2LRUA

Solution structure of the wnk1 autoinhibitory domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
b'GAMDPQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase WNK1
publication title Solution Structure of the WNK1 Autoinhibitory Domain, a WNK-Specific PF2 Domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 27
structure length 98
sequence length 98
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12202 OSR1_C Oxidative-stress-responsive kinase 1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lruA00
3JSVB 3ZW3A 4AOFA 4B95A 2ZCBA 1E7VA 2N7EA 2KJ6A 2KWVB 2MLBA 2Z0EB 2R2QA 3CSFA 2K8HA 2ZEQA 1RRBA 2MBOA 2DX5B 3ZNID 4MGYE 2NPTB 3GOEA 4I6PA 4MM3A 2MP2A 5HKHA 4AUQC 3IVFA 4AJYB 3DBSA 4TQ0A 2NVUI 2KJHB 4HPMB 4IG7B 2AL3A 1V2YA 4HK2A 3A9JA 2PEAA 3QA8A 2N1WA 1XQQA 2ZVOA 4GN1A 4W9KA 1YQBA 4I6LB 5DPSA 5JHBA 3SDLC 2DZJA 3JVZX 1C3TA 3R7RA 3RULA 3O65B 2G4DB 1KM7A 1YX5B 3A33B 3AU4A 4F1SA 4FADA 4FA6A 3CSTA 5DPWA 1LQBA 3PS6A 2FUHB 1FXTB 2R2OA 2KN5A 1V6EA 2K8BA 4LDTD 4NQLB 3UQBA 5LLIA 2HTHA 2C9WB 5CHFA 3PGEA 2LUEA 1KJTA 3BINA 4KSKC 3K9OB 2KTRA 1WGDA 2OOBB 2XBBC 4HLEA 3AI5A 3PRZA 1R4MI 3VXWA 2M8SA 4OVUA 3R66C 2XK5B 2BKFA 3DBHI 2BGFA 3M95A 2M17A 4DXAB 3NOBA 1VCBA 2O2VA 2G3QB 3WA0A 2J0JA 4DDID 4ANVA 2CS4A 3KYDD 4LCDE 1WR1A 2RR9A 4BKGA 1CMXB 1Q0WB 5FR6A 3ZDTA 1YIWA 4HJKA 2M0XA 4KV2A 3A9KB 5GMVA 2L0FA 2N4FA 4ICUA 2D3GA 2EMSA 4ANXA 2VRRB 3DCGA 3S2AA 1Q1OA 3CF6E 3QHTA 3SD5A 3WAOA 4GDKB 2ZCCA 1XT9B 3U30A 1I35A 4ANUA 2JZZA 1G6JA 3KH0A 5J2RA 4NQKE 1X1MA 2LXAA 4HXDA 5AEKB 5JZEB 1L2NA 1V81A 4N9F4 5D7GA 4GDLA 4HDQA 2MBHA 2KX0A 2L76A 1WXAA 2LWPA 4FHKA 4MH0E 1WJ4A 2KX3A 2BF8B 4GGQA 4DHJB 2MBBB 3L0WB 3IHPC 4IUMB 1TBEA 3VTVA 2O6VD 4EZKA 2WX0A 1OQYA 3A4SC 2KK8A 2O6VA 3GZNI 2JY6A 1TGZB 2WWZA 4TKNA 2NS5A 4BOSC 3KUZA 2D07B 2GBKA 3H6NA 4MEMA 4FHJA 5C23A 4EZJA 4ASWC 4RMAA 1WJNA 2DYMA 4KDLB 5G2NA 4IM0A 3M62B 1E90A 2REXA 2KLGA 2FIFA 4IC7B 5CX3A 3V6EB 2KWUB 2YVCA 5JHAA 2DYBA 2J7QB 2Z59B 2MSED 1XD3B 3EFUA 1Z2MA 3JSVA 4KIKA 2DZKA 5E6PA 4XC2A 4TQ1A 2KC1A 3DDCB 3PPAA 2JXXA 5E6OA 3RT3B 3X0WA 4ANWA 4KSLC 4M8MA 2L05A 2J0MA 2KKCA 3PLUA 2LRWA 3BY4B 1WJ6A 2NPTA 3PLVA 3QWZB 4EKUA 4A3PA 5LXHA 1L7YA 1OTRB 2K1FA 3AXCA 2IO3B 2IO2B 4IWPA 5CHWA 2ZVNA 2FCQA 2GBJA 2KDIA 4NPNA 4WWPA 1IYFA 4FJZA 2I1JA 1S3SG 3ZLZA 2MCNB 2W9NA 1H8CA 2NCNA 3ML8A 4W9GA 4NAWA 3SHQA 1A5RA 3KUCB 1WMHB 1VD2A 3PV1A 3PRMB 4KDIC 2FNJB 4W9HA 3ZRFA 3VVWB 2MBEA 5G55A 2ZZPB 2BPSA 3HHMA 3RCZA 3PTFC 4CHKA 3AU5A 1V80A 2NBVB 2RGFA 2KMAA 4W9JA 4DDGD 1LFDA 2KFKB 4PS7A 1TTNA 3H7PA 3SU8X 3VDZA 4K7SA 4M0WB 1WRDB 2CHXA 4BKTA 1SGHA 1OGWA 4EOYA 3TIXA 1EF5A 2DZIA 1WFYA 4IWQA 4HPLB 4F8CB 2UWQA 4GXBA 1WIAA 3VQIA 2KQ7A 4GB9A 3P2BA 2XEWA 4FBJB 3NZUA 4WWNA 3DOWA 2PE6B 2FIDA 1JRUA 1P1AA 3A9KA 3ENEA 2WX1A 1E8ZA 4DHZE 4ZYNA 2RSUA 5J17A 1ISNA 1V5TA 3VAWA 2FAZA 3AULA 1RFAA 2EMTA 5IAAC 2AYOB 3NHEB 3UF8A 4RM8A 3IG3A 3DQVA 3PHWB 2DHZA 5KHOA 2RPQA 3ZVVA 1WF9A 3QQ8B 3A1QB 2JRIB 3RD2A 3W1SC 3V61A 4HCNB 4MSQB 2LVOA 2D2QA 3ZNHB 3PZDA 2KDEB 4W9EA 3ZRCA 3ECIA 4BKSD 1P9DU 3KYCD 4DHJD 2BWFA 3VHTC 4BKSA 4GMVA 2D11A 3V6CB 1GJZA 4EUTA 3IBEA 4FLHA 4JIOU 2JUOA 3NZSA 4AJWA 5C1ZA 2K6QA 1P3QU 1ZKHA 2FCSA 3QJZA 4JGHB 4MELA 4B9KA 3L54A 4K81A 2LJ5A 3DVNU 4PS3A 3K9PB 2MWSB 1E8XA 2QHOA 3TJPA 1EO6A 2DYOA 2IY1B 3PHXB 4PYUA 3WAMA 2BYFA 3VUXA 4IW0A 3QX1A 4W9CA 2K6DB 3A9JB 3WANA 2GMIC 2LVQA 3OJ3A 3DVGX 4XX5A 4A3OA 4MDKE 3VUYA 3I3TB 3ZDMC 4CO7A 2GBMA 2CHZA 4CYEA 4ZRKA 4A20A 2A5UA 3HK0A 3OLMD 1WE7A 4JQWC 3TMPB 4TV3A 1WGYA 2JRHA 4G11A 1UBQA 2MW5A 2N9EB 1PQSA 1YJ1A 2LI5A 1UBIA 1WI0A 2G4SA 4WQOB 2L7RA 3ZIMA 3U7DA 3TCAA 1U4AA 3W1SA 2IZVB 4LJOB 3QK0A 1SIFA 3TL5A 4URKA 2C7MB 3DVGY 2JZ3B 3RZWC 3OAWA 3ZKJC 2MBQA 2LGXA 1RLFA 4GIVA 3UQAA 4ZRIA 2AL6A 3H1UA 3QARA 4WWOA 3EC8A 2C5LC 1J0GA 1UZXB 4DWFA 2A4ZA 3Q3FA 5D6JB 5L83A 3Q3JA 3VUWA 4IWOA 2IO1B 4KZCA 3V60A 2LD9A 3RYTA 2CR5A 1WMHA 3NY5A 3B0AA 1WXSA 4G50A 2JT4B 2ASQA 3WIMA 3ZTDA 4E3CA 3APCA 3M3JA 4F7ZA 3H9DA 4FULA 1D3ZA 2N1VA 4GU2A 4RM9A 5AZGA 2KVRA 1IPGA 1KLVA 3N3KB 5DCNA 1WGHA 1NDDA 2JVCA 4B6WA 2C7HA 2KFKA 2BWES 1H4RA 1R4NI 3L08A 4E71A 1LXDA 3QAQA 1E7UA 3VH4B 1F9JA 2IO0B 3A4RA 1T0YA 1WM3A 1V9JA 4XZ4A 3T8MA 2V4LA 3UINB 2CHWA 3ZUNA 3JYUA 1WJUA 1K8RB 1OEYJ 2KD0A 2PPHA 4M8NA 3LDZE 5CHVC 3R7QA 2B3AA 1M94A 1WXVA 2LASA 2ZPYA 1V86A 4MSMB 3HM6X 1UH6A 3D32A 1Q5WB 2O6VB 4HWIB 1HE8A 3VTWA 4EEWA 4WJQA 3UIOB 2LZ6A 2BYEA 1C1YB 1P0RA 2L8JA 2JPHA 5L95C 1NI2A 3ALBA 2AWTA 2KJRA 2WDTB 3MTNB 1WZ3A 3A1QA 4II2B 2LGDA 3RUIB 4K7UA 2YLMA 3N30A 4K7WA 5EDSA 3MHSD 2EKEC 3DPDA 2ZNVB 2XK5A 2FCNA 3N32A 2PE9A 4KIKB 2DAFA 1WX8A 1GG3A 3DVNV 3M63B 2L0TA 2PJHA 1E8WA 4BBNF 2JWZA 2OJRA 5D94A 2G45B 1WY8A 2ZJDA 4BVUC 1IP9A 3JW0X 4MJSB 2Y5BB 2KDFB 2DENB 2L3ZA 2M4NA 2UYZB 2CU1A 4NY0A 5CTRC 1WX7A 2L00B 1Z5SB 4GDKA 2KANA 2KZRA 4FJYA 2NBWB 4J6IA 4FN2A 2MA9B 2KWCA 3ZTCA 2KXJA 1WGGA 1WXMA 3R3MA 4DBGA 1WYWB 1P98A 3L13A 4TUUA 2KDBA 3HIZA 4AP4C 2LVPA 3PRPB 2GOWA 4NAWB 5J18A 2KOXA 1WGRA 3HM3A 3ML9A 3PSEB 3APDA 4E74A 2JF5A 1UD7A 1YD8U 4ZRJA 3OJ4B 3T9LA 2IBIB 5LXIB 5KHQA 3ZNGC 4NJ7A 3UGBB 3NS8A 1GC6A 1WZ0A 2KO3A 2KNBA 2MP2B 2MQJA 3L17A 4WJPA 2KLCA 3H7PB 4PYZA 4EFOA 4HVBA 1J8CA 1GUAB 1GC7A 2Z0DB 3V62A 2GBRA 1SE9A 4YL8A 1WM2A 2HE7A 1S1QB 2K8CA 2NR2A 2ZNVC 1OEYA 3L16A 2N9PC 4MGIE 3VH3B 2KQSA 4AWJA 2K25A 2M1MA 2HJ8A 5AZFA 1J19A 5BO4B 4ZDVA 3KVFB 2LXCA 4BBNC 2ZPNA 3C0RB 4LDTB 3PVLA 3DBLI 1Y8RC 2V1YA 2BKRB 3WAPA 2KHWB 2HD5B 3VFKA 2KTRB 2NBUA 2DAJA 1UGMA 4W9LA 2MRPA 1EF1A 5E6NA 4GOCA 4WJOA 1V49A 3QCAA 1WH3A 3MJWA 2WYQA 4W9IA 3H7SA 2O2VB 4FJVB 4II3B 4PS8A 1WR6E 2N9XA 2GBNA 1I42A 1WE6A 4I6NB 1BT0A 4G3XB 1E8YA 2DZMA 4JL9A 4NJ6A 2IY0B 3U8ZA 1RAXA 1YX6B 3B1LX 3ZNZB 2KFJA 1MG8A 3CMMB 4HDOA 4OVVA 4X57B 2AEHA 4IM2A 2MX2A 4K1RB 2J0KA 4NNJB 3VTUA 1UELA 4BOZB 2CKHB 2C60A 2D10A 1TZ1A 3KUDB 3ZO5B 2LRUA 3QIJA 4JLCA 5DPRA 3IFWB 2KTFA 5JH5C 5IA7A 5DPTA 2LGYA 4GDLB 3L10B 3ONSA 1E5WA 3WALA 1QZEA 4KVGB 2BYVE 2KC2A 4MGKE 1ZGUB 3QC8B 4G0NB 4IM3A 4P7IA 1KOTA 4MGZE 2RD0A 4DHZB 3DBRI 2FCMA 4ICVA 4MJSA 2C7NB 2V3SA 3X23A 3UIPB 2IYDB 2I1KA 1AARA 4WJNA 3W1YA 3RZFA 5TR5A 4LJPB 4WAAA 1GNUA 3LJ3A 3APFA 2N7DA 3KW5B 5D2MB 3EECA 3PT2B 2KMCA 1LM8B 1WX9A 3PREA 3B08A 1V5OA 4DK5A 1NBFC 3TBLD 2K39A 4W9FA 3EHVA 5AZHA 4EZLA 4KZ0A 4BFRA 4GSWA 1EUVB 4HCPB 4W9DA 1ZW7A
chains in the Genus database with same CATH superfamily
