 4R0KA 2QEXQ 4LD6A 1D0YA 4M7DG 3RMSA 4BD3A 1ZLMA 1VQ6A 2ZPEB 2XDPA 1Z9QA 3E19A 2MAMA 1MV0B 2YXYA 2CS7A 1PSEA 3HFNA 3TU4K 2KGTA 3QIIA 1A0NB 2LCSA 4BI4A 2LCLA 5KYUB 2B8AA 2RB6A 3GIBA 3HHTB 4FT2A 3BE3A 1KK7A 3CC2A 4HXJA 2A7YA 4N0AC 2KT8A 4KH1B 3C12A 2XD0A 2PZ1A 2FZCB 2JOYA 3OYKA 1AZEA 3M0PA 2NUTB 5AYFA 5CO7A 2OX7A 1IB8A 4MMLA 4F14A 2H3EB 4J9DA 1RI0A 1ZUKA 3OW2P 1KFZA 2HL3A 2RJEA 2OTJA 3MKDA 3EHRA 2DJQA 3OA6A 2ROTA 3RKWA 2XDBA 3PMTA 2WACA 3EFRA 3MP6A 2M02A 1JJ2A 2LQNA 4J8OA 2KY9A 3JB9I 1TH7A 2RJFA 1YI2A 1YJ9A 4XU0A 3QJ6A 2H8HA 4PJOC 5LJ3f 2M0YA 2K2MA 4II1A 1N8RC 3M57A 4FYYB 1RLQC 4QKUA 2JTFA 1WXUA 1TOVA 2F5KA 1SHFA 2K2VA 2OAUA 2CDTA 2O88A 4D6WA 3M5AA 5A2QE 3I5SA 2DAQA 1VQKQ 1WHJA 1UGPB 3C95A 3JRZA 3QUIA 3A8GB 2OJ2A 2DX1A 3CPFA 4EMKB 3GNGA 1MGQA 2YUQA 3MJXA 1I81A 1T0HA 3HKSA 1M30A 3BY7A 2K57A 1AWOA 5AT1B 3RR6A 3CPWP 4IIMA 3HP9A 2YUNA 1SRLA 4C92C 5GAMf 3UF4A 2P0QA 2EKHA 4M77F 4QQGA 4CI0C 1M1FA 5LJ5h 3PFSA 3EG3A 4NL2A 2LT4A 3CC4A 1UGRB 3CCQQ 1FXXA 2F2XA 2XKOC 2GF7A 4WTOB 1VQ6T 4PL6A 1IO6A 1AHJB 4JJCA 2OTLA 1OQKA 2FPFA 3JSCA 1WA7A 5CKEA 3M0SA 2O01E 1M90U 5KYNA 4RMOA 1AWJA 2DILA 4OB2B 2DL4A 3VS1A 5CKFA 3JB9J 2QQBA 4BDZA 2MMPA 1P92A 1G3WA 4L5GA 2E6ZA 1QMCA 1Q82R 1LJOA 3PVQA 2PNIA 1E6HA 1WZOA 4IIOA 2OTJT 1K76A 3JCMg 3CC2Q 1ABOA 2VUBA 3N5BB 3RBBB 3LWHA 3DKMA 2A08A 3FB9A 1Q7YU 2JJ9A 1NYGA 4PJOF 1R0CB 1YI2T 1YJ9T 2OTJQ 1M9SA 4C0GA 5CK9A 2QK0A 1VQPA 2RQRA 4KGXB 1R77A 5GAN7 3J7AF 4RCBA 3DB4A 1WHHA 1KC8R 1U06A 2O9VA 1RADB 3TEEA 1M5Q1 2SEMA 4LE9A 4OGCA 2MPXC 2K5LA 4AFUC 5GANj 1XOVA 1W1FA 2P0PA 5KYWB 2RPNA 3SD4A 4LN2A 2X35A 2K3XA 5CAIA 1X6OA 1Q81U 1H8KA 4DA4A 3M4YA 2YHTA 2EQIA 2K79A 3HRSA 1SKUB 1ZSGA 3OMCA 3L2QA 1PKSA 2EYXA 2HKQB 1M3AA 1W4SA 4KUDK 2E41A 2E12A 1UDLA 3CC4T 5KE2A 2NYSA 4M75E 1BU1A 3MCAB 3I55A 1W2BP 4EDUA 3VRZA 2OTLT 5HKCA 4BB7A 1K9MC 3CCRA 4Z89A 3RERA 1BK2A 2J6KA 2DZ9A 1I0CA 2RQUA 1I5LA 1G83A 2GBQA 2OTLQ 4PNOA 2FZKB 2K3BA 4PJOD 3EH2A 1GFDA 4QVCA 5GMKj 4C8QA 4O6JA 3ZBDA 1B7TA 4M75B 4F7UE 5KYXB 2X4WA 3KUFA 4OB1B 2EFIA 2JT4A 4RKUE 1X6GA 5GAN3 1JJ2P 1YITT 3VRYA 2X4YA 4FW2A 1UE9A 1VQPT 3KXTA 1NPPA 1IHWA 3URGA 2COWA 1ZA1B 1G3YA 1HYOA 2YSQA 3EFOB 4BY6C 4M7DA 4C92D 3LLRA 1NJIU 1QWEA 2KRSA 3OYHA 5IXFA 3QDFA 4ANJA 1VQPQ 3OSSC 4M78C 4F7UB 2CGHA 2V8JA 1QVGA 2JVVA 3OW2A 1LCKA 3TVTA 5GAOp 3G71Q 3L2UA 2PQWA 1VQOA 4LDYA 1Y57A 3INZA 4HA8A 3NTIA 2EVRA 2DO3A 1GL5A 2D8JA 4JJDA 1OU9A 4QW2A 1VIFA 1D1BA 2YLBA 3CCMQ 4AT1B 3QWYA 1OPKA 2L3RA 1MMGA 2DTOA 2DPPB 2L5QA 3ZFJA 3I55T 1K73C 2P0KA 2BIVA 2QG9B 8AT1B 1Y71A 2WSFE 1VYTA 1VQ7A 2YDLA 3CCRT 2DL7A 1H3ZA 2DA9A 3CCUA 4XAXB 1QCNA 3VUBA 3CPWA 2DIQA 4EIKA 3VS0A 3SEMA 3REAB 3CCRQ 4C5IA 3PNWC 4F17A 3UPUA 2CZ7B 2PTKA 2EAYA 2EJGA 1Q86U 3CC7A 2EQJA 1UGVA 1N27A 2HMAA 3CD6A 2D0QB 1TG0A 2D9TA 1BKBA 4Z8AA 4C92G 1D1CA 3SWNA 3VJPA 1QKWA 1M27C 3EH1A 1JB0E 2A28A 3OS2A 2QYZA 1YCYA 1GCQC 1KQSS 1LNXA 1VOMA 2QXFA 1BI3A 2L8DA 3GF5A 3S3MA 2VKNA 1WHKA 5DLOA 2HDAA 2DYIA 5GMKl 3OS0A 4EMGA 4HT8A 3X20B 2LQKA 1M1KU 3V8JA 1RAAB 3RNJA 1VQOT 2ATCB 1CKAA 2KRMA 5HK3A 3X24B 4A54A 5CQXA 1N5ZA 2C06A 1GXIE 1ZBXA 3O5ZA 1AWXA 1S72A 1TXQA 2RM4A 2EQMA 1D1AA 3UDCA 1RI9A 2KMTA 5GAN4 4RG2A 1KSWA 1RAGB 3RESA 4XTXA 3FC3A 2EJFA 4AG2C 1FX7A 2YRDA 1PD1A 4X34A 4PFOA 1ZSZA 2PUKB 4A53A 1M8VA 2J06A 5GMKh 5CR2A 2L3QA 4PK4A 1KQ1A 1B34A 2RQVA 2RMOA 1PCXA 2KRNA 3OYAA 2J7IA 1VQ7T 2V26A 1UGQB 4L6V5 5KYYA 4A63B 1K8AR 5KYXA 4BACA 4IUTA 4ZTFA 4JRKA 3RKYA 3CCUT 2HSPA 3AHUA 4PLLA 3G1JA 1YBYA 4C8QG 1BIBA 2ZZDA 3CMEQ 4IKFA 2MK5A 1UG1A 3TSZA 3HSBA 2JS2A 3JV3A 1E7OA 5LJ3j 1K9AA 2O31A 1VQ8T 3ASKA 3CCUQ 4E7HA 5J3BA 2FPDA 3CC7T 2RJDA 2DK3A 2BZXA 2EYYA 3CBOA 2CP0A 1TWBA 3CD6T 1XNIA 2EWNA 2QQAA 2GTOA 5CKBA 2CZ1B 4M77C 2RJCA 4ZN3A 1M3BA 3L1AA 1IRXA 3U23A 5CKHA 3EGUA 1WDXA 1W2BA 2M0OA 1KD1U 2EJ9A 3QJYA 2MYSA 2RK2A 2RK1A 2EGAA 1NEBA 5LJ5f 1WHGA 2EPDA 3PVLA 2LJ1A 3CD6Q 1M8MA 1Y96A 4DBQA 5IH2A 2NWMA 4RTUA 3ULRB 1JO8A 2KBTA 4M75F 4JRQA 3PIOA 3OS1A 1NZ9A 2O4XA 2SRCA 2JMCA 2YUPA 2EYWA 2QA4A 3OSVA 5GAMj 2DZCA 2VASA 2GFUA 3UWNA 3D7SB 4C8QE 1SG5A 3VYGA 1SEMA 4E6RA 2CP7A 5I2MA 1MV3A 1OEBA 2PU9B 1T3SA 1N8RR 1QVGP 1YJNA 4VUBA 4IUVA 2QTVA 3VS7A 4QT7A 2DBMA 4Q5WA 2CP5A 3OYNA 4E2FB 1S72T 4F7UF 5GAN6 4EPCA 3NGPA 1C6VX 1N9SA 3RIRA 3J81E 4XU3A 2P84A 4M7DE 2QTXA 3X25B 1EFNA 4J9HA 4E7ZA 3VS2A 2KVQG 3M54A 4C8QB 5GAOm 3M4GA 1VQ4A 1ZBJA 2MIOA 5GAN8 1MMAA 1AWWA 2JS0A 2M16A 1VQ5A 3A8MB 3EGDA 2DXBA 1WNLA 2DL3A 2OI3A 3HRUA 4OMPA 2YUOA 1QQJA 2CP6A 2WSCE 4M7AG 1WJSA 1U8RA 2FRWA 2K7AA 2MOXA 1ZA2B 1M90C 4E7KA 4M78G 3E1SA 5KH6A 4M7DB 2RF0A 2EYQA 4GY5A 2E5KA 2FL7A 1PSFA 4N0AA 4PJNA 2K4YA 3E9GA 4M75D 1FYNA 4HVVA 1BI2A 1LPLA 4RTXA 3JCMc 2DMOA 4JS5A 5IT9E 1OI1A 1Q7YC 4JZ3A 2CYZB 2ZGWA 1JU5C 1OX8A 1K0SA 3QPHA 1QVFS 2AZVA 1MMNA 2E70A 3GP8A 3QXEB 2QA4T 4B9WA 4KBMB 1VQ6Q 4PJOA 3WVDB 4P5NA 4AFZC 1EX4A 2EQKA 1BBZA 3QKJA 4OMOA 4ELZC 5GAN2 2CUBA 3KFVA 2Z0WA 4CC4B 3OYBA 1I4K1 2C0TA 1HD3A 1RAFB 3M0TA 1JQQA 2ROLA 1YJNT 3BDUA 4GBQA 4N4GA 2QA4Q 3MPUB 4CRIA 2HKNA 1EIFA 2IIMA 4J9BA 2DJZA 1R8OB 1AEYA 2VXFA 1ARKA 4OVAA 2JM9A 4JJNK 2RD1A 2VV5A 3ME9A 1Q81C 1YITA 3OY9A 1X75C 3VS4A 3CCLT 2EYZA 5L23A 1YP5A 3A5ZB 4M7AB 4JS4A 3WXMB 3L2VA 4C92A 2M1HA 5FLXE 2CKKA 3EG9A 1VQ4T 3PTAA 1BYMA 1C0MA 3L2ZA 3S3OA 1YI2Q 2RI3A 1I5OB 1YJ9Q 4KUIA 1VQ5T 1QCOA 5LJ5g 2XMFA 2GQIA 3SWNB 4DBHA 3G6EA 1HJDA 4J9FA 1QVPA 3R6OA 3OYJA 1F1BB 1JEGA 3G4SA 1VQ4Q 1TU0B 2LVMA 1VQMT 1VQ9T 3FJ5A 4M77D 4DEXA 4XQ3A 3CXCS 1N6AA 2AHJB 4OGEA 1GCPA 2CZ6B 1HSQA 3JB9F 1G2BA 2QDLA 1CSKA 3EG2A 5DY9A 2OAWA 4PJLA 3EG1A 1KIKA 3WVEB 4MZPA 3I35A 1K9MR 1LVKA 3I56T 4OP0A 4D8DA 4EMKC 1WYXA 4UC4A 1MNDA 3MEVA 3L2WA 2C0IA 5GAOr 1YIJT 3VS5A 4K11A 2Y90A 4X1VA 1Q82U 1OULA 4DBFA 3CMAA 3OYIA 5FU6B 1TUDA 1QLYA 1RACB 2KYMA 2XU8A 2EGCA 3M59A 3CC4Q 4E7IA 4HT9A 4C5GA 1YFNA 3ZEHA 1O9SA 1PC0A 3DLMA 1YJWA 1ZSZB 1JXOA 2RN8A 3E2UA 1ZHIA 2GQVA 1YCSB 2ED0A 5DLQE 2D1XA 1B34B 4FYVB 1NJIC 3OQ5A 4IURA 2QAZA 2DL8A 2LTOA 1IHVA 5KYYB 1NM7A 3A8OB 1G5VA 2HNIA 1PG5B 1M2OA 2FHDA 3HTRA 1FWZA 3HFOA 1KC8U 1GBRA 2DKGA 3QO3A 2RQTA 2YLCA 1D0XA 1TSFA 1UHFA 3NPFA 4HVUA 2F5TX 3H0FA 3MEAA 1BI0A 1B3QA 3P8DA 5FU7B 2DM1A 3UT1A 2E4HA 3M0UA 1K0XA 4J9GA 1GFCA 1YITQ 5I21A 4ELYC 3FRNA 2MF2A 4OMFB 3G6ET 2HQEA 3OYGA 3JCMP 2YT6A 1SHGA 3OYFA 2HL5C 4C0DB 5LJ5d 2KNBB 3LWIA 3G4ST 4PKCC 3JB9D 2LJ0A 3MEUA 2DEUA 1BI1A 2QI2A 1FMKA 2M51A 2FG0A 1Y96B 2A36A 3RDVA 3VKIA 2K5IA 1GBQA 3VUZA 4FSXA 5LJ5e 5D7UA 2O4XB 3CCEA 3HRTA 1K73R 3M56A 3G4SQ 1Z9ZA 3CCVA 1X69A 4MDWA 1NE8A 1U5SA 5GAOq 2JZ2A 1OZ2A 2AKLA 1I07A 1WGSA 2BE9B 4L59A 4BUGA 1BCMA 5I2SA 4XTUA 1X2KA 1RL2A 2BTTA 1Q86C 1YNZA 2AKKA 1E6GA 5FRNA 4M7DF 2COZA 3HL8A 3M53A 1H3HA 3P8HA 3QBYA 3CMAT 4PJOG 2KAFA 1JJ2S 3NFCA 1KQSP 4JPBW 3EHQA 3PE0A 2DBKA 1YWOA 2LJ3A 4J9IA 2PVDB 4BI8B 1KHCA 2RHZA 1U1SA 3I55Q 3CQTA 2LX9A 5D6XA 2NUZA 1YJWT 2X3WD 3G7ZA 1WJQA 2KE9A 1NBEB 1VQNA 4FT4A 2LNVA 1Y0MA 2QASA 3UA7A 4PFZA 1M2VA 3EG0A 3EGDB 1VQ8A 4M7AA 3JAME 2RI5A 3C94A 4OF1A 1YJWQ 5FRMA 3CBPA 1M1KC 4M78A 1ABQA 4J9CA 3REBB 5GANh 2HSEB 2L3SA 3LGFA 3A98A 2HAXA 4C5EA 4X9CA 1G8XA 4HKEA 2ENMA 2HEQA 1HXDA 5A0LA 1KHIA 3DB3A 3TREA 4PJOE 2EGEA 1ZX6A 2E6NA 5GAOn 3OYMA 3QDRB 1HK9A 1AOJA 4J6XA 3LGLA 2L2PA 9ATCB 4M75C 2P4TA 1DJ7B 1Y7XA 3FJPA 2HQHA 2AK5A 2JNGA 2DLPA 3MP1A 2KQWA 3PIPA 4A4GA 1KQ2A 4FU6A 4DBRA 3C0CA 3ZL7C 2AT1B 2RHYA 5IXBA 4AFSC 3IQLA 3EGXA 2FEIA 4XK8E 3CCET 3CCJA 1UEBA 1V1CA 4GLMA 1GRIA 3CCVT 2RHXA 3META 4PJOB 4C92E
chains in the Genus database with same CATH topology
5GAN7 4M7DD 3J7AF 4M7DE 1O75A 2QTXA 3RMQA 3X25B 4RCBA 2YRVA 4JRPA 3DB4A 2I2LA 5J26A 2KVQG 3OBWA 2KDSA 3M54A 4C8QB 3M4GA 5GAOm 4N4IA 3L2RA 1VQ4A 2DXCA 3X28B 3SWNC 3OMGA 3TEEA 1M5Q1 5GAN8 3A8HB 2M16A 1VQ5A 4OGCA 3A8MB 4BDYA 2DXBA 2K5LA 5GANj 1WNLA 3MP8A 1XOVA 3PT9A 5C0MA 2P0PA 3HRUA 4M77E 3O8VA 3GNFB 3SD4A 1WPYA 5KCHA 3CCMT 1JBMA 3V7CA 2X35A 1KD1C 2K3XA 5CAIA 2XIDA 4R56A 1X6OA 2WSCE 4M7AG 1Q81U 1VQKA 4XTZA 1QVFA 1WJSA 4ZN1A 1U8RA 5IN1A 4WF2A 4DA4A 3M4YA 4J7IA 4X9DA 2YHTA 1LOJA 2RHUA 3HRSA 4HCZA 4J7FA 1M90C 1QP3A 3OB9A 4M78G 4XTYA 3E1SA 3X26B 3OMCA 4C92B 5KH6A 2FVUA 2X4XA 3L2QA 4M7DB 4E7LA 4GY5A 1VQNT 1W4SA 2FL7A 3M58A 5D6YA 4A4KA 1PSFA 2K3YA 4KUDK 3MEWA 2VXEA 2XICA 3JCMb 2E41A 2E12A 3MHXA 4A4HA 3CC4T 5KE2A 3CBMA 4N0AA 2K4YA 5HY6A 3BFMA 3E9GA 3CMEA 4M75D 4M75E 5J39A 2H3JA 3MCAB 1H641 5LJ3d 1BI2A 3LW5E 3I55A 3EFSA 2Y4XA 3JCMc 4M77B 1VQLT 4EDUA 1SSFA 4C5HA 4JS5A 5IT9E 2OTLT 5HKCA 5C6SA 2DTIA 2XI9A 1OI1A 5FU6C 2FYKA 4BB7A 1Q7YC 3VV0A 1K9MC 4DOWA 2CYZB 3CCRA 2ZGWA 2E65A 1YHQT 2CZ0B 5KCOA 5LJ3e 4JDSA 4BE0A 2E10A 3RERA 1UB4A 4IUQA 5CKDA 2LQ8A 2DZ9A 3QPHA 3CCQA 1QVFS 1I5LA 3NTKA 2R5MA 4C0FA 2PVOB 2Y4YA 4XU2A 3J81E 2E70A 3GP8A 3QXEB 2QA4T 1NPRA 4B9WA 3JB9G 4PNOA 1KG1A 4KBMB 4PJOA 3WVDB 4O5VA 2QEXA 2GFAA 4P5NA 5KE3A 4PJOD 4BE1A 1D3BB 2EQKA 2QQRA 4XTWA 3QKJA 4ELZC 5GAN2 3SDZA 4QVCA 5GMKj 1VIEA 2RI2A 3OYBA 1K73U 1I4K1 4C8QA 4O6JA 3ZBDA 3V8KA 4M75B 1U1TA 2RHIA 4XTVA 4C8QD 4F7UE 1YJNT 3BDUA 5GAMd 2X4WA 4QQDA 4N4GA 3KUFA 2MI6A 4OB1B 2EFIA 2LCCA 4RKUE 4RG8A 4CRIA 2ZPIB 5GAN3 4JLIA 1EIFA 1YITT 2DJZA 1R8OB 2HBPA 1IZ6A 4C0ZA 3CXCA 2VXFA 4M7AF 2X4JA 1Q81C 2RH2A 4OVAA 1XTDA 4J5YA 3CCJT 1WQWA 5GAMe 4JJNK 3JB9H 2RD1A 2VYTA 2X4YA 5GMKi 3GPLA 2VV5A 3ME9A 3JCMJ 1YITA 3OY9A 1X75C 1VQPT 2ZPGB 5GMKm 3CCLT 3M55A 3KXTA 1NPPA 3H6ZA 5FU7C 5A0DA 4M78F 3VU3C 5L8RE 1K8AU 3P8BB 3F70A 3A5ZB 4M7AB 2VGNA 3URGA 3WXMB 5LJ5j 4C92A 3L2VA 2M1HA 4BY6C 1G3YA 2F69A 3E9FA 1Y07A 2CKKA 3BDLA 5FLXE 4MZTA 3LLRA 3QG1A 4C92D 3PTAA 1VQ4T 1NJIU 3CCLA 1BYMA 3L2ZA 3S3OA 2RI3A 2PUOB 3OYHA 4E7KA 4C0DC 1ZQ1A 3FEOA 4KUIA 3OSSC 1VQ5T 2A3LA 4M78C 4EMHA 4F7UB 2CGHA 2V8JA 5LJ5g 2DTHA 1QVGA 1BIAA 3SWNB 3G6EA 1QVPA 2JVVA 5CVIA 2M9UA 3R6OA 3OYJA 4QQ6A 3OW2A 2MWOA 3L42A 5GAOp 5GAOl 2ZPBB 3PMIA 2E5QA 2QDYB 2V8KA 4TVRA 3G4SA 4ME7A 3T9NA 3QSUA 4KT0E 3L2UA 2PQWA 1VQOA 4M77A 3QYGB 2LVMA 4LDYA 3C4SA 1VQMT 1VQ9T 4M77D 2D6FA 1VQKT 3INZA 4NL3A 3OYCA 4HA8A 4XQ3A 3NTIA 5GANd 3RUXA 1I8FA 3CXCS 3FIFA 1N6AA 1VQMA 2AHJB 5GANg 1VQ9A 2DO3A 2R58A 5D6WA 4OGEA 4QW2A 4A4EA 4ZGDB 3SB2A 2CZ6B 3LYIA 1V29B 4NOYA 3V7SA 1M1GA 1VIFA 3JB9F 2DD5A 2HQXA 2DXUA 5DY9A 2KSSA 2YLBA 4QVDA 5GANe 3WVEB 3JCMh 2K5FA 4MZPA 3FDRA 3I56T 4OP0A 5CQYA 4MDXA 1WQ7A 2DIGA 3KBGA 2L3RA 4J6WA 1D3BA 3CMET 2DTOA 2DPPB 4FL6A 4EMKC 5A0GA 4LDWA 4LDVA 4UC4A 2L5QA 2E64A 3MEVA 3ZFJA 3I55T 1K73C 3L2WA 1IREB 5GAOr 2P0KA 3I56A 1YIJT 2LC4A 2BIVA 1JRIA 4M75A 1QVGS 1VUBA 1Y71A 2RA2A 2XK0A 4GLKA 2WSFE 2DVEA 1VQ7A 3OW2S 2Y90A 2JUFA 3EAEA 3GOXA 2VGMA 1QW1A 2GCXA 1Q82U 3CCRT 3CMAA 3CCSA 3OYIA 1OYXA 1YIJA 2NLUA 2R5AA 3GLXA 4A4FA 3JCMf 3S3NA 4LDXA 1H3ZA 5FU6B 3CCUA 4XAXB 1N8RU 3CCQT 4BE2A 2MWPA 2XU8A 3M59A 1KQSA 2JTMA 2LRQA 3QZ9B 3VUBA 3CPWA 2DIQA 4IUUA 4Y28E 4E7IA 4HT9A 2KK4A 4C5GA 3ZEHA 1MHNA 3M9QA 2QEXT 1O9SA 5EG2A 3DLMA 4C5IA 3PNWC 4R55A 2FB7A 2ZPHB 2CZ7B 3UPUA 1YJWA 1K8AC 2ZCFB 3LH0A 1ZHIA 2G3RA 5CCAA 2GQVA 2BUDA 2EAYA 2EJGA 3A8LB 5DLQE 1B34B 3UWNA 2EQJA 3CC7A 1Q86U 1NJIC 4ATOA 4M7AE 2L89A 3OQ5A 4RCCA 4IURA 4MMKA 1N27A 4B9XA 4ZGEB 3CD6A 2LTOA 3TCJA 4E47A 2D0QB 3OYYA 2D9TA 4LD9K 5M9OA 1BKBA 3A8OB 3SFMA 4C92G 4M78E 4M78D 4F7UA 1G5VA 4M7AD 2HNIA 4LD6A 3SWNA 4M7DG 3RMSA 4BD3A 4HCCA 1VQ6A 5CIUA 2ZPEB 2FHDA 1FWZA 3VJPA 2XDPA 1XQHA 3E19A 2MAMA 3HFOA 2QQSA 2CS7A 1KC8U 2ZPFB 1PSEA 2DKGA 3HFNA 3QO3A 1JB0E 3TU4K 3QIIA 1WJRA 3CC2T 3OS2A 4N4HA 1YCYA 2YLCA 2F5TX 4BI4A 2LCLA 2B8AA 1KQSS 2RB6A 3MEAA 3GIBA 3HHTB 4FT2A 5GMKe 1LNXA 1BI0A 3QZ5B 4Y91A 2QXFA 2IVWA 3P8DA 3CPWS 3CC2A 3OBYA 1BI3A 2L8DA 3META 