3JSVB 4WH4A 4AOFA 2ZCBA 3ZJUA 3ZNID 2DX5B 4Q2JA 5HKHA 3IVFA 2KJHB 3GZNB 3A9JA 2PEAA 2N1WA 1XQQA 4W9KA 5JHBA 5DPSA 1YQBA 4I6LB 2WGSA 3CSTA 3PS6A 2FUHB 3MC0B 4LDTD 3PGEA 2LUEA 1KJTA 3IXSA 3K9OB 2QDFA 2KTRA 2OOBB 2EKIA 1N5WA 3RPFC 2I2YA 4OVUA 3R66C 3Q3NC 3DBHI 5IOIA 1FFUA 4DXAB 1VCBA 2G3QB 2J0JA 4DDID 4ANVA 1FPYA 4LCDE 2R61A 3ZDTA 3AEFB 1WGKA 2D3GA 2EMSA 1SB3C 4XE0A 1EWCA 3SD5A 3WAOA 2ZCCA 3KH0A 4WIPA 3ZXRA 3U52E 3BIID 1L2NA 5D7GA 4HDQA 2W3RA 1XF5L 3R2IA 1TBEA 1QT9A 1I4QA 2O6VD 4KGTA 1FFVA 3N9YC 4EE2A 2O6VA 1T0RC 4TKNA 2NS5A 2QIEB 2KN4A 1L4DB 3H8HA 2D07B 3H6NA 5C23A 1VLBA 5G2NA 2JSVX 2REXA 2FIFA 3V6EB 3I63C 2DYBA 2J7QB 2Z59B 1K50A 5E6PA 2DZKA 2WXNA 4ZYSA 4TQ1A 3DDCB 1E7PB 1L0XB 5MPOA 2LRWA 4EKUA 1L5PA 4A3PA 1AWDA 1I4HA 1OTRB 2INNE 1WSPA 3NG0A 2N7JA 5CHWA 4ZRPA 2GBJA 2I1JA 3AE4B 2W9NA 2NCNA 3KQ4A 3ML8A 1A5RA 5IP4D 1WMHB 1VD2A 3PV1A 4KDIC 2FNJB 1FRDA 4W9HA 1DOXA 2N9KA 4YT0B 2FUG1 4IKGA 3W2DA 3RCZA 2NMQA 3AU5A 2KMAA 2KFKB 4PS7A 3TEXA 4K7SA 4M0WB 5EE9A 1N63A 4EOYA 1P7EA 4IWQA 3NVZA 3BK2A 2XEWA 4WWNA 1SXTA 1I7HA 1XCQL 5GXGB 2FIDA 1FCLA 3A9KA 2MJDA 4HEA1 2V3NA 4DHZE 1ISNA 1V5TA 3SEBA 3VAWA 1WF9A 3Q14C 2JRIB 2SEBD 2D2QA 4N59A 4TMAB 3ZRCA 1D5XC 3ECIA 4DHJD 3BZDB 3IBEA 4L23A 2K6QA 4B9KA 3QJZA 4MELA 3L54A 3DVNU 4PS3A 1ENFA 4C4VB 3Q3MC 2QHOA 4PYUA 3WAMA 3Q3OC 1D5MC 1PUTA 1T3QA 3DWMA 4W9CA 2MH7A 3B2GA 3A9JB 4A3OA 3AEDB 4CO7A 4ZRKA 4A6QA 2A5UA 4L1BA 4JQWC 4G11A 1FNWA 1WI0A 2WHIA 1CZPA 3TCAA 3W1SA 2IZVB 2LHEA 4LJOB 2V0GA 1JWAD 4URKA 3DVGY 5BYSA 3OAWA 2MBQA 2GB1A 3UQAA 2LHDA 2OHFA 3EC8A 4P16A 3Q8FA 1UZXB 3Q3FA 2WU2B 2MHJA 3RYTA 4G50A 3I9V1 1EU3A 3U7ZA 2ZW0A 4MACA 1QOGA 2N1VA 4RM9A 3HUIA 1K51A 4B6WA 1K52A 1NDDA 2BWES 2UU7A 4A8XC 1F9JA 1YN5A 1WM3A 3UINB 2CHWA 3JYUA 1OEYJ 4M8NA 3R7QA 2WDVB 1V1PB 1V86A 2O6VB 2KT7A 1P0RA 3TEWA 4II2B 3MTNB 4K7UA 2PLPA 3N30A 4K7WA 5EDSA 3RFZB 1CJEA 3DPDA 2XK5A 2FCNA 2W3SA 1GG3A 3DVNV 1YQ4B 2L0TA 2PJHA 3P4PB 3NVYA 1SJHD 3T3OA 2ZJDA 3JW0X 5HG2A 1J7CA 4ZOHC 1XO3A 4M02A 4GDKA 2HJ1A 3NVVA 2KANA 1QOFA 2MA9B 2KXJA 1MG4A 4H2AA 1P98A 1HA5A 4TUUA 2KDBA 3PRPB 4L2YA 3P1MA 3VR8B 3ML9A 1NYQA 4ZRJA 3BYYB 1HTQA 5KHQA 4KGSA 3UGBB 1GC6A 4WJPA 2WDRB 4HVBA 2NTSA 2GBRA 1VZ8A 4P1BC 1S1QB 2K8CA 2NR2A 4MGIE 4HRSA 2KQSA 5EE1A 2K25A 2M1MA 2HJ8A 3OWEB 2LFIA 1UGJA 2BKRB 3VFKA 2W82A 3FC4A 3NVWA 1KLUD 2IPKD 3HVDA 4WJOA 1WH3A 1ZXHA 2WYQA 1I4XA 4II3B 2N9XA 5BMGA 4I6NB 4YTPB 1BT0A 2DZMA 4NJ6A 3Q8BA 4JL9A 2IY0B 2WXOA 1DOIA 3IT6B 3TEZA 2KMMA 4ZHPA 2B76B 1I4PA 4IM2A 3VTUA 1NENB 2D10A 1TZ1A 3KUDB 2QCZA 2D3CA 1QF6A 3L10B 3ONSA 4HPPA 5BYQA 1E5WA 1QZEA 1TKYA 4KVGB 4MGKE 4KX6B 1T6BX 1C78A 4D2KA 2V3PA 4ICVA 1I4RA 4USAA 4WJNA 3W1YA 4O1NA 1QOBA 4LJPB 3PT2B 1WX9A 1V5OA 1UWMA 2K39A 5AZHA 3EHVA 3SFDB 4BFRA 1IGCA 1ZW7A 4S17A 4A55A 3ZW3A 5D3DA 2MLBA 3CSFA 1FNVA 1RRBA 3MJ5A 2NPTB 4I6PA 2CU3A 4MM3A 2MP2A 4AJYB 1WYGA 1EM7A 2BYTA 3E9SA 2CJOA 2ZVOA 4JE3B 2DZJA 1C3TA 3O65B 1SJED 3AU4A 3KWVA 3A33B 5DPWA 1LQBA 2R2OA 2JQRB 2MEKA 4NQLB 5LLIA 2QC8A 5I4DA 3BINA 2W54A 3AE2B 1TKGA 5BMIA 4HLEA 3PRZA 3VXWA 2M8SA 3BK1A 3IAM1 2XK5B 3M95A 1R4NB 2M17A 2CS4A 1SBBB 3KYDD 2RR9A 3LYYA 1Q0WB 2WXHA 4HJKA 2M0XA 1PYWD 3BVMA 4ICUA 3DCGA 2YEPB 4GDKB 2AQ1B 2PTLA 4NQKE 2LXAA 2WXMA 1KH0A 2J42A 4CQNA 2G1EA 4MH0E 4FHKA 1NYRA 1WJ4A 2IGGA 3DHIC 3VTVA 1TS5A 1OQYA 5HHDG 2D5GA 4YSXB 4IOIE 2ICIA 2VH2A 2MJEA 3NUHB 4FHJA 1YJIA 1HEZE 1ROEA 1QOAA 2WDQB 4WQMA 1JWUD 5CX3A 3BYTB 4IC7B 3EFUA 2DWQA 2JXXA 1P7FA 5E6OA 4ANWA 4KSLC 4M8MA 2L05A 2WQYB 2WXKA 4P1CC 3BY4B 3QWZB 2BBCA 3V05A 4C56C 5LXHA 1L7YA 3W5VB 2IO3B 2IO2B 2ZVNA 2N0SB 4NPNA 1IYFA 4C7ZA 1S3SG 3ZLZA 2MCNB 1XCTL 4W9GA 4YTMB 1AW7A 2Z8LA 4KGRA 2MBEA 2ZZPB 4RFBA 1XXGA 4CHKA 2ONQA 2NBVB 4W9JA 4DDGD 3VDZA 3RN9C 3SU8X 1F2RI 5G5HA 2CHXA 4XYCA 4GXBA 2L52A 4FBJB 1OQRA 2WP9B 1JRUA 5G5GA 2WX1A 1K53A 5IN7A 4ZYNA 2RSUA 5J17A 2M0AA 5JXVA 5EE3A 2EMTA 5IAAC 2AYOB 4RM8A 3WCQA 2DHZA 1JWMD 2E6XA 3QQ8B 1N6ZA 3A1QB 4WWMA 3PZ8A 2LVOA 4W9EA 4BKSD 1P9DU 3KYCD 3IAS1 3Q2AC 4BKSA 4GMVA 3V6CB 1GJZA 4XDDA 3NZSA 1P3QU 2VH1A 1I4GA 2LJ5A 1ZXIA 3K9PB 2WXJA 2MWSB 1E8XA 2WXFA 3TJPA 3DBRB 4JPSA 2K6DB 2K3UA 3OJ3A 2GBMA 3HK0A 4WURA 1T0SC 1WGYA 3W5UB 1N62A 4AQ7A 2GLSA 1PQSA 1YJ1A 4RGNA 2LI5A 1UBIA 2G4SA 1VJKA 3RI7C 4WQOB 3MC8A 3CIRB 4OZAA 4OVZA 1NVID 1IGDA 4REZA 1A70A 2JZ3B 3ZKJC 3RNGC 1NEKB 1RLFA 4ZRIA 3QARA 3AE7B 4WWOA 2C5LC 3LXFA 4DWFA 2IGDA 3VUWA 3ZQ4A 4IWOA 2IO1B 2LD9A 3WIMA 2CR5A 4E3CA 2ASQA 3M3JA 3AH7A 5AZGA 3AN1A 1IPGA 3N3KB 5DCNA 1WGHA 1R4NI 3J9CA 2GRIA 2JX5A 2JYTA 3P4RB 2IO0B 3A4RA 2V4LA 1TS2A 2KQ4X 1DYQA 4LNKA 1C4AA 1M94A 3AEGB 2ZPYA 3EUB2 1YQ3B 3HM6X 5HI1A 3P63A 1QILA 2LZ6A 2BYEA 1FIQA 2JPHA 1NI2A 3NRZA 1C76A 2AWTA 1D6EC 2KJRA 2WDTB 4RNAA 2RDBC 2ZNVB 2LEKA 1WX8A 3M63B 1E8WA 1C4PA 2DBYA 3C19A 4BVUC 1IP9A 2KDFB 2D3BA 1PGBA 3BVGA 1CQVA 1Z5SB 1MJDA 4FJYA 4J3OD 3MHZA 2G9HD 4J6IA 4FN2A 2KWCA 3RNCC 1WXMA 4C7YA 1WYWB 4LNOA 1VR9A 2BB6A 3CWIA 1N60A 5J18A 3BWUD 3HM3A 3PSEB 3APDA 4E74A 2JF5A 3T9LA 2IBIB 5LXIB 4LK0M 4M01A 1GB4A 1RYJA 1WZ0A 1GAQB 2KLCA 1J8CA 1XLNA 2QJLA 1GC7A 2Z0DB 3Q8AA 3V62A 4YL8A 1WM2A 1E0ZA 2Y5PA 3L16A 1OEYA 4JWUC 3KWLA 3VH3B 1V8CA 1L6UA 1TS3A 4LDTB 4S0RA 3URYA 3AE5B 1XLPA 3TEYA 1ZDVA 3B9JA 3WAPA 2HD5B 4N58A 2KTRB 1UGMA 1RWSA 1V49A 1Q10A 3H7SA 1C79A 3R8BA 1HZ6A 3VRBB 3NZ3A 3N1XC 2BVCA 1MG8A 2KFJA 4JX1C 1C9FA 3U2SC 1UELA 2LJIA 2C60A 2I38A 4JLCA 1M4VA 2LGYA 3E56A 2BYVE 3QC8B 4G0NB 4IM3A 3T3NA 4MGZE 3DBRI 3GP7A 2FCMA 4MJSA 2V3SA 3UIPB 1AARA 3RZFA 1Y56A 2W55A 3EA6A 3EECA 1ET6A 3PREA 1TKEA 1AN8A 2K9XA 4GSWA 1EUVB 5IA7A 4OW0A 1F2RC 1JW9D 4B95A 2N7EA 2R2QA 4LNIA 4WAFA 2K8HA 2INDC 2ZEQA 3AEEB 1WRIA 4MGYE 4TQ0A 3DBSA 3BVZA 3FAHA 2NVUI 4HPMB 2N9LA 4IG7B 2AL3A 1V2YA 3SDLC 3RULA 2G4DB 3Q8EA 3SR6A 1FXTB 2KN5A 1V6EA 2K8BA 4NAMA 2HTHA 3AEAB 3DWGC 1QKZA 2C9WB 3FKYA 1WGDA 2ACZB 4US8A 1F0ZA 1R4MI 1JWBD 1VDVA 2BKFA 4XGAB 2O2VA 3WA0A 1PDXA 2L32A 4BKGA 2J53A 1J7BA 3A9KB 5GMVA 2Y3AA 2VRRB 3S2AA 1Q1OA 3CF6E 2DNFA 4YWGG 3GS2A 1XT9B 3U30A 4OZBA 4ANUA 3RNAC 2JZZA 1G6JA 5J2RA 3IT4B 3Q69A 1X1MA 1VRAB 2L83A 3NJTA 1V81A 4GDLA 2MBHA 2KX0A 2LWPA 2BF8B 4GGQA 4DHJB 2MBBB 3L0WB 3IHPC 4RGTA 1FNUA 4ZHOA 2WX0A 2KK8A 2V9HA 1ACCA 1TGZB 2JWUA 2LGIA 4BOSC 3KUZA 2GBKA 5IO9A 4EZJA 5T8IA 4ASWC 4RMAA 4KDLB 1MFWA 4IM0A 3M62B 1E90A 1RM6C 2YVCA 5JHAA 2K5PA 1Z2MA 3JSVA 2Q5WD 4OHJA 1MHHE 3PPAA 3RT3B 1IBXA 3N1ZC 3RNEC 3HVZA 2E3TA 1WJ6A 1QQRA 2K1FA 2HTME 3AXCA 1R7SA 4UDUC 4WWPA 1T0QC 2M19A 4NAWA 3SHQA 3NS1A 3VVWB 5G55A 2BPSA 3VRAB 1FCCC 1F1HA 1TTNA 1E9MA 1FXIA 3RMKC 1WRDB 1SGHA 2Y5CA 3DBLB 1EF5A 1WFYA 3AEBB 3DHHC 4F8CB 2UWQA 2KQ7A 4GB9A 3DOWA 3B2FA 1P1AA 1E8ZA 4RGOS 2K22A 4BAXA 2FAZA 3AULA 3NHEB 1TT5B 1V1OA 3IG3A 2WLBA 5KHOA 1ZE3D 3LB8C 4HJGE 2RPQA 3ZVVA 2AQ3B 3RD2A 4HCNB 2BS3B 4MSQB 2KDEB 2WXQA 1AYFA 1SE4A 