2A7YA 3GF5A 5FU7B 3UT1A 4N0AC 3S3MA 3C12A 2XD0A 3QHSA 5DLOA 2JOYA 3OYKA 5GMKl 4JRIA 3OS0A 4EMGA 3V8LA 2XG8D 2WSEE 3QYHB 5AYFA 4BY6B 5CO7A 5I21A 3OS5A 4FIBA 4ELYC 3FRNA 5DM7R 2MF2A 4OMFB 4MMLA 5LJ3h 3VYHB 3OYLA 2HQEA 3OYGA 3G6ET 2VC8A 3JCMP 1RI0A 4HT8A 3OYFA 2RO0A 2RJEA 4C0DB 2OTJA 5LJ5d 3X20B 4JS4A 2LQKA 3OA6A 3LWIA 1M1KU 3V8JA 3RKWA 4M78B 2XDBA 1G3TA 3PMTA 3G4ST 4PKCC 2WACA 3EFRA 3MP6A 3JB9D 1VQOT 3MEUA 1JJ2A 2V8IA 1BI1A 1X01A 2QI2A 4J8OA 4Z02A 5IAYA 1Y96B 2KY9A 5HK3A 3X24B 3JB9I 1TH7A 2E1HA 2RJFA 5CQXA 4A54A 3DLLA 1YI2A 4QVZA 2K5IA 3VKIA 1Q82C 4M7DA 3VUZA 1YJ9A 4FSXA 3QJ6A 4XU0A 5LJ5e 3JCMQ 2C06A 1GXIE 2O4XB 4PJOC 1ZBXA 4M75G 3CCEA 3HRTA 5LJ3f 4JUVA 1S72A 2RM4A 4II1A 2EQMA 3M56A 3UDCA 1N8RC 2KMTA 3M57A 5GAN4 2JTFA 3CCVA 4MDWA 4RG2A 2IG0A 1NE8A 4C8QC 5GAOq 2JZ2A 2F5KA 3G71A 3RESA 1OZ2A 2K2VA 1WGSA 2OAUA 4XTXA 2EJFA 3FC3A 4DOVA 1FX7A 3JCMX 4D6WA 3M5AA 5A2QE 4V2SA 4X34A 4L59A 4BUGA 2PUKB 4A53A 5I2SA 1M8VA 2DAQA 4XTUA 5GMKh 5CR2A 5GAMh 1UGPB 3C95A 1RL2A 3JRZA 3QUIA 1Q86C 1KQ1A 2PVGB 1B34A 5HK0A 3A8GB 5FRNA 3OYAA 3CPFA 3JCMV 3GNGA 4EMKB 4C92F 1VQ7T 1MGQA 4M7DF 3FLGA 1UGQB 4L6V5 3HL8A 4LDUA 1I81A 3M53A 3P8HA 3QBYA 3CMAT 4J6YA 3CCST 3CEYA 3HKSA 4PJOG 2KAFA 4BACA 3BY7A 2K57A 4IUTA 3CCMA 4JRKA 3RKYA 4ZTFA 3NFCA 1JJ2S 3CCUT 1QP2A 3V7RA 3HPWA 3AHUA 4PLLA 1KC8C 3PGGA 3HP9A 1YBYA 4F7UG 4C8QG 4C92C 1BIBA 5GAMf 2ZZDA 2PVDB 4BI8B 1KHCA 2RHZA 4M7DC 2P0QA 3H8ZA 4IKFA 1U1SA 2LDMA 4M77F 2LX9A 3HSBA 5D6XA 3LX7A 1YJWT 3S6WA 3G7ZA 4QQGA 3JCMW 5LJ3j 1WJQA 1VQ8T 1VQNA 3MO8A 3RKXA 3ASKA 4FT4A 4CI0C 1M1FA 5LJ5h 4E7HA 3PFSA 5J3BA 2LNVA 4MZMA 3CC7T 2RJDA 2DK3A 4ZGJB 3CBOA 2R57A 4NL2A 2BKDN 2LT4A 3CD6T 3CC4A 1XNIA 2EWNA 2QQAA 5CKBA 1UGRB 5LJ3g 1VQ8A 2CZ1B 4M77C 2RJCA 2JN0A 4ZN3A 3JAME 5FROA 3OYDA 4M7AA 2RI5A 1FXXA 3L1AA 3NTHA 4ZTJA 2XKOC 2GF7A 3C94A 4OF1A 1VQ6T 4PL6A 2DXTA 5FRMA 3CBPA 5CKHA 1M1KC 1W2BA 2M0OA 1KD1U 1VQLA 1AHJB 4NS5A 4M78A 2EJ9A 3QJYA 3OYEA 2OTLA 4KULA 2RK2A 5GANh 2LT1A 2RK1A 4OB0B 5LJ5f 4E7JA 3JSCA 1N9RA 3LGFA 5CKEA 2HAXA 1Y96A 4PLIA 4X9CA 4C5EA 4HKEA 2EIFA 2O01E 1YHQA 1M90U 4M75F 3Q1JA 4JRQA 1HXDA 4RMOA 3PIOA 5A0LA 3OS1A 4J83A 1KHIA 1NZ9A 3DB3A 2O4XA 2QQ9A 3TREA 1OZ3A 4PJOE 4BI3A 4OB2B 5GAN5 2E6NA 5CKFA 5GAOn 3OYMA 3JB9J 2QA4A 2QQBA 3OSVA 5GAMj 4BDZA 2DZCA 2MMPA 2GFUA 3QDRB 1P92A 1G3WA 1HK9A 5LL6S 4J6XA 4IUPA 2E6ZA 4L5GA 3LGLA 4M77G 1UGSB 4C8QE 4M75C 5GANf 1LJOA 3JCMd 2P4TA 3VYGA 1DJ7B 1Y7XA 3FJPA 4OB3B 2OTJT 1G3SA 2XHCA 2DD4A 5I2MA 5GAMg 3JCMg 2JNGA 3MP1A 2KQWA 2VUBA 2PU9B 3N5BB 4YTLA 3PIPA 3LWHA 3DKMA 1YJNA 4A4GA 4DQ2A 1KQ2A 2DEQA 2HD0A 4VUBA 3FB9A 4FM4B 3BW1A 4JLGA 4FU6A 4IUVA 1Q7YU 4EMKA 1K9MU 4PJOF 2RHYA 1YI2T 2XDDA 3JCMe 1W2BS 2EKOA 3J80E 4XU1A 1YJ9T 2EQUA 4Q5WA 3OYNA 4XK8E 3CCET 1M9SA 4C0GA 5CK9A 4HCBA 3CCJA 1S72T 4F7UF 4C8QF 5GAN6 1UEBA 1M4ZA 4EPCA 1N9SA 3RIRA 1VQPA 3CCVT 4M7AC 2RHXA 2EYQA 4PJOB 3ER0A 4XU3A 3G71T 4C92E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHN A;  3FLG A;  3M9Q A;  4CRI A;  3P8H A;  3QBY A;  3DLM A;  4C5I A;  3PNW C;  3CEY A;  2YRV A;  3DB4 A;  5J26 A;  4BAC A;  4ZTF A;  4IUT A;  3LH0 A;  2G3R A;  3L2R A;  4N4I A;  2BUD A;  4PLL A;  4OVA A;  3OMG A;  2EQJ A;  2L89 A;  3OQ5 A;  2VYT A;  2X4Y A;  4IUR A;  3ME9 A;  1N27 A;  3OY9 A;  4B9X A;  2M16 A;  1KHC A;  2LTO A;  2RHZ A;  3H6Z A;  4BDY A;  3H8Z A;  4IKF A;  2D9T A;  5M9O A;  2LDM A;  3MP8 A;  5C0M A;  1G5V A;  5D6X A;  4LD6 A;  3LX7 A;  4BD3 A;  3S6W A;  3O8V A;  3F70 A;  5CIU A;  4QQG A;  2FHD A;  3SD4 A;  1WJQ A;  2XDP A;  5KCH A;  3L2V A;  2M1H A;  3E9F A;  3MO8 A;  2CKK A;  2QQS A;  3ASK A;  3BDL A;  2X35 A;  3LLR A;  3PFS A;  4E7H A;  2K3X A;  3S3O A;  2RJD A;  2RI3 A;  3OYH A;  3QII A;  1WJR A;  2R57 A;  3OS2 A;  3FEO A;  1WJS A;  2BKD N;  4N4H A;  1XNI A;  5IN1 A;  3OYD A;  2RJC A;  5FRO A;  2RI5 A;  2B8A A;  2RHU A;  3NTH A;  4HCZ A;  3MEA A;  2GF7 A;  4ZTJ A;  3OB9 A;  4E7K A;  3OYJ A;  4QQ6 A;  3OMC A;  2MWO A;  3L42 A;  2X4X A;  3P8D A;  4PL6 A;  5KH6 A;  3L2Q A;  5FRM A;  2L8D A;  3MET A;  3PMI A;  4GY5 A;  2E5Q A;  4E7L A;  2M0O A;  3UT1 A;  4NS5 A;  3S3M A;  3L2U A;  2PQW A;  5D6Y A;  3OYE A;  2K3Y A;  2LVM A;  3C4S A;  3OYK A;  3MEW A;  3OS0 A;  4E7J A;  3OYC A;  4A4H A;  3NTI A;  3LGF A;  5KE2 A;  4PLI A;  4C5E A;  3OYL A;  2HQE A;  3OYG A;  1RI0 A;  3Q1J A;  3E9G A;  3OS1 A;  2RO0 A;  5J39 A;  2RJE A;  2R58 A;  3OYF A;  5D6W A;  3DB3 A;  4A4E A;  2O4X A;  4QW2 A;  3OA6 A;  1OZ3 A;  3LYI A;  3PMT A;  4EDU A;  2WAC A;  2E6N A;  1SSF A;  3MP6 A;  4C5H A;  3MEU A;  3OYM A;  4BDZ A;  2HQX A;  5C6S A;  2GFU A;  1OI1 A;  4Z02 A;  3UWN A;  4IUP A;  5IAY A;  3LGL A;  3FDR A;  2RJF A;  4QVZ A;  2DIG A;  2L3R A;  3QJ6 A;  5KCO A;  4FL6 A;  4BE0 A;  2O4X B;  4IUQ A;  4UC4 A;  3MP1 A;  3MEV A;  3L2W A;  3NTK A;  4II1 A;  2EQM A;  2R5M A;  2P0K A;  4A4G A;  2BIV A;  2JTF A;  2XK0 A;  4B9W A;  4RG2 A;  4FU6 A;  2IG0 A;  4IUV A;  2JZ2 A;  2F5K A;  3EAE A;  3GOX A;  1OZ2 A;  1WGS A;  2RHY A;  3FC3 A;  2GFA A;  5KE3 A;  4BE1 A;  3OYI A;  2EQK A;  1OYX A;  2EKO A;  2QQR A;  2NLU A;  2R5A A;  3QKJ A;  4X34 A;  4L59 A;  2EQU A;  4A4F A;  4Q5W A;  3S3N A;  1H3Z A;  3OYN A;  3OYB A;  2DAQ A;  2RI2 A;  4BE2 A;  2MWP A;  2LRQ A;  2DIQ A;  2RHI A;  4IUU A;  4E7I A;  2X4W A;  4QQD A;  4N4G A;  3KUF A;  3OYA A;  5FRN A;  2EFI A;  2RHX A;  4C5G A;  2LCC A;  3ZEH A; 
#chains in the Genus database with same CATH topology
 1NLP C;  4M7D D;  3QWX X;  1PWT A;  1PHT A;  3RMQ A;  2C0O A;  2CP2 A;  2YRV A;  1VQO Q;  5J26 A;  1WI7 A;  3OBW A;  3L2R A;  3X28 B;  2NUP A;  1QWF A;  1ACM B;  1PM3 A;  4BDY A;  3MP8 A;  3PT9 A;  3O8V A;  5I22 A;  5KCH A;  1JBM A;  1KD1 C;  5FW9 A;  4R56 A;  2JTE A;  1VQK A;  2JMA A;  2LX7 A;  4XTZ A;  2DFU A;  4WF2 A;  4J7I A;  4X9D A;  1LOJ A;  4J7F A;  4HCB A;  2F2W A;  4C92 B;  2X4X A;  4HCK A;  3EG9 B;  1YN8 A;  1VQN T;  1AT1 B;  1VQ7 Q;  1X27 A;  3M58 A;  1GCQ A;  5D6Y A;  2K3Y A;  2FPE A;  2DRM A;  2XIC A;  3JCM b;  3MHX A;  1MMD A;  1SPK A;  4A4H A;  2LP5 A;  4KRT A;  1WFW A;  5HY6 A;  4OMN A;  2H3J A;  2CP3 A;  2V1R A;  2ECZ A;  3LW5 E;  3EFS A;  2Y4X A;  1VQN Q;  5C6S A;  1D0Z A;  2FYK A;  4DOW A;  1VQ8 Q;  1BCO A;  2E65 A;  3CC7 Q;  4JDS A;  4BE0 A;  2O2O A;  4ORZ A;  1UB4 A;  2LQ8 A;  3CCQ A;  3THK A;  1KJW A;  2D0N A;  2KI7 A;  2PVO B;  2X3X D;  1NPR A;  1KG1 A;  2CH4 A;  2GFA A;  5KE3 A;  2JM8 A;  1UFF A;  2QQR A;  4XTW A;  2L3P A;  3SDZ A;  2VVK A;  1VIE A;  2RI2 A;  1OPL A;  1U1T A;  4XTV A;  2KXD A;  2KYB A;  1W70 A;  2DRK A;  3NMZ C;  1MNE A;  3TQ7 P;  1K1Z A;  4RG8 A;  5ECA A;  2ZPI B;  1TUG B;  2HBP A;  4HVW A;  4C0Z A;  2X4J A;  2RH2 A;  1XTD A;  3CCJ T;  4OMM A;  1WQW A;  3JB9 H;  2AIR B;  3JCM J;  3H6Z A;  5FWC A;  5A0D A;  2GTJ A;  5L8R E;  4D8K A;  2V1Q A;  1K8A U;  3A1P A;  1WHM A;  2A0F B;  2VGN A;  4FW1 A;  2IPO B;  2K6D A;  3CCL A;  2F69 A;  3E9F A;  1Y07 A;  2P4R A;  3CCJ Q;  4FYW B;  2GNC A;  1ZQ1 A;  3FEO A;  1PNJ A;  2A3L A;  2CRE A;  4EMH A;  2DTH A;  1T3L A;  1M90 R;  5CVI A;  1S72 Q;  2M9U A;  4QQ6 A;  2MWO A;  5GAO l;  1MUZ A;  2E5Q A;  2QDY B;  4RTT A;  4ME7 A;  4KT0 E;  2RNA A;  4M77 A;  3QYG B;  3C4S A;  1J3T A;  2EBP A;  1VQK T;  1NYF A;  4OML A;  1QVF P;  6AT1 B;  5GAN d;  1UTI A;  3FIF A;  1VQM A;  1VQ9 A;  4A4E A;  3VS3 A;  4ZGD B;  3SB2 A;  3LYI A;  1V29 B;  1WHL A;  3V7S A;  1M1G A;  4PFP A;  1VYU A;  3UA6 A;  2AZS A;  2DXU A;  2KSS A;  4QVD A;  5GAN e;  1Q7Y R;  3JCM h;  2KT1 A;  2K5F A;  3FDR A;  1JXM A;  5CQY A;  4LXC A;  1SRM A;  1D3B A;  4FL6 A;  2E64 A;  4KGV B;  1IRE B;  1FMV A;  3I56 A;  1QVG S;  1VUB A;  2RA2 A;  2XK0 A;  2W10 A;  4GLK A;  3OW2 S;  2JUF A;  3EAE A;  3GOX A;  2VGM A;  3CCS A;  1YIJ A;  2NLU A;  1X6B A;  2R5A A;  4A4F A;  4LDX A;  2QGG A;  1QKX A;  4ZNX A;  3CCQ T;  4BE2 A;  2MWP A;  1N8R U;  1KQS A;  2FO0 A;  2LRQ A;  3QZ9 B;  1T0J A;  1UHC A;  1X2Q A;  2CSQ A;  1MHN A;  5FWB A;  3M9Q A;  2F1L A;  5EG2 A;  2FB7 A;  1D09 B;  2ZCF B;  2COY A;  4AMC A;  2G3R A;  5CCA A;  2BUD A;  2DL5 A;  2G6F X;  4M7A E;  1WXT A;  1AZG B;  2HZY A;  2L89 A;  4RCC A;  1Q81 R;  4MMK A;  4B9X A;  1QCF A;  1C1A A;  3OYY A;  5M9O A;  3SFM A;  4M78 E;  1BB9 A;  2CSI A;  4RTZ A;  4HCC A;  5CIU A;  1XQH A;  3CXC P;  2QQS A;  2ZPF B;  1NEG A;  1WJR A;  3CC2 T;  3NHN A;  4KGZ B;  4N4H A;  3I9Q A;  1AD5 A;  5GMK e;  3QZ5 B;  3CPW S;  4Y91 A;  1YJN Q;  2IVW A;  3OBY A;  2QGF B;  1RLP C;  5EC7 A;  3QHS A;  1M2V B;  4JRI A;  3V8L A;  2XG8 D;  2WSE E;  3QYH B;  4PJJ A;  4BY6 B;  3OS5 A;  4FIB A;  5DM7 R;  5LJ3 h;  3VYH B;  3OYL A;  2ABL A;  2VC8 A;  2RO0 A;  4PJM A;  2KEA A;  1NG2 A;  5IHK A;  4M78 B;  3CCL Q;  1G3T A;  2HBW A;  2V8I A;  1X01 A;  4Z02 A;  5IAY A;  3DLL A;  1RAI B;  2E1H A;  4QVZ A;  2CH4 W;  1Q82 C;  3JCM Q;  4M75 G;  1SSH A;  4JUV A;  1XJW B;  3TSW A;  1VQ5 Q;  4M4Z A;  1YWP A;  2F2V A;  2IG0 A;  4C8Q C;  3G71 A;  5IHI A;  4DOV A;  3JCM X;  4V2S A;  1VQM Q;  1VQ9 Q;  5GAM h;  2J05 A;  2PVG B;  5HK0 A;  2YRC A;  3JCM V;  4C92 F;  3H9N A;  3FLG A;  4LDU A;  4J6Y A;  3CCS T;  3CEY A;  3EGX B;  4JZ4 A;  3CCM A;  4E7S A;  1QP2 A;  3V7R A;  3HPW A;  4LUE A;  1KC8 C;  1NJI R;  3PGG A;  3I56 Q;  4F7U G;  4M7D C;  2FRY A;  4B6M A;  3H8Z A;  2LDM A;  3CCS Q;  3LX7 A;  5KYU A;  3S6W A;  1YIJ Q;  3JCM W;  2FZG B;  3MO8 A;  3RKX A;  1PD0 A;  2NUP B;  4MZM A;  1TTH B;  4RUG A;  4ZGJ B;  2R57 A;  2BKD N;  2ZAE A;  1VA7 A;  5LJ3 g;  2NUT A;  3OYD A;  2JN0 A;  4AFQ C;  5FRO A;  4ZTJ A;  3NTH A;  1IXD A;  2JXB A;  2DXT A;  1VQL A;  4NS5 A;  3OYE A;  4KUL A;  2LT1 A;  2CUD A;  4OB0 B;  2HCK A;  4E7J A;  1OV3 A;  4FYX B;  1N9R A;  3H41 A;  4PLI A;  2EIF A;  4AG1 C;  1YHQ A;  3Q1J A;  4J83 A;  5GJV B;  1V76 A;  2QQ9 A;  4ESR A;  1SF9 A;  1OZ3 A;  4BI3 A;  5GAN 5;  5LL6 S;  4M77 G;  4IUP A;  1UGS B;  5GAN f;  3JCM d;  4FSS A;  1H92 A;  4RTW A;  4OB3 B;  1G3S A;  2XHC A;  2DD4 A;  2CT4 A;  5GAM g;  4J9E A;  4YTL A;  4OMQ A;  4DQ2 A;  2DEQ A;  2HD0 A;  4FM4 B;  3BW1 A;  4JLG A;  4EMK A;  1K9M U;  2A37 A;  2XDD A;  3JCM e;  1W2B S;  2BE7 D;  2EKO A;  3J80 E;  4XU1 A;  2EQU A;  3H0I A;  4F04 B;  4C8Q F;  1Q86 R;  1M4Z A;  3G6E Q;  2EW3 A;  4M7A C;  3ER0 A;  1VYV A;  3G71 T;  1ZUU A;  1O75 A;  4JRP A;  2KXC A;  2I2L A;  2KDS A;  4N4I A;  5GJW B;  2DXC A;  3SWN C;  1B07 A;  3OMG A;  2ED1 A;  1PRL C;  2DER A;  3A8H B;  2L0A A;  5C0M A;  4M77 E;  5IHN A;  1WX6 A;  3GNF B;  8ATC B;  2LNH B;  1NLO C;  1WPY A;  2DE0 X;  3CCM T;  3V7C A;  4LNP A;  2XID A;  3AT1 B;  1U3O A;  1I1J A;  2D8H A;  1QVF A;  1PKT A;  4ZN1 A;  5IN1 A;  2RHU A;  4HCZ A;  2X9H A;  1QP3 A;  3OB9 A;  4XTY A;  3X26 B;  2FVU A;  5HCK A;  4E7L A;  1M1K R;  1IGQ A;  4A4K A;  3MEW A;  2VXE A;  3CMA Q;  1TS9 A;  1R0B G;  3CBM A;  3VS6 A;  1EZZ B;  2W0Z A;  5I11 A;  3BFM A;  3CME A;  5J39 A;  1H64 1;  5LJ3 d;  4LUD A;  1FMW A;  4M77 B;  2B86 A;  1VQL T;  4RTY A;  1SSF A;  4C5H A;  1W6X A;  4CC3 A;  2DTI A;  2XI9 A;  5FU6 C;  3VV0 A;  1WLP B;  1YHQ T;  2CZ0 B;  5KCO A;  3M0Q A;  5LJ3 e;  2E10 A;  4IUQ A;  5CKD A;  3NTK A;  2R5M A;  1VQL Q;  4C0F A;  2Y4Y A;  4XU2 A;  1ZSZ C;  1OOT A;  3JB9 G;  4O5V A;  2QEX A;  4BE1 A;  1D3B B;  4FCY A;  1YHQ Q;  2DVJ A;  1WIE A;  2MCN A;  2VB6 A;  1K73 U;  2E3H A;  1UUE A;  1CKB A;  3V8K A;  4CC7 A;  2RHI A;  4C8Q D;  3R6N A;  5GAM d;  4QQD A;  2MI6 A;  2LCC A;  3H0H A;  1AVZ C;  4JLI A;  1UEC A;  