1GOZA 3FILA 1KRHA 2BWFA 4K3BA 3VHTC 2D11A 4YSYB 4EUTA 4JIOU 1E6EB 2JUOA 3ABVB 5C1ZA 1ZKHA 4JGHB 1JWSD 1T5XD 3C8YA 3TUOA 3AE1B 3ETRA 3PHXB 2BYFA 1SEBD 3MP9A 3WANA 2GMIC 2LVQA 4XX5A 3DVGX 2QSDA 4MDKE 2CHZA 4CYEA 3OLMD 1GPXA 3TMPB 4TV3A 4A9AA 2MW5A 2QMTA 2RMMA 2LUMA 3U7DA 2HDEA 3QK0A 1SIFA 2C7MB 4HKQA 2GI9A 3AB5A 2AL6A 3H1UA 2RDGA 3GB1A 4LNNA 1J0GA 5D6JB 4ARCA 1MPEA 5L83A 3Q3JA 4KZCA 4M00A 3ZTDA 1WMHA 3APCA 4PT5A 3H9DA 1IUEA 4FULA 1D3ZA 4GU2A 2BW2A 1KLVA 5JH5C 2C7HA 2KFKA 2MJ3A 4E71A 3L08A 4C00A 3ZJTA 4M0WA 3QAQA 1E7UA 3T8MA 3U4EG 1T0YA 1V9JA 2IGHA 1K8RB 2KAJA 5CHVC 1TJEA 1WXVA 2LASA 5FKAC 4B0MA 1Q5WB 4HWIB 1HE8A 4HROA 4EEWA 4WJQA 3UIOB 2OJWA 1C1YB 5L95C 1ESFA 3ALBA 2LGDA 3RUIB 2YLMA 1PFDA 3N32A 1YN4A 3TSSA 1JQ4A 1IBXB 1SSNA 2OJRA 4LTUA 5D94A 1WY8A 3EFCA 1CK1A 2DENB 2KDMA 2UYZB 2CU1A 4NY0A 4C4VA 5CTRC 1WX7A 1QLBB 4A90A 4LLGM 1BUIC 1STEA 1MHXA 4IDIA 1ZOYB 1WGGA 1FO4A 1FMAD 3L13A 4KKJA 3HIZA 2LVPA 4NAWB 2KOXA 2AX5A 3ZJVA 1UD7A 5AUIA 1BXTA 4QAYA 1TZOA 1TY0A 4NJ7A 3AE6B 1BMLC 2JXTA 3NS8A 4MM3B 2MP2B 2MQJA 3MC9A 4PYZA 5H8YE 1KF6B 2PW9A 1YMHE 1SIJA 4DQOC 2ZNVC 2RDHA 2J52A 3PO0A 5E6JA 4AWJA 2IDYA 3Q6BA 2JZPA 1J19A 1UF0A 4KKIA 3KVFB 2LXCA 5BO4B 4BBNC 3C0RB 1XLQA 3DBLI 1FRRA 2KHWB 2TSSA 3AM9A 2ON8A 5E6NA 1TY2A 4GOCA 3QCAA 3FILB 1SE2A 1WR6E 3AV8A 1V1PA 2GBNA 1WE6A 4G3XB 3U8ZA 1FEHA 1YX6B 3ZNZB 4RGMA 2AEHA 2MX2A 4NNJB 4TSSA 2ZW1A 3ZO5B 3QIJA 1L6VA 5DPRA 1OFFA 2DLBA 4XDCA 2KTFA 1B1ZA 4N6EB 5DPTA 1MVKA 3WALA 2WS3B 1R4MB 1JMLA 4AS1A 5IKCM 3X23A 2IYDB 2I1KA 1B9RA 5TR5A 2SAKA 1GNUA 3APFA 3VR9B 3B08A 1NBFC 3TBLD 5H92C 2RPVA 4YSZB 4OZCA 1E7VA 2KJ6A 1L0VB 2JU6X 2KWVB 2Z0EB 4ACFA 1JROA 3L4PA 2MBOA 1UUPA 3GOEA 5FK9C 2BQQA 4AUQC 1HQRD 3I5JC 4HK2A 3QA8A 4GN1A 3JVZX 3R7RA 3N1YC 3AE9B 1KM7A 1YX5B 4FADA 4F1SA 4FA6A 3RNFC 4ZRQA 2QILA 3R2TA 3UQBA 4DXFA 5CHFA 1VZ6A 4KSKC 1XLOA 2XBBC 3AI5A 2WU5B 2BGFA 1YNTE 3NOBA 5AUKA 3AMZA 1WR1A 1CMXB 5FR6A 1YIWA 4KV2A 2EELA 2L0FA 2N4FA 2YEPF 4ANXA 1TYGB 1DGJA 3QHTA 2WXPA 3RNBC 1I35A 1YN3A 1DOYA 5JZEB 4HXDA 5AEKB 2INCC 1HTOA 4N9F4 2L76A 1WXAA 1JALA 2KX3A 1J7AA 2WNMA 2PMVA 4IUMB 2CJNA 4EZKA 4MH8A 2WXIA 3A4SC 3GZNI 2JY6A 2WWZA 2XN9C 4MEMA 3O13A 4K3CA 1WJNA 2DYMA 3Q8CA 1VZ7A 2KLGA 2KWUB 2MSED 1XD3B 4KIKA 4XWWA 4LNFA 4XC2A 2KC1A 2KACA 3X0WA 2J0MA 2KKCA 3PLUA 2NPTA 3PLVA 1NI3A 4JWSC 4IWPA 2FCQA 2H89B 2KDIA 4FJZA 1YJJA 4P6VF 1H8CA 2K0PA 3KUCB 3ZRFA 2KWDA 3PRMB 2KYWA 3HHMA 1SF0A 3PTFC 1V80A 2RGFA 1LFDA 3H7PA 4BKTA 2XNAC 1OGWA 3TIXA 2DZIA 4HPLB 1PGXA 2VZKD 2LMCA 1WIAA 2QEJC 3I57A 3VQIA 3ZXVA 3P2BA 3NZUA 1D5ZC 2PE6B 3ENEA 2WXLA 1RFAA 4NZLB 3P42A 3UF8A 1ZUD2 3DQVA 3PHWB 1D4BA 3W1SC 4PK1A 3V61A 3ZNHB 3PZDA 5EE0A 2OEDA 4FLHA 4AJWA 3W9CB 3P4QB 2FCSA 4MT5A 1N61A 4K81A 3DHGC 5BYRA 1EO6A 2DYOA 2IY1B 2L1AA 1YOVB 3VUXA 3UI3A 4IW0A 3QX1A 2PIAA 1L4ZB 3VUYA 3I3TB 3ZDMC 4DXGA 4B0EA 4A20A 1WE7A 1KTKA 5D3IB 2BB5A 2PKOA 2JRHA 1UBQA 2N9EB 2BS2B 2L7RA 3ZIMA 1U4AA 2WXGA 1XEEA 3TL5A 3RZWC 3EGRA 2LGXA 4GIVA 1EU4A 3SFEB 1N5XA 2A4ZA 1RFKA 3V60A 1PGAA 3NY5A 3B0AA 1WXSA 2WXRA 2JT4B 3N20C 5C3JB 4FXCA 4F7ZA 2PVGC 4NJCA 1FXAA 4GLSC 2KVRA 4RCOA 1UNSA 2JVCA 3MFGA 1H4RA 3AECB 1LXDA 3VH4B 4XZ4A 4RF0A 1MI0A 5C2TB 3ZUNA 1WJUA 2KD0A 2PPHA 3LDZE 2B3AA 1GB1A 3DBHB 1TS4A 3GE8C 4MSMB 1UH6A 3D32A 3VTWA 2L8JA 3ZYYX 5BMHA 1WZ3A 3A1QA 1SE3A 1WWTA 3MHSD 2EKEC 2PE9A 4KIKB 1C77A 2DAFA 2BTEA 2PVOD 1WXQA 4BBNF 2JWZA 2G45B 5HFYA 1JCKB 4MJSB 2Y5BB 2L3ZA 2M4NA 3P4SB 2FE8A 2L00B 1L0YB 2KZRA 2NBWB 1HZ5A 3OG5A 4C80A 3ZTCA 2INPE 2D3AA 3R3MA 4DBGA 1V97A 1KLGD 4AP4C 2GOWA 1WGRA 3ZGZA 1YD8U 5FR3A 3OJ4B 4US9A 1LO5D 1F52A 2V4IB 4ITKA 3V3XA 3ZNGC 3PZ7A 2KNBA 2KO3A 3L17A 3H7PB 4EFOA 2X8XX 2BS4B 1GUAB 1SE9A 2HE7A 2X38A 1LGRA 2N9PC 2VZKB 1OQQA 2KVZA 3GE3C 2AQ2B 5AZFA 1F77A 1UWXA 3AE3B 4ZDVA 1FM0D 2H88B 2ZPNA 4YXDB 4YTNB 3PVLA 1Y8RC 2V1YA 2NBUA 2DAJA 4W9LA 2MRPA 1EF1A 3MJWA 4W9IA 2O2VB 1TIFA 1HXYD 4FJVB 4PS8A 1E10A 5TSSA 4BZAA 1I42A 1E8YA 1RAXA 3B1LX 3KLSX 2NTTA 4HDOA 3CMMB 4OVVA 4R3DA 4X57B 4K1RB 2J0KA 4BOZB 2CKHB 1ET9A 2LRUA 3IFWB 1ZPSA 1JRPA 2M56B 4GDLB 5LNK1 2KC2A 1ZGUB 4RF1A 4XWTA 3AE8B 4P7IA 1KOTA 2FBWB 2RD0A 4DHZB 4RH6A 1KFYB 2C7NB 1C4CA 1ZP0B 3HRDD 2LGSA 1EWYC 1FD6A 4WAAA 3LJ3A 3KW5B 2N7DA 5D2MB 4HKZE 2JYEA 2KMCA 1LM8B 2J4XA 4DK5A 2IJ0A 4W9FA 4EZLA 2BT6A 4ARIA 1ZDXA 4KZ0A 4HCPB 4W9DA
chains in the Genus database with same CATH topology
3JSVB 3ZW3A 4AOFA 4B95A 2ZCBA 1E7VA 2N7EA 2KJ6A 2KWVB 2MLBA 2Z0EB 2R2QA 3CSFA 2K8HA 2ZEQA 1RRBA 2MBOA 2DX5B 3ZNID 4MGYE 2NPTB 3GOEA 4I6PA 4MM3A 2MP2A 5HKHA 4AUQC 3IVFA 4AJYB 3DBSA 4TQ0A 2NVUI 2KJHB 4HPMB 4IG7B 2AL3A 1V2YA 4HK2A 3A9JA 2PEAA 3QA8A 2N1WA 1XQQA 2ZVOA 4GN1A 4W9KA 1YQBA 4I6LB 5DPSA 5JHBA 3SDLC 2DZJA 3JVZX 1C3TA 3R7RA 3RULA 3O65B 2G4DB 1KM7A 1YX5B 3A33B 3AU4A 4F1SA 4FADA 4FA6A 3CSTA 5DPWA 1LQBA 3PS6A 2FUHB 1FXTB 2R2OA 2KN5A 1V6EA 2K8BA 4LDTD 4NQLB 3UQBA 5LLIA 2HTHA 2C9WB 5CHFA 3PGEA 2LUEA 1KJTA 3BINA 4KSKC 3K9OB 2KTRA 1WGDA 2OOBB 2XBBC 4HLEA 3AI5A 3PRZA 1R4MI 3VXWA 2M8SA 4OVUA 3R66C 2XK5B 2BKFA 3DBHI 2BGFA 3M95A 2M17A 4DXAB 3NOBA 1VCBA 2O2VA 2G3QB 3WA0A 2J0JA 4DDID 4ANVA 2CS4A 3KYDD 4LCDE 1WR1A 2RR9A 4BKGA 1CMXB 1Q0WB 5FR6A 3ZDTA 1YIWA 4HJKA 2M0XA 4KV2A 3A9KB 5GMVA 2L0FA 2N4FA 4ICUA 2D3GA 2EMSA 4ANXA 2VRRB 3DCGA 3S2AA 1Q1OA 3CF6E 3QHTA 3SD5A 3WAOA 4GDKB 2ZCCA 1XT9B 3U30A 1I35A 4ANUA 2JZZA 1G6JA 3KH0A 5J2RA 4NQKE 1X1MA 2LXAA 4HXDA 5AEKB 5JZEB 1L2NA 1V81A 4N9F4 5D7GA 4GDLA 4HDQA 2MBHA 2KX0A 2L76A 1WXAA 2LWPA 4FHKA 4MH0E 1WJ4A 2KX3A 2BF8B 4GGQA 4DHJB 2MBBB 3L0WB 3IHPC 4IUMB 1TBEA 3VTVA 2O6VD 4EZKA 2WX0A 1OQYA 3A4SC 2KK8A 2O6VA 3GZNI 2JY6A 1TGZB 2WWZA 4TKNA 2NS5A 4BOSC 3KUZA 2D07B 2GBKA 3H6NA 4MEMA 4FHJA 5C23A 4EZJA 4ASWC 4RMAA 1WJNA 2DYMA 4KDLB 5G2NA 4IM0A 3M62B 1E90A 2REXA 2KLGA 2FIFA 4IC7B 5CX3A 3V6EB 2KWUB 2YVCA 5JHAA 2DYBA 2J7QB 2Z59B 2MSED 1XD3B 3EFUA 1Z2MA 3JSVA 4KIKA 2DZKA 5E6PA 4XC2A 4TQ1A 2KC1A 3DDCB 3PPAA 2JXXA 5E6OA 3RT3B 3X0WA 4ANWA 4KSLC 4M8MA 2L05A 2J0MA 2KKCA 3PLUA 2LRWA 3BY4B 1WJ6A 2NPTA 3PLVA 3QWZB 4EKUA 4A3PA 5LXHA 1L7YA 1OTRB 2K1FA 3AXCA 2IO3B 2IO2B 4IWPA 5CHWA 2ZVNA 2FCQA 2GBJA 2KDIA 4NPNA 4WWPA 1IYFA 4FJZA 2I1JA 1S3SG 3ZLZA 2MCNB 2W9NA 1H8CA 2NCNA 3ML8A 4W9GA 4NAWA 3SHQA 1A5RA 3KUCB 1WMHB 1VD2A 3PV1A 3PRMB 4KDIC 2FNJB 4W9HA 3ZRFA 3VVWB 2MBEA 5G55A 2ZZPB 2BPSA 3HHMA 3RCZA 3PTFC 4CHKA 3AU5A 1V80A 2NBVB 2RGFA 2KMAA 4W9JA 4DDGD 1LFDA 2KFKB 4PS7A 1TTNA 3H7PA 3SU8X 3VDZA 4K7SA 4M0WB 1WRDB 2CHXA 4BKTA 1SGHA 1OGWA 4EOYA 3TIXA 1EF5A 2DZIA 1WFYA 4IWQA 4HPLB 4F8CB 2UWQA 4GXBA 1WIAA 3VQIA 2KQ7A 4GB9A 3P2BA 2XEWA 4FBJB 3NZUA 4WWNA 3DOWA 2PE6B 2FIDA 1JRUA 1P1AA 3A9KA 3ENEA 2WX1A 1E8ZA 4DHZE 4ZYNA 2RSUA 5J17A 1ISNA 1V5TA 3VAWA 2FAZA 3AULA 1RFAA 2EMTA 5IAAC 2AYOB 3NHEB 3UF8A 4RM8A 3IG3A 3DQVA 3PHWB 2DHZA 5KHOA 2RPQA 3ZVVA 1WF9A 3QQ8B 3A1QB 2JRIB 3RD2A 3W1SC 3V61A 4HCNB 4MSQB 2LVOA 2D2QA 3ZNHB 3PZDA 2KDEB 4W9EA 3ZRCA 3ECIA 4BKSD 1P9DU 3KYCD 4DHJD 2BWFA 3VHTC 4BKSA 4GMVA 2D11A 3V6CB 1GJZA 4EUTA 3IBEA 4FLHA 4JIOU 2JUOA 3NZSA 4AJWA 5C1ZA 2K6QA 1P3QU 1ZKHA 2FCSA 3QJZA 4JGHB 4MELA 4B9KA 3L54A 4K81A 2LJ5A 3DVNU 4PS3A 3K9PB 2MWSB 1E8XA 2QHOA 3TJPA 1EO6A 2DYOA 2IY1B 3PHXB 4PYUA 3WAMA 2BYFA 3VUXA 4IW0A 3QX1A 4W9CA 2K6DB 3A9JB 3WANA 2GMIC 2LVQA 3OJ3A 3DVGX 4XX5A 4A3OA 4MDKE 3VUYA 3I3TB 3ZDMC 4CO7A 2GBMA 2CHZA 4CYEA 4ZRKA 4A20A 2A5UA 3HK0A 3OLMD 1WE7A 4JQWC 3TMPB 4TV3A 1WGYA 2JRHA 4G11A 1UBQA 2MW5A 2N9EB 1PQSA 1YJ1A 2LI5A 1UBIA 1WI0A 2G4SA 4WQOB 2L7RA 3ZIMA 3U7DA 3TCAA 1U4AA 3W1SA 2IZVB 4LJOB 3QK0A 1SIFA 3TL5A 4URKA 2C7MB 3DVGY 2JZ3B 3RZWC 3OAWA 3ZKJC 2MBQA 2LGXA 1RLFA 4GIVA 3UQAA 4ZRIA 2AL6A 3H1UA 3QARA 4WWOA 3EC8A 2C5LC 1J0GA 1UZXB 4DWFA 2A4ZA 3Q3FA 5D6JB 5L83A 3Q3JA 3VUWA 4IWOA 2IO1B 4KZCA 3V60A 2LD9A 3RYTA 2CR5A 1WMHA 3NY5A 3B0AA 1WXSA 4G50A 2JT4B 2ASQA 3WIMA 3ZTDA 4E3CA 3APCA 3M3JA 4F7ZA 3H9DA 4FULA 1D3ZA 2N1VA 4GU2A 4RM9A 5AZGA 2KVRA 1IPGA 1KLVA 3N3KB 5DCNA 1WGHA 1NDDA 2JVCA 4B6WA 2C7HA 2KFKA 2BWES 1H4RA 1R4NI 3L08A 4E71A 1LXDA 3QAQA 1E7UA 3VH4B 1F9JA 2IO0B 3A4RA 1T0YA 1WM3A 1V9JA 4XZ4A 3T8MA 2V4LA 3UINB 2CHWA 3ZUNA 3JYUA 1WJUA 1K8RB 1OEYJ 2KD0A 2PPHA 4M8NA 3LDZE 5CHVC 3R7QA 2B3AA 1M94A 1WXVA 2LASA 2ZPYA 1V86A 4MSMB 3HM6X 1UH6A 3D32A 1Q5WB 2O6VB 4HWIB 1HE8A 3VTWA 4EEWA 4WJQA 3UIOB 2LZ6A 2BYEA 1C1YB 1P0RA 2L8JA 2JPHA 5L95C 1NI2A 3ALBA 2AWTA 2KJRA 2WDTB 3MTNB 1WZ3A 3A1QA 4II2B 2LGDA 3RUIB 4K7UA 2YLMA 3N30A 4K7WA 5EDSA 3MHSD 2EKEC 3DPDA 2ZNVB 2XK5A 2FCNA 3N32A 2PE9A 4KIKB 2DAFA 1WX8A 1GG3A 3DVNV 3M63B 2L0TA 2PJHA 1E8WA 4BBNF 2JWZA 2OJRA 5D94A 2G45B 1WY8A 2ZJDA 4BVUC 1IP9A 3JW0X 4MJSB 2Y5BB 2KDFB 2DENB 2L3ZA 2M4NA 2UYZB 2CU1A 4NY0A 5CTRC 1WX7A 2L00B 1Z5SB 4GDKA 2KANA 2KZRA 4FJYA 2NBWB 4J6IA 4FN2A 2MA9B 2KWCA 3ZTCA 2KXJA 1WGGA 1WXMA 3R3MA 4DBGA 1WYWB 1P98A 3L13A 4TUUA 2KDBA 3HIZA 4AP4C 2LVPA 3PRPB 2GOWA 4NAWB 5J18A 2KOXA 1WGRA 3HM3A 3ML9A 3PSEB 3APDA 4E74A 2JF5A 1UD7A 1YD8U 4ZRJA 3OJ4B 3T9LA 2IBIB 5LXIB 5KHQA 3ZNGC 4NJ7A 3UGBB 3NS8A 1GC6A 1WZ0A 2KO3A 2KNBA 2MP2B 2MQJA 3L17A 4WJPA 2KLCA 3H7PB 4PYZA 4EFOA 4HVBA 1J8CA 1GUAB 1GC7A 2Z0DB 3V62A 2GBRA 1SE9A 4YL8A 1WM2A 2HE7A 1S1QB 2K8CA 2NR2A 2ZNVC 1OEYA 3L16A 2N9PC 4MGIE 3VH3B 2KQSA 4AWJA 2K25A 2M1MA 2HJ8A 5AZFA 1J19A 5BO4B 4ZDVA 3KVFB 2LXCA 4BBNC 2ZPNA 3C0RB 4LDTB 3PVLA 3DBLI 1Y8RC 2V1YA 2BKRB 3WAPA 2KHWB 2HD5B 3VFKA 2KTRB 2NBUA 2DAJA 1UGMA 4W9LA 2MRPA 1EF1A 5E6NA 4GOCA 4WJOA 1V49A 3QCAA 1WH3A 3MJWA 2WYQA 4W9IA 3H7SA 2O2VB 4FJVB 4II3B 4PS8A 1WR6E 2N9XA 2GBNA 1I42A 1WE6A 4I6NB 1BT0A 4G3XB 1E8YA 2DZMA 4JL9A 4NJ6A 2IY0B 3U8ZA 1RAXA 1YX6B 3B1LX 3ZNZB 2KFJA 1MG8A 3CMMB 4HDOA 4OVVA 4X57B 2AEHA 4IM2A 2MX2A 4K1RB 2J0KA 4NNJB 3VTUA 1UELA 4BOZB 2CKHB 2C60A 2D10A 1TZ1A 3KUDB 3ZO5B 2LRUA 3QIJA 4JLCA 5DPRA 3IFWB 2KTFA 5JH5C 5IA7A 5DPTA 2LGYA 4GDLB 3L10B 3ONSA 1E5WA 3WALA 1QZEA 4KVGB 2BYVE 2KC2A 4MGKE 1ZGUB 3QC8B 4G0NB 4IM3A 4P7IA 1KOTA 4MGZE 2RD0A 4DHZB 3DBRI 2FCMA 4ICVA 4MJSA 2C7NB 2V3SA 3X23A 3UIPB 2IYDB 2I1KA 1AARA 4WJNA 3W1YA 3RZFA 5TR5A 4LJPB 4WAAA 1GNUA 3LJ3A 3APFA 2N7DA 3KW5B 5D2MB 3EECA 3PT2B 2KMCA 1LM8B 1WX9A 3PREA 3B08A 1V5OA 4DK5A 1NBFC 3TBLD 2K39A 4W9FA 3EHVA 5AZHA 4EZLA 4KZ0A 4BFRA 4GSWA 1EUVB 4HCPB 4W9DA 1ZW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSV B;  3ZW3 A;  4AOF A;  4B95 A;  2ZCB A;  1E7V A;  2N7E A;  2KJ6 A;  2KWV B;  2MLB A;  2Z0E B;  2R2Q A;  3CSF A;  2K8H A;  2ZEQ A;  1RRB A;  2MBO A;  2DX5 B;  3ZNI D;  4MGY E;  2NPT B;  3GOE A;  4I6P A;  4MM3 A;  2MP2 A;  5HKH A;  4AUQ C;  3IVF A;  4AJY B;  3DBS A;  4TQ0 A;  2NVU I;  2KJH B;  4HPM B;  4IG7 B;  2AL3 A;  1V2Y A;  4HK2 A;  3A9J A;  2PEA A;  3QA8 A;  2N1W A;  1XQQ A;  2ZVO A;  4GN1 A;  4W9K A;  1YQB A;  4I6L B;  5DPS A;  5JHB A;  3SDL C;  2DZJ A;  3JVZ X;  1C3T A;  3R7R A;  3RUL A;  3O65 B;  2G4D B;  1KM7 A;  1YX5 B;  3A33 B;  3AU4 A;  4F1S A;  4FAD A;  4FA6 A;  3CST A;  5DPW A;  1LQB A;  3PS6 A;  2FUH B;  1FXT B;  2R2O A;  2KN5 A;  1V6E A;  2K8B A;  4LDT D;  4NQL B;  3UQB A;  5LLI A;  2HTH A;  2C9W B;  5CHF A;  3PGE A;  2LUE A;  1KJT A;  3BIN A;  4KSK C;  3K9O B;  2KTR A;  1WGD A;  2OOB B;  2XBB C;  4HLE A;  3AI5 A;  3PRZ A;  1R4M I;  3VXW A;  2M8S A;  4OVU A;  3R66 C;  2XK5 B;  2BKF A;  3DBH I;  2BGF A;  3M95 A;  2M17 A;  4DXA B;  3NOB A;  1VCB A;  2O2V A;  2G3Q B;  3WA0 A;  2J0J A;  4DDI D;  4ANV A;  2CS4 A;  3KYD D;  4LCD E;  1WR1 A;  2RR9 A;  4BKG A;  1CMX B;  1Q0W B;  5FR6 A;  3ZDT A;  1YIW A;  4HJK A;  2M0X A;  4KV2 A;  3A9K B;  5GMV A;  2L0F A;  2N4F A;  4ICU A;  2D3G A;  2EMS A;  4ANX A;  2VRR B;  3DCG A;  3S2A A;  1Q1O A;  3CF6 E;  3QHT A;  3SD5 A;  3WAO A;  4GDK B;  2ZCC A;  1XT9 B;  3U30 A;  1I35 A;  4ANU A;  2JZZ A;  1G6J A;  3KH0 A;  5J2R A;  4NQK E;  1X1M A;  2LXA A;  4HXD A;  5AEK B;  5JZE B;  1L2N A;  1V81 A;  4N9F 4;  5D7G A;  4GDL A;  4HDQ A;  2MBH A;  2KX0 A;  2L76 A;  1WXA A;  2LWP A;  4FHK A;  4MH0 E;  1WJ4 A;  2KX3 A;  2BF8 B;  4GGQ A;  4DHJ B;  2MBB B;  3L0W B;  3IHP C;  4IUM B;  1TBE A;  3VTV A;  2O6V D;  4EZK A;  2WX0 A;  1OQY A;  3A4S C;  2KK8 A;  2O6V A;  3GZN I;  2JY6 A;  1TGZ B;  2WWZ A;  4TKN A;  2NS5 A;  4BOS C;  3KUZ A;  2D07 B;  2GBK A;  3H6N A;  4MEM A;  4FHJ A;  5C23 A;  4EZJ A;  4ASW C;  4RMA A;  1WJN A;  2DYM A;  4KDL B;  5G2N A;  4IM0 A;  3M62 B;  1E90 A;  2REX A;  2KLG A;  2FIF A;  4IC7 B;  5CX3 A;  3V6E B;  2KWU B;  2YVC A;  5JHA A;  2DYB A;  2J7Q B;  2Z59 B;  2MSE D;  1XD3 B;  3EFU A;  1Z2M A;  3JSV A;  4KIK A;  2DZK A;  5E6P A;  4XC2 A;  4TQ1 A;  2KC1 A;  3DDC B;  3PPA A;  2JXX A;  5E6O A;  3RT3 B;  3X0W A;  4ANW A;  4KSL C;  4M8M A;  2L05 A;  2J0M A;  2KKC A;  3PLU A;  2LRW A;  3BY4 B;  1WJ6 A;  2NPT A;  3PLV A;  3QWZ B;  4EKU A;  4A3P A;  5LXH A;  1L7Y A;  1OTR B;  2K1F A;  3AXC A;  2IO3 B;  2IO2 B;  4IWP A;  5CHW A;  2ZVN A;  2FCQ A;  2GBJ A;  2KDI A;  4NPN A;  4WWP A;  1IYF A;  4FJZ A;  2I1J A;  1S3S G;  3ZLZ A;  2MCN B;  2W9N A;  1H8C A;  2NCN A;  3ML8 A;  4W9G A;  4NAW A;  3SHQ A;  1A5R A;  3KUC B;  1WMH B;  1VD2 A;  3PV1 A;  3PRM B;  4KDI C;  2FNJ B;  4W9H A;  3ZRF A;  3VVW B;  2MBE A;  5G55 A;  2ZZP B;  2BPS A;  3HHM A;  3RCZ A;  3PTF C;  4CHK A;  3AU5 A;  1V80 A;  2NBV B;  2RGF A;  2KMA A;  4W9J A;  