2J6F A;  4CC2 A;  1IZ6 A;  5KYW A;  3CXC A;  4M7A F;  4J5Y A;  5GAM e;  2VYT A;  5GMK i;  3GPL A;  4Z88 A;  2ZPG B;  5GMK m;  3M55 A;  4WCI A;  5FU7 C;  3SHW A;  4M78 F;  3VU3 C;  2ESW A;  3P8B B;  3F70 A;  5LJ5 j;  3BDL A;  4MZT A;  3QG1 A;  1KD1 R;  1UJY A;  2PUO B;  1RAB B;  4C0D C;  3GBQ A;  1Q95 G;  2YWW A;  2J6O A;  2X51 A;  3CCE Q;  1BIA A;  1UJ0 A;  1IGU A;  3L42 A;  3CCV Q;  2ZPB B;  3PMI A;  2DYB A;  2V8K A;  4TVR A;  3T9N A;  3QSU A;  2BZY A;  3UAT A;  2VWF A;  2D6F A;  2JW4 A;  4NL3 A;  3OYC A;  3RUX A;  1I8F A;  2LMJ A;  5GAN g;  4RTV A;  2R58 A;  5D6W A;  2DET A;  3I5R A;  2O9S A;  1RAH B;  1PRM C;  4NOY A;  2DD5 A;  2HQX A;  1K4U S;  4Y92 A;  4KH0 B;  4MDX A;  1WQ7 A;  2DIG A;  3KBG A;  4J6W A;  3CME T;  1RAE B;  2I0N A;  4LDW A;  4LDV A;  5A0G A;  7AT1 B;  2LZ6 B;  3LH5 A;  2LC4 A;  1JRI A;  4M75 A;  2RQW A;  2DVE A;  1QW1 A;  2LQW A;  1M3C A;  1WXB A;  2GCX A;  1OYX A;  2DNU A;  2KR3 A;  3GLX A;  3S3N A;  1OX9 A;  3JCM f;  1TUC A;  1ZUY A;  2JTM A;  4IUU A;  4Y28 E;  1X43 A;  2KK4 A;  3M0R A;  2E3I A;  2CT3 A;  2GGR A;  2QEX T;  1RUW A;  4R55 A;  2DF6 A;  2ZPH B;  1K8A C;  2KRO A;  4DEY A;  3LH0 A;  1S1N A;  3EFO A;  3A8L B;  4M7A D;  4ATO A;  1OU8 A;  4JJB A;  2BZ8 A;  4F16 A;  4ZGE B;  2K9G A;  3TCJ A;  4E47 A;  4LD9 K;  4F7U A;  4M78 D;  4R0K A;  2QEX Q;  4LD6 A;  1D0Y A;  4M7D G;  3RMS A;  4BD3 A;  1ZLM A;  1VQ6 A;  2ZPE B;  2XDP A;  1Z9Q A;  3E19 A;  2MAM A;  1MV0 B;  2YXY A;  2CS7 A;  1PSE A;  3HFN A;  3TU4 K;  2KGT A;  3QII A;  1A0N B;  2LCS A;  4BI4 A;  2LCL A;  5KYU B;  2B8A A;  2RB6 A;  3GIB A;  3HHT B;  4FT2 A;  3BE3 A;  1KK7 A;  3CC2 A;  4HXJ A;  2A7Y A;  4N0A C;  2KT8 A;  4KH1 B;  3C12 A;  2XD0 A;  2PZ1 A;  2FZC B;  2JOY A;  3OYK A;  1AZE A;  3M0P A;  2NUT B;  5AYF A;  5CO7 A;  2OX7 A;  1IB8 A;  4MML A;  4F14 A;  2H3E B;  4J9D A;  1RI0 A;  1ZUK A;  3OW2 P;  1KFZ A;  2HL3 A;  2RJE A;  2OTJ A;  3MKD A;  3EHR A;  2DJQ A;  3OA6 A;  2ROT A;  3RKW A;  2XDB A;  3PMT A;  2WAC A;  3EFR A;  3MP6 A;  2M02 A;  1JJ2 A;  2LQN A;  4J8O A;  2KY9 A;  3JB9 I;  1TH7 A;  2RJF A;  1YI2 A;  1YJ9 A;  4XU0 A;  3QJ6 A;  2H8H A;  4PJO C;  5LJ3 f;  2M0Y A;  2K2M A;  4II1 A;  1N8R C;  3M57 A;  4FYY B;  1RLQ C;  4QKU A;  2JTF A;  1WXU A;  1TOV A;  2F5K A;  1SHF A;  2K2V A;  2OAU A;  2CDT A;  2O88 A;  4D6W A;  3M5A A;  5A2Q E;  3I5S A;  2DAQ A;  1VQK Q;  1WHJ A;  1UGP B;  3C95 A;  3JRZ A;  3QUI A;  3A8G B;  2OJ2 A;  2DX1 A;  3CPF A;  4EMK B;  3GNG A;  1MGQ A;  2YUQ A;  3MJX A;  1I81 A;  1T0H A;  3HKS A;  1M30 A;  3BY7 A;  2K57 A;  1AWO A;  5AT1 B;  3RR6 A;  3CPW P;  4IIM A;  3HP9 A;  2YUN A;  1SRL A;  4C92 C;  5GAM f;  3UF4 A;  2P0Q A;  2EKH A;  4M77 F;  4QQG A;  4CI0 C;  1M1F A;  5LJ5 h;  3PFS A;  3EG3 A;  4NL2 A;  2LT4 A;  3CC4 A;  1UGR B;  3CCQ Q;  1FXX A;  2F2X A;  2XKO C;  2GF7 A;  4WTO B;  1VQ6 T;  4PL6 A;  1IO6 A;  1AHJ B;  4JJC A;  2OTL A;  1OQK A;  2FPF A;  3JSC A;  1WA7 A;  5CKE A;  3M0S A;  2O01 E;  1M90 U;  5KYN A;  4RMO A;  1AWJ A;  2DIL A;  4OB2 B;  2DL4 A;  3VS1 A;  5CKF A;  3JB9 J;  2QQB A;  4BDZ A;  2MMP A;  1P92 A;  1G3W A;  4L5G A;  2E6Z A;  1QMC A;  1Q82 R;  1LJO A;  3PVQ A;  2PNI A;  1E6H A;  1WZO A;  4IIO A;  2OTJ T;  1K76 A;  3JCM g;  3CC2 Q;  1ABO A;  2VUB A;  3N5B B;  3RBB B;  3LWH A;  3DKM A;  2A08 A;  3FB9 A;  1Q7Y U;  2JJ9 A;  1NYG A;  4PJO F;  1R0C B;  1YI2 T;  1YJ9 T;  2OTJ Q;  1M9S A;  4C0G A;  5CK9 A;  2QK0 A;  1VQP A;  2RQR A;  4KGX B;  1R77 A;  5GAN 7;  3J7A F;  4RCB A;  3DB4 A;  1WHH A;  1KC8 R;  1U06 A;  2O9V A;  1RAD B;  3TEE A;  1M5Q 1;  2SEM A;  4LE9 A;  4OGC A;  2MPX C;  2K5L A;  4AFU C;  5GAN j;  1XOV A;  1W1F A;  2P0P A;  5KYW B;  2RPN A;  3SD4 A;  4LN2 A;  2X35 A;  2K3X A;  5CAI A;  1X6O A;  1Q81 U;  1H8K A;  4DA4 A;  3M4Y A;  2YHT A;  2EQI A;  2K79 A;  3HRS A;  1SKU B;  1ZSG A;  3OMC A;  3L2Q A;  1PKS A;  2EYX A;  2HKQ B;  1M3A A;  1W4S A;  4KUD K;  2E41 A;  2E12 A;  1UDL A;  3CC4 T;  5KE2 A;  2NYS A;  4M75 E;  1BU1 A;  3MCA B;  3I55 A;  1W2B P;  4EDU A;  3VRZ A;  2OTL T;  5HKC A;  4BB7 A;  1K9M C;  3CCR A;  4Z89 A;  3RER A;  1BK2 A;  2J6K A;  2DZ9 A;  1I0C A;  2RQU A;  1I5L A;  1G83 A;  2GBQ A;  2OTL Q;  4PNO A;  2FZK B;  2K3B A;  4PJO D;  3EH2 A;  1GFD A;  4QVC A;  5GMK j;  4C8Q A;  4O6J A;  3ZBD A;  1B7T A;  4M75 B;  4F7U E;  5KYX B;  2X4W A;  3KUF A;  4OB1 B;  2EFI A;  2JT4 A;  4RKU E;  1X6G A;  5GAN 3;  1JJ2 P;  1YIT T;  3VRY A;  2X4Y A;  4FW2 A;  1UE9 A;  1VQP T;  3KXT A;  1NPP A;  1IHW A;  3URG A;  2COW A;  1ZA1 B;  1G3Y A;  1HYO A;  2YSQ A;  3EFO B;  4BY6 C;  4M7D A;  4C92 D;  3LLR A;  1NJI U;  1QWE A;  2KRS A;  3OYH A;  5IXF A;  3QDF A;  4ANJ A;  1VQP Q;  3OSS C;  4M78 C;  4F7U B;  2CGH A;  2V8J A;  1QVG A;  2JVV A;  3OW2 A;  1LCK A;  3TVT A;  5GAO p;  3G71 Q;  3L2U A;  2PQW A;  1VQO A;  4LDY A;  1Y57 A;  3INZ A;  4HA8 A;  3NTI A;  2EVR A;  2DO3 A;  1GL5 A;  2D8J A;  4JJD A;  1OU9 A;  4QW2 A;  1VIF A;  1D1B A;  2YLB A;  3CCM Q;  4AT1 B;  3QWY A;  1OPK A;  2L3R A;  1MMG A;  2DTO A;  2DPP B;  2L5Q A;  3ZFJ A;  3I55 T;  1K73 C;  2P0K A;  2BIV A;  2QG9 B;  8AT1 B;  1Y71 A;  2WSF E;  1VYT A;  1VQ7 A;  2YDL A;  3CCR T;  2DL7 A;  1H3Z A;  2DA9 A;  3CCU A;  4XAX B;  1QCN A;  3VUB A;  3CPW A;  2DIQ A;  4EIK A;  3VS0 A;  3SEM A;  3REA B;  3CCR Q;  4C5I A;  3PNW C;  4F17 A;  3UPU A;  2CZ7 B;  2PTK A;  2EAY A;  2EJG A;  1Q86 U;  3CC7 A;  2EQJ A;  1UGV A;  1N27 A;  2HMA A;  3CD6 A;  2D0Q B;  1TG0 A;  2D9T A;  1BKB A;  4Z8A A;  4C92 G;  1D1C A;  3SWN A;  3VJP A;  1QKW A;  1M27 C;  3EH1 A;  1JB0 E;  2A28 A;  3OS2 A;  2QYZ A;  1YCY A;  1GCQ C;  1KQS S;  1LNX A;  1VOM A;  2QXF A;  1BI3 A;  2L8D A;  3GF5 A;  3S3M A;  2VKN