4DDG D;  1LFD A;  2KFK B;  4PS7 A;  1TTN A;  3H7P A;  3SU8 X;  3VDZ A;  4K7S A;  4M0W B;  1WRD B;  2CHX A;  4BKT A;  1SGH A;  1OGW A;  4EOY A;  3TIX A;  1EF5 A;  2DZI A;  1WFY A;  4IWQ A;  4HPL B;  4F8C B;  2UWQ A;  4GXB A;  1WIA A;  3VQI A;  2KQ7 A;  4GB9 A;  3P2B A;  2XEW A;  4FBJ B;  3NZU A;  4WWN A;  3DOW A;  2PE6 B;  2FID A;  1JRU A;  1P1A A;  3A9K A;  3ENE A;  2WX1 A;  1E8Z A;  4DHZ E;  4ZYN A;  2RSU A;  5J17 A;  1ISN A;  1V5T A;  3VAW A;  2FAZ A;  3AUL A;  1RFA A;  2EMT A;  5IAA C;  2AYO B;  3NHE B;  3UF8 A;  4RM8 A;  3IG3 A;  3DQV A;  3PHW B;  2DHZ A;  5KHO A;  2RPQ A;  3ZVV A;  1WF9 A;  3QQ8 B;  3A1Q B;  2JRI B;  3RD2 A;  3W1S C;  3V61 A;  4HCN B;  4MSQ B;  2LVO A;  2D2Q A;  3ZNH B;  3PZD A;  2KDE B;  4W9E A;  3ZRC A;  3ECI A;  4BKS D;  1P9D U;  3KYC D;  4DHJ D;  2BWF A;  3VHT C;  4BKS A;  4GMV A;  2D11 A;  3V6C B;  1GJZ A;  4EUT A;  3IBE A;  4FLH A;  4JIO U;  2JUO A;  3NZS A;  4AJW A;  5C1Z A;  2K6Q A;  1P3Q U;  1ZKH A;  2FCS A;  3QJZ A;  4JGH B;  4MEL A;  4B9K A;  3L54 A;  4K81 A;  2LJ5 A;  3DVN U;  4PS3 A;  3K9P B;  2MWS B;  1E8X A;  2QHO A;  3TJP A;  1EO6 A;  2DYO A;  2IY1 B;  3PHX B;  4PYU A;  3WAM A;  2BYF A;  3VUX A;  4IW0 A;  3QX1 A;  4W9C A;  2K6D B;  3A9J B;  3WAN A;  2GMI C;  2LVQ A;  3OJ3 A;  3DVG X;  4XX5 A;  4A3O A;  4MDK E;  3VUY A;  3I3T B;  3ZDM C;  4CO7 A;  2GBM A;  2CHZ A;  4CYE A;  4ZRK A;  4A20 A;  2A5U A;  3HK0 A;  3OLM D;  1WE7 A;  4JQW C;  3TMP B;  4TV3 A;  1WGY A;  2JRH A;  4G11 A;  1UBQ A;  2MW5 A;  2N9E B;  1PQS A;  1YJ1 A;  2LI5 A;  1UBI A;  1WI0 A;  2G4S A;  4WQO B;  2L7R A;  3ZIM A;  3U7D A;  3TCA A;  1U4A A;  3W1S A;  2IZV B;  4LJO B;  3QK0 A;  1SIF A;  3TL5 A;  4URK A;  2C7M B;  3DVG Y;  2JZ3 B;  3RZW C;  3OAW A;  3ZKJ C;  2MBQ A;  2LGX A;  1RLF A;  4GIV A;  3UQA A;  4ZRI A;  2AL6 A;  3H1U A;  3QAR A;  4WWO A;  3EC8 A;  2C5L C;  1J0G A;  1UZX B;  4DWF A;  2A4Z A;  3Q3F A;  5D6J B;  5L83 A;  3Q3J A;  3VUW A;  4IWO A;  2IO1 B;  4KZC A;  3V60 A;  2LD9 A;  3RYT A;  2CR5 A;  1WMH A;  3NY5 A;  3B0A A;  1WXS A;  4G50 A;  2JT4 B;  2ASQ A;  3WIM A;  3ZTD A;  4E3C A;  3APC A;  3M3J A;  4F7Z A;  3H9D A;  4FUL A;  1D3Z A;  2N1V A;  4GU2 A;  4RM9 A;  5AZG A;  2KVR A;  1IPG A;  1KLV A;  3N3K B;  5DCN A;  1WGH A;  1NDD A;  2JVC A;  4B6W A;  2C7H A;  2KFK A;  2BWE S;  1H4R A;  1R4N I;  3L08 A;  4E71 A;  1LXD A;  3QAQ A;  1E7U A;  3VH4 B;  1F9J A;  2IO0 B;  3A4R A;  1T0Y A;  1WM3 A;  1V9J A;  4XZ4 A;  3T8M A;  2V4L A;  3UIN B;  2CHW A;  3ZUN A;  3JYU A;  1WJU A;  1K8R B;  1OEY J;  2KD0 A;  2PPH A;  4M8N A;  3LDZ E;  5CHV C;  3R7Q A;  2B3A A;  1M94 A;  1WXV A;  2LAS A;  2ZPY A;  1V86 A;  4MSM B;  3HM6 X;  1UH6 A;  3D32 A;  1Q5W B;  2O6V B;  4HWI B;  1HE8 A;  3VTW A;  4EEW A;  4WJQ A;  3UIO B;  2LZ6 A;  2BYE A;  1C1Y B;  1P0R A;  2L8J A;  2JPH A;  5L95 C;  1NI2 A;  3ALB A;  2AWT A;  2KJR A;  2WDT B;  3MTN B;  1WZ3 A;  3A1Q A;  4II2 B;  2LGD A;  3RUI B;  4K7U A;  2YLM A;  3N30 A;  4K7W A;  5EDS A;  3MHS D;  2EKE C;  3DPD A;  2ZNV B;  2XK5 A;  2FCN A;  3N32 A;  2PE9 A;  4KIK B;  2DAF A;  1WX8 A;  1GG3 A;  3DVN V;  3M63 B;  2L0T A;  2PJH A;  1E8W A;  4BBN F;  2JWZ A;  2OJR A;  5D94 A;  2G45 B;  1WY8 A;  2ZJD A;  4BVU C;  1IP9 A;  3JW0 X;  4MJS B;  2Y5B B;  2KDF B;  2DEN B;  2L3Z A;  2M4N A;  2UYZ B;  2CU1 A;  4NY0 A;  5CTR C;  1WX7 A;  2L00 B;  1Z5S B;  4GDK A;  2KAN A;  2KZR A;  4FJY A;  2NBW B;  4J6I A;  4FN2 A;  2MA9 B;  2KWC A;  3ZTC A;  2KXJ A;  1WGG A;  1WXM A;  3R3M A;  4DBG A;  1WYW B;  1P98 A;  3L13 A;  4TUU A;  2KDB A;  3HIZ A;  4AP4 C;  2LVP A;  3PRP B;  2GOW A;  4NAW B;  5J18 A;  2KOX A;  1WGR A;  3HM3 A;  3ML9 A;  3PSE B;  3APD A;  4E74 A;  2JF5 A;  1UD7 A;  1YD8 U;  4ZRJ A;  3OJ4 B;  3T9L A;  2IBI B;  5LXI B;  5KHQ A;  3ZNG C;  4NJ7 A;  3UGB B;  3NS8 A;  1GC6 A;  1WZ0 A;  2KO3 A;  2KNB A;  2MP2 B;  2MQJ A;  3L17 A;  4WJP A;  2KLC A;  3H7P B;  4PYZ A;  4EFO A;  4HVB A;  1J8C A;  1GUA B;  1GC7 A;  2Z0D B;  3V62 A;  2GBR A;  1SE9 A;  4YL8 A;  1WM2 A;  2HE7 A;  1S1Q B;  2K8C A;  2NR2 A;  2ZNV C;  1OEY A;  3L16 A;  2N9P C;  4MGI E;  3VH3 B;  2KQS A;  4AWJ A;  2K25 A;  2M1M A;  2HJ8 A;  5AZF A;  1J19 A;  5BO4 B;  4ZDV A;  3KVF B;  2LXC A;  4BBN C;  2ZPN A;  3C0R B;  4LDT B;  3PVL A;  3DBL I;  1Y8R C;  2V1Y A;  2BKR B;  3WAP A;  2KHW B;  2HD5 B;  3VFK A;  2KTR B;  2NBU A;  2DAJ A;  1UGM A;  4W9L A;  2MRP A;  1EF1 A;  5E6N A;  4GOC A;  4WJO A;  1V49 A;  3QCA A;  1WH3 A;  3MJW A;  2WYQ A;  4W9I A;  3H7S A;  2O2V B;  4FJV B;  4II3 B;  4PS8 A;  1WR6 E;  2N9X A;  2GBN A;  1I42 A;  1WE6 A;  4I6N B;  1BT0 A;  4G3X B;  1E8Y A;  2DZM A;  4JL9 A;  4NJ6 A;  2IY0 B;  3U8Z A;  1RAX A;  1YX6 B;  3B1L X;  3ZNZ B;  2KFJ A;  1MG8 A;  3CMM B;  4HDO A;  4OVV A;  4X57 B;  2AEH A;  4IM2 A;  2MX2 A;  4K1R B;  2J0K A;  4NNJ B;  3VTU A;  1UEL A;  4BOZ B;  2CKH B;  2C60 A;  2D10 A;  1TZ1 A;  3KUD B;  3ZO5 B;  2LRU A;  3QIJ A;  4JLC A;  5DPR A;  3IFW B;  2KTF A;  5JH5 C;  5IA7 A;  5DPT A;  2LGY A;  4GDL B;  3L10 B;  3ONS A;  1E5W A;  3WAL A;  1QZE A;  4KVG B;  2BYV E;  2KC2 A;  4MGK E;  1ZGU B;  3QC8 B;  4G0N B;  4IM3 A;  4P7I A;  1KOT A;  4MGZ E;  2RD0 A;  4DHZ B;  3DBR I;  2FCM A;  4ICV A;  4MJS A;  2C7N B;  2V3S A;  3X23 A;  3UIP B;  2IYD B;  2I1K A;  1AAR A;  4WJN A;  3W1Y A;  3RZF A;  5TR5 A;  4LJP B;  4WAA A;  1GNU A;  3LJ3 A;  3APF A;  2N7D A;  3KW5 B;  5D2M B;  3EEC A;  3PT2 B;  2KMC A;  1LM8 B;  1WX9 A;  3PRE A;  3B08 A;  1V5O A;  4DK5 A;  1NBF C;  3TBL D;  2K39 A;  4W9F A;  3EHV A;  5AZH A;  4EZL A;  4KZ0 A;  4BFR A;  4GSW A;  1EUV B;  4HCP B;  4W9D A;  1ZW7 A; 
#chains in the Genus database with same CATH topology