A;  1WHK A;  5DLO A;  2HDA A;  2DYI A;  5GMK l;  3OS0 A;  4EMG A;  4HT8 A;  3X20 B;  2LQK A;  1M1K U;  3V8J A;  1RAA B;  3RNJ A;  1VQO T;  2ATC B;  1CKA A;  2KRM A;  5HK3 A;  3X24 B;  4A54 A;  5CQX A;  1N5Z A;  2C06 A;  1GXI E;  1ZBX A;  3O5Z A;  1AWX A;  1S72 A;  1TXQ A;  2RM4 A;  2EQM A;  1D1A A;  3UDC A;  1RI9 A;  2KMT A;  5GAN 4;  4RG2 A;  1KSW A;  1RAG B;  3RES A;  4XTX A;  3FC3 A;  2EJF A;  4AG2 C;  1FX7 A;  2YRD A;  1PD1 A;  4X34 A;  4PFO A;  1ZSZ A;  2PUK B;  4A53 A;  1M8V A;  2J06 A;  5GMK h;  5CR2 A;  2L3Q A;  4PK4 A;  1KQ1 A;  1B34 A;  2RQV A;  2RMO A;  1PCX A;  2KRN A;  3OYA A;  2J7I A;  1VQ7 T;  2V26 A;  1UGQ B;  4L6V 5;  5KYY A;  4A63 B;  1K8A R;  5KYX A;  4BAC A;  4IUT A;  4ZTF A;  4JRK A;  3RKY A;  3CCU T;  2HSP A;  3AHU A;  4PLL A;  3G1J A;  1YBY A;  4C8Q G;  1BIB A;  2ZZD A;  3CME Q;  4IKF A;  2MK5 A;  1UG1 A;  3TSZ A;  3HSB A;  2JS2 A;  3JV3 A;  1E7O A;  5LJ3 j;  1K9A A;  2O31 A;  1VQ8 T;  3ASK A;  3CCU Q;  4E7H A;  5J3B A;  2FPD A;  3CC7 T;  2RJD A;  2DK3 A;  2BZX A;  2EYY A;  3CBO A;  2CP0 A;  1TWB A;  3CD6 T;  1XNI A;  2EWN A;  2QQA A;  2GTO A;  5CKB A;  2CZ1 B;  4M77 C;  2RJC A;  4ZN3 A;  1M3B A;  3L1A A;  1IRX A;  3U23 A;  5CKH A;  3EGU A;  1WDX A;  1W2B A;  2M0O A;  1KD1 U;  2EJ9 A;  3QJY A;  2MYS A;  2RK2 A;  2RK1 A;  2EGA A;  1NEB A;  5LJ5 f;  1WHG A;  2EPD A;  3PVL A;  2LJ1 A;  3CD6 Q;  1M8M A;  1Y96 A;  4DBQ A;  5IH2 A;  2NWM A;  4RTU A;  3ULR B;  1JO8 A;  2KBT A;  4M75 F;  4JRQ A;  3PIO A;  3OS1 A;  1NZ9 A;  2O4X A;  2SRC A;  2JMC A;  2YUP A;  2EYW A;  2QA4 A;  3OSV A;  5GAM j;  2DZC A;  2VAS A;  2GFU A;  3UWN A;  3D7S B;  4C8Q E;  1SG5 A;  3VYG A;  1SEM A;  4E6R A;  2CP7 A;  5I2M A;  1MV3 A;  1OEB A;  2PU9 B;  1T3S A;  1N8R R;  1QVG P;  1YJN A;  4VUB A;  4IUV A;  2QTV A;  3VS7 A;  4QT7 A;  2DBM A;  4Q5W A;  2CP5 A;  3OYN A;  4E2F B;  1S72 T;  4F7U F;  5GAN 6;  4EPC A;  3NGP A;  1C6V X;  1N9S A;  3RIR A;  3J81 E;  4XU3 A;  2P84 A;  4M7D E;  2QTX A;  3X25 B;  1EFN A;  4J9H A;  4E7Z A;  3VS2 A;  2KVQ G;  3M54 A;  4C8Q B;  5GAO m;  3M4G A;  1VQ4 A;  1ZBJ A;  2MIO A;  5GAN 8;  1MMA A;  1AWW A;  2JS0 A;  2M16 A;  1VQ5 A;  3A8M B;  3EGD A;  2DXB A;  1WNL A;  2DL3 A;  2OI3 A;  3HRU A;  4OMP A;  2YUO A;  1QQJ A;  2CP6 A;  2WSC E;  4M7A G;  1WJS A;  1U8R A;  2FRW A;  2K7A A;  2MOX A;  1ZA2 B;  1M90 C;  4E7K A;  4M78 G;  3E1S A;  5KH6 A;  4M7D B;  2RF0 A;  2EYQ A;  4GY5 A;  2E5K A;  2FL7 A;  1PSF A;  4N0A A;  4PJN A;  2K4Y A;  3E9G A;  4M75 D;  1FYN A;  4HVV A;  1BI2 A;  1LPL A;  4RTX A;  3JCM c;  2DMO A;  4JS5 A;  5IT9 E;  1OI1 A;  1Q7Y C;  4JZ3 A;  2CYZ B;  2ZGW A;  1JU5 C;  1OX8 A;  1K0S A;  3QPH A;  1QVF S;  2AZV A;  1MMN A;  2E70 A;  3GP8 A;  3QXE B;  2QA4 T;  4B9W A;  4KBM B;  1VQ6 Q;  4PJO A;  3WVD B;  4P5N A;  4AFZ C;  1EX4 A;  2EQK A;  1BBZ A;  3QKJ A;  4OMO A;  4ELZ C;  5GAN 2;  2CUB A;  3KFV A;  2Z0W A;  4CC4 B;  3OYB A;  1I4K 1;  2C0T A;  1HD3 A;  1RAF B;  3M0T A;  1JQQ A;  2ROL A;  1YJN T;  3BDU A;  4GBQ A;  4N4G A;  2QA4 Q;  3MPU B;  4CRI A;  2HKN A;  1EIF A;  2IIM A;  4J9B A;  2DJZ A;  1R8O B;  1AEY A;  2VXF A;  1ARK A;  4OVA A;  2JM9 A;  4JJN K;  2RD1 A;  2VV5 A;  3ME9 A;  1Q81 C;  1YIT A;  3OY9 A;  1X75 C;  3VS4 A;  3CCL T;  2EYZ A;  5L23 A;  1YP5 A;  3A5Z B;  4M7A B;  4JS4 A;  3WXM B;  3L2V A;  4C92 A;  2M1H A;  5FLX E;  2CKK A;  3EG9 A;  1VQ4 T;  3PTA A;  1BYM A;  1C0M A;  3L2Z A;  3S3O A;  1YI2 Q;  2RI3 A;  1I5O B;  1YJ9 Q;  4KUI A;  1VQ5 T;  1QCO A;  5LJ5 g;  2XMF A;  2GQI A;  3SWN B;  4DBH A;  3G6E A;  1HJD A;  4J9F A;  1QVP A;  3R6O A;  3OYJ A;  1F1B B;  1JEG A;  3G4S A;  1VQ4 Q;  1TU0 B;  2LVM A;  1VQM T;  1VQ9 T;  3FJ5 A;  4M77 D;  4DEX A;  4XQ3 A;  3CXC S;  1N6A A;  2AHJ B;  4OGE A;  1GCP A;  2CZ6 B;  1HSQ A;  3JB9 F;  1G2B A;  2QDL A;  1CSK A;  3EG2 A;  5DY9 A;  2OAW A;  4PJL A;  3EG1 A;  1KIK A;  3WVE B;  4MZP A;  3I35 A;  1K9M R;  1LVK A;  3I56 T;  4OP0 A;  4D8D A;  4EMK C;  1WYX A;  4UC4 A;  1MND A;  3MEV A;  3L2W A;  2C0I A;  5GAO r;  1YIJ T;  3VS5 A;  4K11 A;  2Y90 A;  4X1V A;  1Q82 U;  1OUL A;  4DBF A;  3CMA A;  3OYI A;  5FU6 B;  1TUD A;  1QLY A;  1RAC B;  2KYM A;  2XU8 A;  2EGC A;  3M59 A;  3CC4 Q;  4E7I A;  4HT9 A;  4C5G A;  1YFN A;  3ZEH A;  1O9S A;  1PC0 A;  3DLM A;  1YJW A;  1ZSZ B;  1JXO A;  2RN8 A;  3E2U A;  1ZHI A;  2GQV A;  1YCS B;  2ED0 A;  5DLQ E;  2D1X A;  1B34 B;  4FYV B;  1NJI C;  3OQ5 A;  4IUR A;  2QAZ A;  2DL8 A;  2LTO A;  1IHV A;  5KYY B;  1NM7 A;  3A8O B;  1G5V A;  2HNI A;  1PG5 B;  1M2O A;  2FHD A;  3HTR A;  1FWZ A;  3HFO A;  1KC8 U;  1GBR A;  2DKG A;  3QO3 A;  2RQT A;  2YLC A;  1D0X A;  1TSF A;  1UHF A;  3NPF A;  4HVU A;  2F5T X;  3H0F A;  3MEA A;  1BI0 A;  1B3Q A;  3P8D A;  5FU7 B;  2DM1 A;  3UT1 A;  2E4H A;  3M0U A;  1K0X A;  4J9G A;  1GFC A;  1YIT Q;  5I21 A;  4ELY C;  3FRN A;  2MF2 A;  4OMF B;  3G6E T;  2HQE A;  3OYG A;  3JCM P;  2YT6 A;  1SHG A;  3OYF A;  2HL5 C;  4C0D B;  5LJ5 d;  2KNB B;  3LWI A;  3G4S T;  4PKC C;  3JB9 D;  2LJ0 A;  3MEU A;  2DEU A;  1BI1 A;  2QI2 A;  1FMK A;  2M51 A;  2FG0 A;  1Y96 B;  2A36 A;  3RDV A;  3VKI A;  2K5I A;  1GBQ A;  3VUZ A;  4FSX A;  5LJ5 e;  5D7U A;  2O4X B;  3CCE A;  3HRT A;  1K73 R;  3M56 A;  3G4S Q;  1Z9Z A;  3CCV A;  1X69 A;  4MDW A;  1NE8 A;  1U5S A;  5GAO q;  2JZ2 A;  1OZ2 A;  2AKL A;  1I07 A;  1WGS A;  2BE9 B;  4L59 A;  4BUG A;  1BCM A;  5I2S A;  4XTU A;  1X2K A;  1RL2 A;  2BTT A;  1Q86 C;  1YNZ A;  2AKK A;  1E6G A;  5FRN A;  4M7D F;  2COZ A;  3HL8 A;  3M53 A;  1H3H A;  3P8H A;  3QBY A;  3CMA T;  4PJO G;  2KAF A;  1JJ2 S;  3NFC A;  1KQS P;  4JPB W;  3EHQ A;  3PE0 A;  2DBK A;  1YWO A;  2LJ3 A;  4J9I A;  2PVD B;  4BI8 B;  1KHC A;  2RHZ A;  1U1S A;  3I55 Q;  3CQT A;  2LX9 A;  5D6X A;  2NUZ A;  1YJW T;  2X3W D;  3G7Z A;  1WJQ A;  2KE9 A;  1NBE B;  1VQN A;  4FT4 A;  2LNV A;  1Y0M A;  2QAS A;  3UA7 A;  4PFZ A;  1M2V A;  3EG0 A;  3EGD B;  1VQ8 A;  4M7A A;  3JAM E;  2RI5 A;  3C94 A;  4OF1 A;  1YJW Q;  5FRM A;  3CBP A;  1M1K C;  4M78 A;  1ABQ A;  4J9C A;  3REB B;  5GAN h;  2HSE B;  2L3S A;  3LGF A;  3A98 A;  2HAX A;  4C5E A;  4X9C A;  1G8X A;  4HKE A;  2ENM A;  2HEQ A;  1HXD A;  5A0L A;  1KHI A;  3DB3 A;  3TRE A;  4PJO E;  2EGE A;  1ZX6 A;  2E6N A;  5GAO n;  3OYM A;  3QDR B;  1HK9 A;  1AOJ A;  4J6X A;  3LGL A;  2L2P A;  9ATC B;  4M75 C;  2P4T A;  1DJ7 B;  1Y7X A;  3FJP A;  2HQH A;  2AK5 A;  2JNG A;  2DLP A;  3MP1 A;  2KQW A;  3PIP A;  4A4G A;  1KQ2 A;  4FU6 A;  4DBR A;  3C0C A;  3ZL7 C;  2AT1 B;  2RHY A;  5IXB A;  4AFS C;  3IQL A;  3EGX A;  2FEI A;  4XK8 E;  3CCE T;  3CCJ A;  1UEB A;  1V1C A;  4GLM A;  1GRI A;  3CCV T;  2RHX A;  3MET A;  4PJO B;  4C92 E; 
#chains in the Genus database with same CATH homology
 5GAN 7;  4M7D D;  3J7A F;  4M7D E;  1O75 A;  2QTX A;  3RMQ A;  3X25 B;  4RCB A;  2YRV A;  4JRP A;  3DB4 A;  2I2L A;  5J26 A;  2KVQ G;  3OBW A;  2KDS A;  3M54 A;  4C8Q B;  3M4G A;  5GAO m;  4N4I A;  3L2R A;  1VQ4 A;  2DXC A;  3X28 B;  3SWN C;  3OMG A;  3TEE A;  1M5Q 1;  5GAN 8;  3A8H B;  2M16 A;  1VQ5 A;  4OGC A;  3A8M B;  4BDY A;  2DXB A;  2K5L A;  5GAN j;  1WNL A;  3MP8 A;  1XOV A;  3PT9 A;  5C0M A;  2P0P A;  3HRU A;  4M77 E;  3O8V A;  3GNF B;  3SD4 A;  1WPY A;  5KCH A;  3CCM T;  1JBM A;  3V7C A;  2X35 A;  1KD1 C;  2K3X A;  5CAI A;  2XID A;  4R56 A;  1X6O A;  2WSC E;  4M7A G;  1Q81 U;  1VQK A;  4XTZ A;  1QVF A;  1WJS A;  4ZN1 A;  1U8R A;  5IN1 A;  4WF2 A;  4DA4 A;  3M4Y A;  4J7I A;  4X9D A;  2YHT A;  1LOJ A;  2RHU A;  3HRS A;  4HCZ A;  4J7F A;  1M90 C;  1QP3 A;  3OB9 A;  4M78 G;  4XTY A;  3E1S A;  3X26 B;  3OMC A;  4C92 B;  5KH6 A;  2FVU A;  2X4X A;  3L2Q A;  4M7D B;  4E7L A;  4GY5 A;  1VQN T;  1W4S A;  2FL7 A;  3M58 A;  5D6Y A;  4A4K A;  1PSF A;  2K3Y A;  4KUD K;  3MEW A;  2VXE A;  2XIC A;  3JCM b;  2E41 A;  2E12 A;  3MHX A;  4A4H A;  3CC4 T;  5KE2 A;  3CBM A;  4N0A A;  2K4Y A;  5HY6 A;  3BFM A;  3E9G A;  3CME A;  4M75 D;  4M75 E;  5J39 A;  2H3J A;  3MCA B;  1H64 1;  5LJ3 d;  1BI2 A;  3LW5 E;  3I55 A;  3EFS A;  2Y4X A;  3JCM c;  4M77 B;  1VQL T;  4EDU A;  1SSF A;  4C5H A;  4JS5 A;  5IT9 E;  2OTL T;  5HKC A;  5C6S A;  2DTI A;  2XI9 A;  1OI1 A;  5FU6 C;  2FYK A;  4BB7 A;  1Q7Y C;  3VV0 A;  1K9M C;  4DOW A;  2CYZ B;  3CCR A;  2ZGW A;  2E65 A;  1YHQ T;  2CZ0 B;  5KCO A;  5LJ3 e;  4JDS A;  4BE0 A;  2E10 A;  3RER A;  1UB4 A;  4IUQ A;  5CKD A;  2LQ8 A;  2DZ9 A;  3QPH A;  3CCQ A;  1QVF S;  1I5L A;  3NTK A;  2R5M A;  4C0F A;  2PVO B;  2Y4Y A;  4XU2 A;  3J81 E;  2E70 A;  3GP8 A;  3QXE B;  2QA4 T;  1NPR A;  4B9W A;  3JB9 G;  4PNO A;  1KG1 A;  4KBM B;  4PJO A;  3WVD B;  4O5V A;  2QEX A;  2GFA A;  4P5N A;  5KE3 A;  4PJO D;  4BE1 A;  1D3B B;  2EQK A;  2QQR A;  4XTW A;  3QKJ A;  4ELZ C;  5GAN 2;  3SDZ A;  4QVC A;  5GMK j;  1VIE A;  2RI2 A;  3OYB A;  1K73 U;  1I4K 1;  4C8Q A;  4O6J A;  3ZBD A;  3V8K A;  4M75 B;  1U1T A;  2RHI A;  4XTV A;  4C8Q D;  4F7U E;  1YJN T;  3BDU A;  5GAM d;  2X4W A;  4QQD A;  4N4G A;  3KUF A;  2MI6 A;  4OB1 B;  2EFI A;  2LCC A;  4RKU E;  4RG8 A;  4CRI A;  2ZPI B;  5GAN 3;  4JLI A;  1EIF A;  1YIT T;  2DJZ A;  1R8O B;  2HBP A;  1IZ6 A;  4C0Z A;  3CXC A;  2VXF A;  4M7A F;  2X4J A;  1Q81 C;  2RH2 A;  4OVA A;  1XTD A;  4J5Y A;  3CCJ T;  1WQW A;  5GAM e;  4JJN K;  3JB9 H;  2RD1 A;  2VYT A;  2X4Y A;  5GMK i;  3GPL A;  2VV5 A;  3ME9 A;  3JCM J;  1YIT A;  3OY9 A;  1X75 C;  1VQP T;  2ZPG B;  5GMK m;  3CCL T;  3M55 A;  3KXT A;  1NPP A;  3H6Z A;  5FU7 C;  5A0D A;  4M78 F;  3VU3 C;  5L8R E;  1K8A U;  3P8B B;  3F70 A;  3A5Z B;  4M7A B;  2VGN A;  3URG A;  3WXM B;  5LJ5 j;  4C92 A;  3L2V A;  2M1H A;  4BY6 C;  1G3Y A;  2F69 A;  3E9F A;  1Y07 A;  2CKK A;  3BDL A;  5FLX E;  4MZT A;  3LLR A;  3QG1 A;  4C92 D;  3PTA A;  1VQ4 T;  1NJI U;  3CCL A;  1BYM A;  3L2Z A;  3S3O A;  2RI3 A;  2PUO B;  3OYH A;  4E7K A;  4C0D C;  1ZQ1 A;  3FEO A;  4KUI A;  3OSS C;  1VQ5 T;  2A3L A;  4M78 C;  4EMH A;  4F7U B;  2CGH A;  2V8J A;  5LJ5 g;  2DTH A;  1QVG A;  1BIA A;  3SWN B;  3G6E A;  1QVP A;  2JVV A;  5CVI A;  2M9U A;  3R6O A;  3OYJ A;  4QQ6 A;  3OW2 A;  2MWO A;  3L42 A;  5GAO p;  5GAO l;  2ZPB B;  3PMI A;  2E5Q A;  2QDY B;  2V8K A;  4TVR A;  3G4S A;  4ME7 A;  3T9N A;  3QSU A;  4KT0 E;  3L2U A;  2PQW A;  1VQO A;  4M77 A;  3QYG B;  2LVM A;  4LDY A;  3C4S A;  1VQM T;  1VQ9 T;  4M77 D;  2D6F A;  1VQK T;  3INZ A;  4NL3 A;  3OYC A;  4HA8 A;  4XQ3 A;  3NTI A;  5GAN d;  3RUX A;  1I8F A;  3CXC S;  3FIF A;  1N6A A;  1VQM A;  2AHJ B;  5GAN g;  1VQ9 A;  2DO3 A;  2R58 A;  5D6W A;  4OGE A;  4QW2 A;  4A4E A;  4ZGD B;  3SB2 A;  2CZ6 B;  3LYI A;  1V29 B;  4NOY A;  3V7S A;  1M1G A;  1VIF A;  3JB9 F;  2DD5 A;  2HQX A;  2DXU A;  5DY9 A;  2KSS A;  2YLB A;  4QVD A;  5GAN e;  3WVE B;  3JCM h;  2K5F A;  4MZP A;  3FDR A;  3I56 T;  4OP0 A;  5CQY A;  4MDX A;  1WQ7 A;  2DIG A;  3KBG A;  2L3R A;  4J6W A;  1D3B A;  3CME T;  2DTO A;  2DPP B;  4FL6 A;  4EMK C;  5A0G A;  4LDW A;  4LDV A;  4UC4 A;  2L5Q A;  2E64 A;  3MEV A;  3ZFJ A;  3I55 T;  1K73 C;  3L2W A;  1IRE B;  5GAO r;  2P0K A;  3I56 A;  1YIJ T;  2LC4 A;  2BIV A;  1JRI A;  4M75 A;  1QVG S;  1VUB A;  1Y71 A;  2RA2 A;  2XK0 A;  4GLK A;  2WSF E;  2DVE A;  1VQ7 A;  3OW2 S;  2Y90 A;  2JUF A;  3EAE A;  3GOX A;  2VGM A;  1QW1 A;  2GCX A;  1Q82 U;  3CCR T;  3CMA A;  3CCS A;  3OYI A;  1OYX A;  1YIJ A;  2NLU A;  2R5A A;  3GLX A;  4A4F A;  3JCM f;  3S3N A;  4LDX A;  1H3Z A;  5FU6 B;  3CCU A;  4XAX