 3JSV B;  4WH4 A;  4AOF A;  2ZCB A;  3ZJU A;  3ZNI D;  2DX5 B;  4Q2J A;  5HKH A;  3IVF A;  2KJH B;  3GZN B;  3A9J A;  2PEA A;  2N1W A;  1XQQ A;  4W9K A;  5JHB A;  5DPS A;  1YQB A;  4I6L B;  2WGS A;  3CST A;  3PS6 A;  2FUH B;  3MC0 B;  4LDT D;  3PGE A;  2LUE A;  1KJT A;  3IXS A;  3K9O B;  2QDF A;  2KTR A;  2OOB B;  2EKI A;  1N5W A;  3RPF C;  2I2Y A;  4OVU A;  3R66 C;  3Q3N C;  3DBH I;  5IOI A;  1FFU A;  4DXA B;  1VCB A;  2G3Q B;  2J0J A;  4DDI D;  4ANV A;  1FPY A;  4LCD E;  2R61 A;  3ZDT A;  3AEF B;  1WGK A;  2D3G A;  2EMS A;  1SB3 C;  4XE0 A;  1EWC A;  3SD5 A;  3WAO A;  2ZCC A;  3KH0 A;  4WIP A;  3ZXR A;  3U52 E;  3BII D;  1L2N A;  5D7G A;  4HDQ A;  2W3R A;  1XF5 L;  3R2I A;  1TBE A;  1QT9 A;  1I4Q A;  2O6V D;  4KGT A;  1FFV A;  3N9Y C;  4EE2 A;  2O6V A;  1T0R C;  4TKN A;  2NS5 A;  2QIE B;  2KN4 A;  1L4D B;  3H8H A;  2D07 B;  3H6N A;  5C23 A;  1VLB A;  5G2N A;  2JSV X;  2REX A;  2FIF A;  3V6E B;  3I63 C;  2DYB A;  2J7Q B;  2Z59 B;  1K50 A;  5E6P A;  2DZK A;  2WXN A;  4ZYS A;  4TQ1 A;  3DDC B;  1E7P B;  1L0X B;  5MPO A;  2LRW A;  4EKU A;  1L5P A;  4A3P A;  1AWD A;  1I4H A;  1OTR B;  2INN E;  1WSP A;  3NG0 A;  2N7J A;  5CHW A;  4ZRP A;  2GBJ A;  2I1J A;  3AE4 B;  2W9N A;  2NCN A;  3KQ4 A;  3ML8 A;  1A5R A;  5IP4 D;  1WMH B;  1VD2 A;  3PV1 A;  4KDI C;  2FNJ B;  1FRD A;  4W9H A;  1DOX A;  2N9K A;  4YT0 B;  2FUG 1;  4IKG A;  3W2D A;  3RCZ A;  2NMQ A;  3AU5 A;  2KMA A;  2KFK B;  4PS7 A;  3TEX A;  4K7S A;  4M0W B;  5EE9 A;  1N63 A;  4EOY A;  1P7E A;  4IWQ A;  3NVZ A;  3BK2 A;  2XEW A;  4WWN A;  1SXT A;  1I7H A;  1XCQ L;  5GXG B;  2FID A;  1FCL A;  3A9K A;  2MJD A;  4HEA 1;  2V3N A;  4DHZ E;  1ISN A;  1V5T A;  3SEB A;  3VAW A;  1WF9 A;  3Q14 C;  2JRI B;  2SEB D;  2D2Q A;  4N59 A;  4TMA B;  3ZRC A;  1D5X C;  3ECI A;  4DHJ D;  3BZD B;  3IBE A;  4L23 A;  2K6Q A;  4B9K A;  3QJZ A;  4MEL A;  3L54 A;  3DVN U;  4PS3 A;  1ENF A;  4C4V B;  3Q3M C;  2QHO A;  4PYU A;  3WAM A;  3Q3O C;  1D5M C;  1PUT A;  1T3Q A;  3DWM A;  4W9C A;  2MH7 A;  3B2G A;  3A9J B;  4A3O A;  3AED B;  4CO7 A;  4ZRK A;  4A6Q A;  2A5U A;  4L1B A;  4JQW C;  4G11 A;  1FNW A;  1WI0 A;  2WHI A;  1CZP A;  3TCA A;  3W1S A;  2IZV B;  2LHE A;  4LJO B;  2V0G A;  1JWA D;  4URK A;  3DVG Y;  5BYS A;  3OAW A;  2MBQ A;  2GB1 A;  3UQA A;  2LHD A;  2OHF A;  3EC8 A;  4P16 A;  3Q8F A;  1UZX B;  3Q3F A;  2WU2 B;  2MHJ A;  3RYT A;  4G50 A;  3I9V 1;  1EU3 A;  3U7Z A;  2ZW0 A;  4MAC A;  1QOG A;  2N1V A;  4RM9 A;  3HUI A;  1K51 A;  4B6W A;  1K52 A;  1NDD A;  2BWE S;  2UU7 A;  4A8X C;  1F9J A;  1YN5 A;  1WM3 A;  3UIN B;  2CHW A;  3JYU A;  1OEY J;  4M8N A;  3R7Q A;  2WDV B;  1V1P B;  1V86 A;  2O6V B;  2KT7 A;  1P0R A;  3TEW A;  4II2 B;  3MTN B;  4K7U A;  2PLP A;  3N30 A;  4K7W A;  5EDS A;  3RFZ B;  1CJE A;  3DPD A;  2XK5 A;  2FCN A;  2W3S A;  1GG3 A;  3DVN V;  1YQ4 B;  2L0T A;  2PJH A;  3P4P B;  3NVY A;  1SJH D;  3T3O A;  2ZJD A;  3JW0 X;  5HG2 A;  1J7C A;  4ZOH C;  1XO3 A;  4M02 A;  4GDK A;  2HJ1 A;  3NVV A;  2KAN A;  1QOF A;  2MA9 B;  2KXJ A;  1MG4 A;  4H2A A;  1P98 A;  1HA5 A;  4TUU A;  2KDB A;  3PRP B;  4L2Y A;  3P1M A;  3VR8 B;  3ML9 A;  1NYQ A;  4ZRJ A;  3BYY B;  1HTQ A;  5KHQ A;  4KGS A;  3UGB B;  1GC6 A;  4WJP A;  2WDR B;  4HVB A;  2NTS A;  2GBR A;  1VZ8 A;  4P1B C;  1S1Q B;  2K8C A;  2NR2 A;  4MGI E;  4HRS A;  2KQS A;  5EE1 A;  2K25 A;  2M1M A;  2HJ8 A;  3OWE B;  2LFI A;  1UGJ A;  2BKR B;  3VFK A;  2W82 A;  3FC4 A;  3NVW A;  1KLU D;  2IPK D;  3HVD A;  4WJO A;  1WH3 A;  1ZXH A;  2WYQ A;  1I4X A;  4II3 B;  2N9X A;  5BMG A;  4I6N B;  4YTP B;  1BT0 A;  2DZM A;  4NJ6 A;  3Q8B A;  4JL9 A;  2IY0 B;  2WXO A;  1DOI A;  3IT6 B;  3TEZ A;  2KMM A;  4ZHP A;  2B76 B;  1I4P A;  4IM2 A;  3VTU A;  1NEN B;  2D10 A;  1TZ1 A;  3KUD B;  2QCZ A;  2D3C A;  1QF6 A;  3L10 B;  3ONS A;  4HPP A;  5BYQ A;  1E5W A;  1QZE A;  1TKY A;  4KVG B;  4MGK E;  4KX6 B;  1T6B X;  1C78 A;  4D2K A;  2V3P A;  4ICV A;  1I4R A;  4USA A;  4WJN A;  3W1Y A;  4O1N A;  1QOB A;  4LJP B;  3PT2 B;  1WX9 A;  1V5O A;  1UWM A;  2K39 A;  5AZH A;  3EHV A;  3SFD B;  4BFR A;  1IGC A;  1ZW7 A;  4S17 A;  4A55 A;  3ZW3 A;  5D3D A;  2MLB A;  3CSF A;  1FNV A;  1RRB A;  3MJ5 A;  2NPT B;  4I6P A;  2CU3 A;  4MM3 A;  2MP2 A;  4AJY B;  1WYG A;  1EM7 A;  2BYT A;  3E9S A;  2CJO A;  2ZVO A;  4JE3 B;  2DZJ A;  1C3T A;  3O65 B;  1SJE D;  3AU4 A;  3KWV A;  3A33 B;  5DPW A;  1LQB A;  2R2O A;  2JQR B;  2MEK A;  4NQL B;  5LLI A;  2QC8 A;  5I4D A;  3BIN A;  2W54 A;  3AE2 B;  1TKG A;  5BMI A;  4HLE A;  3PRZ A;  3VXW A;  2M8S A;  3BK1 A;  3IAM 1;  2XK5 B;  3M95 A;  1R4N B;  2M17 A;  2CS4 A;  1SBB B;  3KYD D;  2RR9 A;  3LYY A;  1Q0W B;  2WXH A;  4HJK A;  2M0X A;  1PYW D;  3BVM A;  4ICU A;  3DCG A;  2YEP B;  4GDK B;  2AQ1 B;  2PTL A;  4NQK E;  2LXA A;  2WXM A;  1KH0 A;  2J42 A;  4CQN A;  2G1E A;  4MH0 E;  4FHK A;  1NYR A;  1WJ4 A;  2IGG A;  3DHI C;  3VTV A;  1TS5 A;  1OQY A;  5HHD G;  2D5G A;  4YSX B;  4IOI E;  2ICI A;  2VH2 A;  2MJE A;  3NUH B;  4FHJ A;  1YJI A;  1HEZ E;  1ROE A;  1QOA A;  2WDQ B;  4WQM A;  1JWU D;  5CX3 A;  3BYT B;  4IC7 B;  3EFU A;  2DWQ A;  2JXX A;  1P7F A;  5E6O A;  4ANW A;  4KSL C;  4M8M A;  2L05 A;  2WQY B;  2WXK A;  4P1C C;  3BY4 B;  3QWZ B;  2BBC A;  3V05 A;  4C56 C;  5LXH A;  1L7Y A;  3W5V B;  2IO3 B;  2IO2 B;  2ZVN A;  2N0S B;  4NPN A;  1IYF A;  4C7Z A;  1S3S G;  3ZLZ A;  2MCN B;  1XCT L;  4W9G A;  4YTM B;  1AW7 A;  2Z8L A;  4KGR A;  2MBE A;  2ZZP B;  4RFB A;  1XXG A;  4CHK A;  2ONQ A;  2NBV B;  4W9J A;  4DDG D;  3VDZ A;  3RN9 C;  3SU8 X;  1F2R I;  5G5H A;  2CHX A;  4XYC A;  4GXB A;  2L52 A;  4FBJ B;  1OQR A;  2WP9 B;  1JRU A;  5G5G A;  2WX1 A;  1K53 A;  5IN7 A;  4ZYN A;  2RSU A;  5J17 A;  2M0A A;  5JXV A;  5EE3 A;  2EMT A;  5IAA C;  2AYO B;  4RM8 A;  3WCQ A;  2DHZ A;  1JWM D;  2E6X A;  3QQ8 B;  1N6Z A;  3A1Q B;  4WWM A;  3PZ8 A;  2LVO A;  4W9E A;  4BKS D;  1P9D U;  3KYC D;  3IAS 1;  3Q2A C;  4BKS A;  4GMV A;  3V6C B;  1GJZ A;  4XDD A;  3NZS A;  1P3Q U;  2VH1 A;  1I4G A;  2LJ5 A;  1ZXI A;  3K9P B;  2WXJ A;  2MWS B;  1E8X A;  2WXF A;  3TJP A;  3DBR B;  4JPS A;  2K6D B;  2K3U A;  3OJ3 A;  2GBM A;  3HK0 A;  4WUR A;  1T0S C;  1WGY A;  3W5U B;  1N62 A;  4AQ7 A;  2GLS A;  1PQS A;  1YJ1 A;  4RGN A;  2LI5 A;  1UBI A;  2G4S A;  1VJK A;  3RI7 C;  4WQO B;  3MC8 A;  3CIR B;  4OZA A;  4OVZ A;  1NVI D;  1IGD A;  4REZ A;  1A70 A;  2JZ3 B;  3ZKJ C;  3RNG C;  1NEK B;  1RLF A;  4ZRI A;  3QAR A;  3AE7 B;  4WWO A;  2C5L C;  3LXF A;  4DWF A;  2IGD A;  3VUW A;  3ZQ4 A;  4IWO A;  2IO1 B;  2LD9 A;  3WIM A;  2CR5 A;  4E3C A;  2ASQ A;  3M3J A;  3AH7 A;  5AZG A;  3AN1 A;  1IPG A;  3N3K B;  5DCN A;  1WGH A;  1R4N I;  3J9C A;  2GRI A;  2JX5 A;  2JYT A;  3P4R B;  2IO0 B;  3A4R A;  2V4L A;  1TS2 A;  2KQ4 X;  1DYQ A;  4LNK A;  1C4A A;  1M94 A;  3AEG B;  2ZPY A;  3EUB 2;  1YQ3 B;  3HM6 X;  5HI1 A;  3P63 A;  1QIL A;  2LZ6 A;  2BYE A;  1FIQ A;  2JPH A;  1NI2 A;  3NRZ A;  1C76 A;  2AWT A;  1D6E C;  2KJR A;  2WDT B;  4RNA A;  2RDB C;  2ZNV B;  2LEK A;  1WX8 A;  3M63 B;  1E8W A;  1C4P A;  2DBY A;  3C19 A;  4BVU C;  1IP9 A;  2KDF B;  2D3B A;  1PGB A;  3BVG A;  1CQV A;  1Z5S B;  1MJD A;  4FJY A;  4J3O D;  3MHZ A;  2G9H D;  4J6I A;  4FN2 A;  2KWC A;  3RNC C;  1WXM A;  4C7Y A;  1WYW B;  4LNO A;  1VR9 A;  2BB6 A;  3CWI A;  1N60 A;  5J18 A;  3BWU D;  3HM3 A;  3PSE B;  3APD A;  