B;  1N8R U;  3CCQ T;  4BE2 A;  2MWP A;  2XU8 A;  3M59 A;  1KQS A;  2JTM A;  2LRQ A;  3QZ9 B;  3VUB A;  3CPW A;  2DIQ A;  4IUU A;  4Y28 E;  4E7I A;  4HT9 A;  2KK4 A;  4C5G A;  3ZEH A;  1MHN A;  3M9Q A;  2QEX T;  1O9S A;  5EG2 A;  3DLM A;  4C5I A;  3PNW C;  4R55 A;  2FB7 A;  2ZPH B;  2CZ7 B;  3UPU A;  1YJW A;  1K8A C;  2ZCF B;  3LH0 A;  1ZHI A;  2G3R A;  5CCA A;  2GQV A;  2BUD A;  2EAY A;  2EJG A;  3A8L B;  5DLQ E;  1B34 B;  3UWN A;  2EQJ A;  3CC7 A;  1Q86 U;  1NJI C;  4ATO A;  4M7A E;  2L89 A;  3OQ5 A;  4RCC A;  4IUR A;  4MMK A;  1N27 A;  4B9X A;  4ZGE B;  3CD6 A;  2LTO A;  3TCJ A;  4E47 A;  2D0Q B;  3OYY A;  2D9T A;  4LD9 K;  5M9O A;  1BKB A;  3A8O B;  3SFM A;  4C92 G;  4M78 E;  4M78 D;  4F7U A;  1G5V A;  4M7A D;  2HNI A;  4LD6 A;  3SWN A;  4M7D G;  3RMS A;  4BD3 A;  4HCC A;  1VQ6 A;  5CIU A;  2ZPE B;  2FHD A;  1FWZ A;  3VJP A;  2XDP A;  1XQH A;  3E19 A;  2MAM A;  3HFO A;  2QQS A;  2CS7 A;  1KC8 U;  2ZPF B;  1PSE A;  2DKG A;  3HFN A;  3QO3 A;  1JB0 E;  3TU4 K;  3QII A;  1WJR A;  3CC2 T;  3OS2 A;  4N4H A;  1YCY A;  2YLC A;  2F5T X;  4BI4 A;  2LCL A;  2B8A A;  1KQS S;  2RB6 A;  3MEA A;  3GIB A;  3HHT B;  4FT2 A;  5GMK e;  1LNX A;  1BI0 A;  3QZ5 B;  4Y91 A;  2QXF A;  2IVW A;  3P8D A;  3CPW S;  3CC2 A;  3OBY A;  1BI3 A;  2L8D A;  3MET A;  2A7Y A;  3GF5 A;  5FU7 B;  3UT1 A;  4N0A C;  3S3M A;  3C12 A;  2XD0 A;  3QHS A;  5DLO A;  2JOY A;  3OYK A;  5GMK l;  4JRI A;  3OS0 A;  4EMG A;  3V8L A;  2XG8 D;  2WSE E;  3QYH B;  5AYF A;  4BY6 B;  5CO7 A;  5I21 A;  3OS5 A;  4FIB A;  4ELY C;  3FRN A;  5DM7 R;  2MF2 A;  4OMF B;  4MML A;  5LJ3 h;  3VYH B;  3OYL A;  2HQE A;  3OYG A;  3G6E T;  2VC8 A;  3JCM P;  1RI0 A;  4HT8 A;  3OYF A;  2RO0 A;  2RJE A;  4C0D B;  2OTJ A;  5LJ5 d;  3X20 B;  4JS4 A;  2LQK A;  3OA6 A;  3LWI A;  1M1K U;  3V8J A;  3RKW A;  4M78 B;  2XDB A;  1G3T A;  3PMT A;  3G4S T;  4PKC C;  2WAC A;  3EFR A;  3MP6 A;  3JB9 D;  1VQO T;  3MEU A;  1JJ2 A;  2V8I A;  1BI1 A;  1X01 A;  2QI2 A;  4J8O A;  4Z02 A;  5IAY A;  1Y96 B;  2KY9 A;  5HK3 A;  3X24 B;  3JB9 I;  1TH7 A;  2E1H A;  2RJF A;  5CQX A;  4A54 A;  3DLL A;  1YI2 A;  4QVZ A;  2K5I A;  3VKI A;  1Q82 C;  4M7D A;  3VUZ A;  1YJ9 A;  4FSX A;  3QJ6 A;  4XU0 A;  5LJ5 e;  3JCM Q;  2C06 A;  1GXI E;  2O4X B;  4PJO C;  1ZBX A;  4M75 G;  3CCE A;  3HRT A;  5LJ3 f;  4JUV A;  1S72 A;  2RM4 A;  4II1 A;  2EQM A;  3M56 A;  3UDC A;  1N8R C;  2KMT A;  3M57 A;  5GAN 4;  2JTF A;  3CCV A;  4MDW A;  4RG2 A;  2IG0 A;  1NE8 A;  4C8Q C;  5GAO q;  2JZ2 A;  2F5K A;  3G71 A;  3RES A;  1OZ2 A;  2K2V A;  1WGS A;  2OAU A;  4XTX A;  2EJF A;  3FC3 A;  4DOV A;  1FX7 A;  3JCM X;  4D6W A;  3M5A A;  5A2Q E;  4V2S A;  4X34 A;  4L59 A;  4BUG A;  2PUK B;  4A53 A;  5I2S A;  1M8V A;  2DAQ A;  4XTU A;  5GMK h;  5CR2 A;  5GAM h;  1UGP B;  3C95 A;  1RL2 A;  3JRZ A;  3QUI A;  1Q86 C;  1KQ1 A;  2PVG B;  1B34 A;  5HK0 A;  3A8G B;  5FRN A;  3OYA A;  3CPF A;  3JCM V;  3GNG A;  4EMK B;  4C92 F;  1VQ7 T;  1MGQ A;  4M7D F;  3FLG A;  1UGQ B;  4L6V 5;  3HL8 A;  4LDU A;  1I81 A;  3M53 A;  3P8H A;  3QBY A;  3CMA T;  4J6Y A;  3CCS T;  3CEY A;  3HKS A;  4PJO G;  2KAF A;  4BAC A;  3BY7 A;  2K57 A;  4IUT A;  3CCM A;  4JRK A;  3RKY A;  4ZTF A;  3NFC A;  1JJ2 S;  3CCU T;  1QP2 A;  3V7R A;  3HPW A;  3AHU A;  4PLL A;  1KC8 C;  3PGG A;  3HP9 A;  1YBY A;  4F7U G;  4C8Q G;  4C92 C;  1BIB A;  5GAM f;  2ZZD A;  2PVD B;  4BI8 B;  1KHC A;  2RHZ A;  4M7D C;  2P0Q A;  3H8Z A;  4IKF A;  1U1S A;  2LDM A;  4M77 F;  2LX9 A;  3HSB A;  5D6X A;  3LX7 A;  1YJW T;  3S6W A;  3G7Z A;  4QQG A;  3JCM W;  5LJ3 j;  1WJQ A;  1VQ8 T;  1VQN A;  3MO8 A;  3RKX A;  3ASK A;  4FT4 A;  4CI0 C;  1M1F A;  5LJ5 h;  4E7H A;  3PFS A;  5J3B A;  2LNV A;  4MZM A;  3CC7 T;  2RJD A;  2DK3 A;  4ZGJ B;  3CBO A;  2R57 A;  4NL2 A;  2BKD N;  2LT4 A;  3CD6 T;  3CC4 A;  1XNI A;  2EWN A;  2QQA A;  5CKB A;  1UGR B;  5LJ3 g;  1VQ8 A;  2CZ1 B;  4M77 C;  2RJC A;  2JN0 A;  4ZN3 A;  3JAM E;  5FRO A;  3OYD A;  4M7A A;  2RI5 A;  1FXX A;  3L1A A;  3NTH A;  4ZTJ A;  2XKO C;  2GF7 A;  3C94 A;  4OF1 A;  1VQ6 T;  4PL6 A;  2DXT A;  5FRM A;  3CBP A;  5CKH A;  1M1K C;  1W2B A;  2M0O A;  1KD1 U;  1VQL A;  1AHJ B;  4NS5 A;  4M78 A;  2EJ9 A;  3QJY A;  3OYE A;  2OTL A;  4KUL A;  2RK2 A;  5GAN h;  2LT1 A;  2RK1 A;  4OB0 B;  5LJ5 f;  4E7J A;  3JSC A;  1N9R A;  3LGF A;  5CKE A;  2HAX A;  1Y96 A;  4PLI A;  4X9C A;  4C5E A;  4HKE A;  2EIF A;  2O01 E;  1YHQ A;  1M90 U;  4M75 F;  3Q1J A;  4JRQ A;  1HXD A;  4RMO A;  3PIO A;  5A0L A;  3OS1 A;  4J83 A;  1KHI A;  1NZ9 A;  3DB3 A;  2O4X A;  2QQ9 A;  3TRE A;  1OZ3 A;  4PJO E;  4BI3 A;  4OB2 B;  5GAN 5;  2E6N A;  5CKF A;  5GAO n;  3OYM A;  3JB9 J;  2QA4 A;  2QQB A;  3OSV A;  5GAM j;  4BDZ A;  2DZC A;  2MMP A;  2GFU A;  3QDR B;  1P92 A;  1G3W A;  1HK9 A;  5LL6 S;  4J6X A;  4IUP A;  2E6Z A;  4L5G A;  3LGL A;  4M77 G;  1UGS B;  4C8Q E;  4M75 C;  5GAN f;  1LJO A;  3JCM d;  2P4T A;  3VYG A;  1DJ7 B;  1Y7X A;  3FJP A;  4OB3 B;  2OTJ T;  1G3S A;  2XHC A;  2DD4 A;  5I2M A;  5GAM g;  3JCM g;  2JNG A;  3MP1 A;  2KQW A;  2VUB A;  2PU9 B;  3N5B B;  4YTL A;  3PIP A;  3LWH A;  3DKM A;  1YJN A;  4A4G A;  4DQ2 A;  1KQ2 A;  2DEQ A;  2HD0 A;  4VUB A;  3FB9 A;  4FM4 B;  3BW1 A;  4JLG A;  4FU6 A;  4IUV A;  1Q7Y U;  4EMK A;  1K9M U;  4PJO F;  2RHY A;  1YI2 T;  2XDD A;  3JCM e;  1W2B S;  2EKO A;  3J80 E;  4XU1 A;  1YJ9 T;  2EQU A;  4Q5W A;  3OYN A;  4XK8 E;  3CCE T;  1M9S A;  4C0G A;  5CK9 A;  4HCB A;  3CCJ A;  1S72 T;  4F7U F;  4C8Q F;  5GAN 6;  1UEB A;  1M4Z A;  4EPC A;  1N9S A;  3RIR A;  1VQP A;  3CCV T;  4M7A C;  2RHX A;  2EYQ A;  4PJO B;  3ER0 A;  4XU3 A;  3G71 T;  4C92 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...