4E74 A;  2JF5 A;  3T9L A;  2IBI B;  5LXI B;  4LK0 M;  4M01 A;  1GB4 A;  1RYJ A;  1WZ0 A;  1GAQ B;  2KLC A;  1J8C A;  1XLN A;  2QJL A;  1GC7 A;  2Z0D B;  3Q8A A;  3V62 A;  4YL8 A;  1WM2 A;  1E0Z A;  2Y5P A;  3L16 A;  1OEY A;  4JWU C;  3KWL A;  3VH3 B;  1V8C A;  1L6U A;  1TS3 A;  4LDT B;  4S0R A;  3URY A;  3AE5 B;  1XLP A;  3TEY A;  1ZDV A;  3B9J A;  3WAP A;  2HD5 B;  4N58 A;  2KTR B;  1UGM A;  1RWS A;  1V49 A;  1Q10 A;  3H7S A;  1C79 A;  3R8B A;  1HZ6 A;  3VRB B;  3NZ3 A;  3N1X C;  2BVC A;  1MG8 A;  2KFJ A;  4JX1 C;  1C9F A;  3U2S C;  1UEL A;  2LJI A;  2C60 A;  2I38 A;  4JLC A;  1M4V A;  2LGY A;  3E56 A;  2BYV E;  3QC8 B;  4G0N B;  4IM3 A;  3T3N A;  4MGZ E;  3DBR I;  3GP7 A;  2FCM A;  4MJS A;  2V3S A;  3UIP B;  1AAR A;  3RZF A;  1Y56 A;  2W55 A;  3EA6 A;  3EEC A;  1ET6 A;  3PRE A;  1TKE A;  1AN8 A;  2K9X A;  4GSW A;  1EUV B;  5IA7 A;  4OW0 A;  1F2R C;  1JW9 D;  4B95 A;  2N7E A;  2R2Q A;  4LNI A;  4WAF A;  2K8H A;  2IND C;  2ZEQ A;  3AEE B;  1WRI A;  4MGY E;  4TQ0 A;  3DBS A;  3BVZ A;  3FAH A;  2NVU I;  4HPM B;  2N9L A;  4IG7 B;  2AL3 A;  1V2Y A;  3SDL C;  3RUL A;  2G4D B;  3Q8E A;  3SR6 A;  1FXT B;  2KN5 A;  1V6E A;  2K8B A;  4NAM A;  2HTH A;  3AEA B;  3DWG C;  1QKZ A;  2C9W B;  3FKY A;  1WGD A;  2ACZ B;  4US8 A;  1F0Z A;  1R4M I;  1JWB D;  1VDV A;  2BKF A;  4XGA B;  2O2V A;  3WA0 A;  1PDX A;  2L32 A;  4BKG A;  2J53 A;  1J7B A;  3A9K B;  5GMV A;  2Y3A A;  2VRR B;  3S2A A;  1Q1O A;  3CF6 E;  2DNF A;  4YWG G;  3GS2 A;  1XT9 B;  3U30 A;  4OZB A;  4ANU A;  3RNA C;  2JZZ A;  1G6J A;  5J2R A;  3IT4 B;  3Q69 A;  1X1M A;  1VRA B;  2L83 A;  3NJT A;  1V81 A;  4GDL A;  2MBH A;  2KX0 A;  2LWP A;  2BF8 B;  4GGQ A;  4DHJ B;  2MBB B;  3L0W B;  3IHP C;  4RGT A;  1FNU A;  4ZHO A;  2WX0 A;  2KK8 A;  2V9H A;  1ACC A;  1TGZ B;  2JWU A;  2LGI A;  4BOS C;  3KUZ A;  2GBK A;  5IO9 A;  4EZJ A;  5T8I A;  4ASW C;  4RMA A;  4KDL B;  1MFW A;  4IM0 A;  3M62 B;  1E90 A;  1RM6 C;  2YVC A;  5JHA A;  2K5P A;  1Z2M A;  3JSV A;  2Q5W D;  4OHJ A;  1MHH E;  3PPA A;  3RT3 B;  1IBX A;  3N1Z C;  3RNE C;  3HVZ A;  2E3T A;  1WJ6 A;  1QQR A;  2K1F A;  2HTM E;  3AXC A;  1R7S A;  4UDU C;  4WWP A;  1T0Q C;  2M19 A;  4NAW A;  3SHQ A;  3NS1 A;  3VVW B;  5G55 A;  2BPS A;  3VRA B;  1FCC C;  1F1H A;  1TTN A;  1E9M A;  1FXI A;  3RMK C;  1WRD B;  1SGH A;  2Y5C A;  3DBL B;  1EF5 A;  1WFY A;  3AEB B;  3DHH C;  4F8C B;  2UWQ A;  2KQ7 A;  4GB9 A;  3DOW A;  3B2F A;  1P1A A;  1E8Z A;  4RGO S;  2K22 A;  4BAX A;  2FAZ A;  3AUL A;  3NHE B;  1TT5 B;  1V1O A;  3IG3 A;  2WLB A;  5KHO A;  1ZE3 D;  3LB8 C;  4HJG E;  2RPQ A;  3ZVV A;  2AQ3 B;  3RD2 A;  4HCN B;  2BS3 B;  4MSQ B;  2KDE B;  2WXQ A;  1AYF A;  1SE4 A;  1GOZ A;  3FIL A;  1KRH A;  2BWF A;  4K3B A;  3VHT C;  2D11 A;  4YSY B;  4EUT A;  4JIO U;  1E6E B;  2JUO A;  3ABV B;  5C1Z A;  1ZKH A;  4JGH B;  1JWS D;  1T5X D;  3C8Y A;  3TUO A;  3AE1 B;  3ETR A;  3PHX B;  2BYF A;  1SEB D;  3MP9 A;  3WAN A;  2GMI C;  2LVQ A;  4XX5 A;  3DVG X;  2QSD A;  4MDK E;  2CHZ A;  4CYE A;  3OLM D;  1GPX A;  3TMP B;  4TV3 A;  4A9A A;  2MW5 A;  2QMT A;  2RMM A;  2LUM A;  3U7D A;  2HDE A;  3QK0 A;  1SIF A;  2C7M B;  4HKQ A;  2GI9 A;  3AB5 A;  2AL6 A;  3H1U A;  2RDG A;  3GB1 A;  4LNN A;  1J0G A;  5D6J B;  4ARC A;  1MPE A;  5L83 A;  3Q3J A;  4KZC A;  4M00 A;  3ZTD A;  1WMH A;  3APC A;  4PT5 A;  3H9D A;  1IUE A;  4FUL A;  1D3Z A;  4GU2 A;  2BW2 A;  1KLV A;  5JH5 C;  2C7H A;  2KFK A;  2MJ3 A;  4E71 A;  3L08 A;  4C00 A;  3ZJT A;  4M0W A;  3QAQ A;  1E7U A;  3T8M A;  3U4E G;  1T0Y A;  1V9J A;  2IGH A;  1K8R B;  2KAJ A;  5CHV C;  1TJE A;  1WXV A;  2LAS A;  5FKA C;  4B0M A;  1Q5W B;  4HWI B;  1HE8 A;  4HRO A;  4EEW A;  4WJQ A;  3UIO B;  2OJW A;  1C1Y B;  5L95 C;  1ESF A;  3ALB A;  2LGD A;  3RUI B;  2YLM A;  1PFD A;  3N32 A;  1YN4 A;  3TSS A;  1JQ4 A;  1IBX B;  1SSN A;  2OJR A;  4LTU A;  5D94 A;  1WY8 A;  3EFC A;  1CK1 A;  2DEN B;  2KDM A;  2UYZ B;  2CU1 A;  4NY0 A;  4C4V A;  5CTR C;  1WX7 A;  1QLB B;  4A90 A;  4LLG M;  1BUI C;  1STE A;  1MHX A;  4IDI A;  1ZOY B;  1WGG A;  1FO4 A;  1FMA D;  3L13 A;  4KKJ A;  3HIZ A;  2LVP A;  4NAW B;  2KOX A;  2AX5 A;  3ZJV A;  1UD7 A;  5AUI A;  1BXT A;  4QAY A;  1TZO A;  1TY0 A;  4NJ7 A;  3AE6 B;  1BML C;  2JXT A;  3NS8 A;  4MM3 B;  2MP2 B;  2MQJ A;  3MC9 A;  4PYZ A;  5H8Y E;  1KF6 B;  2PW9 A;  1YMH E;  1SIJ A;  4DQO C;  2ZNV C;  2RDH A;  2J52 A;  3PO0 A;  5E6J A;  4AWJ A;  2IDY A;  3Q6B A;  2JZP A;  1J19 A;  1UF0 A;  4KKI A;  3KVF B;  2LXC A;  5BO4 B;  4BBN C;  3C0R B;  1XLQ A;  3DBL I;  1FRR A;  2KHW B;  2TSS A;  3AM9 A;  2ON8 A;  5E6N A;  1TY2 A;  4GOC A;  3QCA A;  3FIL B;  1SE2 A;  1WR6 E;  3AV8 A;  1V1P A;  2GBN A;  1WE6 A;  4G3X B;  3U8Z A;  1FEH A;  1YX6 B;  3ZNZ B;  4RGM A;  2AEH A;  2MX2 A;  4NNJ B;  4TSS A;  2ZW1 A;  3ZO5 B;  3QIJ A;  1L6V A;  5DPR A;  1OFF A;  2DLB A;  4XDC A;  2KTF A;  1B1Z A;  4N6E B;  5DPT A;  1MVK A;  3WAL A;  2WS3 B;  1R4M B;  1JML A;  4AS1 A;  5IKC M;  3X23 A;  2IYD B;  2I1K A;  1B9R A;  5TR5 A;  2SAK A;  1GNU A;  3APF A;  3VR9 B;  3B08 A;  1NBF C;  3TBL D;  5H92 C;  2RPV A;  4YSZ B;  4OZC A;  1E7V A;  2KJ6 A;  1L0V B;  2JU6 X;  2KWV B;  2Z0E B;  4ACF A;  1JRO A;  3L4P A;  2MBO A;  1UUP A;  3GOE A;  5FK9 C;  2BQQ A;  4AUQ C;  1HQR D;  3I5J C;  4HK2 A;  3QA8 A;  4GN1 A;  3JVZ X;  3R7R A;  3N1Y C;  3AE9 B;  1KM7 A;  1YX5 B;  4FAD A;  4F1S A;  4FA6 A;  3RNF C;  4ZRQ A;  2QIL A;  3R2T A;  3UQB A;  4DXF A;  5CHF A;  1VZ6 A;  4KSK C;  1XLO A;  2XBB C;  3AI5 A;  2WU5 B;  2BGF A;  1YNT E;  3NOB A;  5AUK A;  3AMZ A;  1WR1 A;  1CMX B;  5FR6 A;  1YIW A;  4KV2 A;  2EEL A;  2L0F A;  2N4F A;  2YEP F;  4ANX A;  1TYG B;  1DGJ A;  3QHT A;  2WXP A;  3RNB C;  1I35 A;  1YN3 A;  1DOY A;  5JZE B;  4HXD A;  5AEK B;  2INC C;  1HTO A;  4N9F 4;  2L76 A;  1WXA A;  1JAL A;  2KX3 A;  1J7A A;  2WNM A;  2PMV A;  4IUM B;  2CJN A;  4EZK A;  4MH8 A;  2WXI A;  3A4S C;  3GZN I;  2JY6 A;  2WWZ A;  2XN9 C;  4MEM A;  3O13 A;  4K3C A;  1WJN A;  2DYM A;  3Q8C A;  1VZ7 A;  2KLG A;  2KWU B;  2MSE D;  1XD3 B;  4KIK A;  4XWW A;  4LNF A;  4XC2 A;  2KC1 A;  2KAC A;  3X0W A;  2J0M A;  2KKC A;  3PLU A;  2NPT A;  3PLV A;  1NI3 A;  4JWS C;  4IWP A;  2FCQ A;  2H89 B;  2KDI A;  4FJZ A;  1YJJ A;  4P6V F;  1H8C A;  2K0P A;  3KUC B;  3ZRF A;  2KWD A;  3PRM B;  2KYW A;  3HHM A;  1SF0 A;  3PTF C;  1V80 A;  2RGF A;  1LFD A;  3H7P A;  4BKT A;  2XNA C;  1OGW A;  3TIX A;  2DZI A;  4HPL B;  1PGX A;  2VZK D;  2LMC A;  1WIA A;  2QEJ C;  3I57 A;  3VQI A;  3ZXV A;  3P2B A;  3NZU A;  1D5Z C;  2PE6 B;  3ENE A;  2WXL A;  1RFA A;  4NZL B;  3P42 A;  3UF8 A;  1ZUD 2;  3DQV A;  3PHW B;  1D4B A;  3W1S C;  4PK1 A;  3V61 A;  3ZNH B;  3PZD A;  5EE0 A;  2OED A;  4FLH A;  4AJW A;  3W9C B;  3P4Q B;  2FCS A;  4MT5 A;  1N61 A;  4K81 A;  3DHG C;  5BYR A;  1EO6 A;  2DYO A;  2IY1 B;  2L1A A;  1YOV B;  3VUX A;  3UI3 A;  4IW0 A;  3QX1 A;  2PIA A;  1L4Z B;  3VUY A;  3I3T B;  3ZDM C;  4DXG A;  4B0E A;  4A20 A;  1WE7 A;  1KTK A;  5D3I B;  2BB5 A;  2PKO A;  2JRH A;  1UBQ A;  2N9E B;  2BS2 B;  2L7R A;  3ZIM A;  1U4A A;  2WXG A;  1XEE A;  3TL5 A;  3RZW C;  3EGR A;  2LGX A;  4GIV A;  1EU4 A;  3SFE B;  1N5X A;  2A4Z A;  1RFK A;  3V60 A;  1PGA A;  3NY5 A;  3B0A A;  1WXS A;  2WXR A;  2JT4 B;  3N20 C;  5C3J B;  4FXC A;  4F7Z A;  2PVG C;  4NJC A;  1FXA A;  4GLS C;  2KVR A;  4RCO A;  1UNS A;  2JVC A;  3MFG A;  1H4R A;  3AEC B;  1LXD A;  3VH4 B;  4XZ4 A;  4RF0 A;  1MI0 A;  5C2T B;  3ZUN A;  1WJU A;  2KD0 A;  2PPH A;  3LDZ E;  2B3A A;  1GB1 A;  3DBH B;  1TS4 A;  3GE8 C;  4MSM B;  1UH6 A;  3D32 A;  3VTW A;  2L8J A;  3ZYY X;  5BMH A;  1WZ3 A;  3A1Q A;  1SE3 A;  1WWT A;  3MHS D;  2EKE C;  2PE9 A;  4KIK B;  1C77 A;  2DAF A;  2BTE A;  2PVO D;  1WXQ A;  4BBN F;  2JWZ A;  2G45 B;  5HFY A;  1JCK B;  4MJS B;  2Y5B B;  2L3Z A;  2M4N A;  3P4S B;  2FE8 A;  2L00 B;  1L0Y B;  2KZR A;  2NBW B;  1HZ5 A;  3OG5 A;  4C80 A;  3ZTC A;  2INP E;  2D3A A;  3R3M A;  4DBG A;  1V97 A;  1KLG D;  4AP4 C;  2GOW A;  1WGR A;  3ZGZ A;  1YD8 U;  5FR3 A;  3OJ4 B;  4US9 A;  1LO5 D;  1F52 A;  2V4I B;  4ITK A;  3V3X A;  3ZNG C;  3PZ7 A;  2KNB A;  2KO3 A;  3L17 A;  3H7P B;  4EFO A;  2X8X X;  2BS4 B;  1GUA B;  1SE9 A;  2HE7 A;  2X38 A;  1LGR A;  2N9P C;  2VZK B;  1OQQ A;  2KVZ A;  3GE3 C;  2AQ2 B;  5AZF A;  1F77 A;  1UWX A;  3AE3 B;  4ZDV A;  1FM0 D;  2H88 B;  2ZPN A;  4YXD B;  4YTN B;  3PVL A;  1Y8R C;  2V1Y A;  2NBU A;  2DAJ A;  4W9L A;  2MRP A;  1EF1 A;  3MJW A;  4W9I A;  2O2V B;  1TIF A;  1HXY D;  4FJV B;  4PS8 A;  1E10 A;  5TSS A;  4BZA A;  1I42 A;  1E8Y A;  1RAX A;  3B1L X;  3KLS X;  2NTT A;  4HDO A;  3CMM B;  4OVV A;  4R3D A;  4X57 B;  4K1R B;  2J0K A;  4BOZ B;  2CKH B;  1ET9 A;  2LRU A;  3IFW B;  1ZPS A;  1JRP A;  2M56 B;  4GDL B;  5LNK 1;  2KC2 A;  1ZGU B;  4RF1 A;  4XWT A;  3AE8 B;  4P7I A;  1KOT A;  2FBW B;  2RD0 A;  4DHZ B;  4RH6 A;  1KFY B;  2C7N B;  1C4C A;  1ZP0 B;  3HRD D;  2LGS A;  1EWY C;  1FD6 A;  4WAA A;  3LJ3 A;  3KW5 B;  2N7D A;  5D2M B;  4HKZ E;  2JYE A;  2KMC A;  1LM8 B;  2J4X A;  4DK5 A;  2IJ0 A;  4W9F A;  4EZL A;  2BT6 A;  4ARI A;  1ZDX A;  4KZ0 A;  4HCP B;  4W9D A; 
#chains in the Genus database with same CATH homology
 3JSV B;  3ZW3 A;  4AOF A;  4B95 A;  2ZCB A;  1E7V A;  2N7E A;  2KJ6 A;  2KWV B;  2MLB A;  2Z0E B;  2R2Q A;  3CSF A;  2K8H A;  2ZEQ A;  1RRB A;  2MBO A;  2DX5 B;  3ZNI D;  4MGY E;  2NPT B;  3GOE A;  4I6P A;  4MM3 A;  2MP2 A;  5HKH A;  4AUQ C;  3IVF A;  4AJY B;  3DBS A;  4TQ0 A;  2NVU I;  2KJH B;  4HPM B;  4IG7 B;  2AL3 A;  1V2Y A;  4HK2 A;  3A9J A;  2PEA A;  3QA8 A;  2N1W A;  1XQQ A;  2ZVO A;  4GN1 A;  4W9K A;  1YQB A;  4I6L B;  5DPS A;  5JHB A;  3SDL C;  2DZJ A;  3JVZ X;  1C3T A;  3R7R A;  3RUL A;  3O65 B;  2G4D B;  1KM7 A;  1YX5 B;  3A33 B;  3AU4 A;  4F1S A;  4FAD A;  4FA6 A;  3CST A;  5DPW A;  1LQB A;  3PS6 A;  2FUH B;  1FXT B;  2R2O A;  2KN5 A;  1V6E A;  2K8B A;  4LDT D;  4NQL B;  3UQB A;  5LLI A;  2HTH A;  2C9W B;  5CHF A;  3PGE A;  2LUE A;  1KJT A;  3BIN A;  4KSK C;  3K9O B;  2KTR A;  1WGD A;  2OOB B;  2XBB C;  4HLE A;  3AI5 A;  3PRZ A;  1R4M I;  3VXW A;  2M8S A;  4OVU A;  3R66 C;  2XK5 B;  2BKF A;  3DBH I;  2BGF A;  3M95 A;  2M17 A;  4DXA B;  3NOB A;  1VCB A;  2O2V A;  2G3Q B;  3WA0 A;  2J0J A;  4DDI D;  4ANV A;  2CS4 A;  3KYD D;  4LCD E;  1WR1 A;  2RR9 A;  4BKG A;  1CMX B;  1Q0W B;  5FR6 A;  3ZDT A;  1YIW A;  4HJK A;  2M0X A;  4KV2 A;  3A9K B;  5GMV A;  2L0F A;  2N4F A;  4ICU A;  2D3G A;  2EMS A;  4ANX A;  2VRR B;  3DCG A;  3S2A A;  1Q1O A;  3CF6 E;  3QHT A;  3SD5 A;  3WAO A;  4GDK B;  2ZCC A;  1XT9 B;  3U30 A;  1I35 A;  4ANU A;  2JZZ A;  1G6J A;  3KH0 A;  5J2R A;  4NQK E;  1X1M A;  2LXA A;  4HXD A;  5AEK B;  5JZE B;  1L2N A;  1V81 A;  4N9F 4;  5D7G A;  4GDL A;  4HDQ A;  2MBH A;  2KX0 A;  2L76 A;  1WXA A;  2LWP A;  4FHK A;  4MH0 E;  1WJ4 A;  2KX3 A;  2BF8 B;  4GGQ A;  4DHJ B;  2MBB B;  3L0W B;  3IHP C;  4IUM B;  1TBE A;  3VTV A;  2O6V D;  4EZK A;  2WX0 A;  1OQY A;  3A4S C;  2KK8 A;  2O6V A;  3GZN I;  2JY6 A;  1TGZ B;  2WWZ A;  4TKN A;  2NS5 A;  4BOS C;  3KUZ A;  2D07 B;  2GBK A;  3H6N A;  4MEM A;  4FHJ A;  5C23 A;  4EZJ A;  4ASW C;  4RMA A;  1WJN A;  2DYM A;  4KDL B;  5G2N A;  4IM0 A;  3M62 B;  1E90 A;  2REX A;  2KLG A;  2FIF A;  4IC7 B;  5CX3 A;  3V6E B;  2KWU B;  2YVC A;  5JHA A;  2DYB A;  2J7Q B;  2Z59 B;  2MSE D;  1XD3 B;  3EFU A;  1Z2M A;  3JSV A;  4KIK A;  2DZK A;  5E6P A;  4XC2 A;  4TQ1 A;  2KC1 A;  3DDC B;  3PPA A;  2JXX A;  5E6O A;  3RT3 B;  3X0W A;  4ANW A;  4KSL C;  4M8M A;  2L05 A;  2J0M A;  2KKC A;  3PLU A;  2LRW A;  3BY4 B;  1WJ6 A;  2NPT A;  3PLV A;  3QWZ B;  4EKU A;  4A3P A;  5LXH A;  1L7Y A;  1OTR B;  2K1F A;  3AXC A;  2IO3 B;  2IO2 B;  4IWP A;  5CHW A;  2ZVN A;  2FCQ A;  2GBJ A;  2KDI A;  4NPN A;  4WWP A;  1IYF A;  4FJZ A;  2I1J A;  1S3S G;  3ZLZ A;  2MCN B;  2W9N A;  1H8C A;  2NCN A;  3ML8 A;  4W9G A;  4NAW A;  3SHQ A;  1A5R A;  3KUC B;  1WMH B;  1VD2 A;  3PV1 A;  3PRM B;  4KDI C;  2FNJ B;  4W9H A;  3ZRF A;  3VVW B;  2MBE A;  5G55 A;  2ZZP B;  2BPS A;  3HHM A;  3RCZ A;  3PTF C;  4CHK A;  3AU5 A;  1V80 A;  2NBV B;  2RGF A;  2KMA A;  4W9J A;  4DDG D;  1LFD A;  2KFK B;  4PS7 A;  1TTN A;  3H7P A;  3SU8 X;  3VDZ A;  4K7S A;  4M0W B;  1WRD B;  2CHX A;  4BKT A;  1SGH A;  1OGW A;  4EOY A;  3TIX A;  1EF5 A;  2DZI A;  1WFY A;  4IWQ A;  4HPL B;  4F8C B;  2UWQ A;  4GXB A;  1WIA A;  3VQI A;  2KQ7 A;  4GB9 A;  3P2B A;  2XEW A;  4FBJ B;  3NZU A;  4WWN A;  3DOW A;  2PE6 B;  2FID A;  1JRU A;  1P1A A;  3A9K A;  3ENE A;  2WX1 A;  1E8Z A;  4DHZ E;  4ZYN A;  2RSU A;  5J17 A;  1ISN A;  1V5T A;  3VAW A;  2FAZ A;  3AUL A;  1RFA A;  2EMT A;  5IAA C;  2AYO B;  3NHE B;  3UF8 A;  4RM8 A;  3IG3 A;  3DQV A;  3PHW B;  2DHZ A;  5KHO A;  2RPQ A;  3ZVV A;  1WF9 A;  3QQ8 B;  3A1Q B;  2JRI B;  3RD2 A;  3W1S C;  3V61 A;  4HCN B;  4MSQ B;  2LVO A;  2D2Q A;  3ZNH B;  3PZD A;  2KDE B;  4W9E A;  3ZRC A;  3ECI A;  4BKS D;  1P9D U;  3KYC D;  4DHJ D;  2BWF A;  3VHT C;  4BKS A;  4GMV A;  2D11 A;  3V6C B;  1GJZ A;  4EUT A;  3IBE A;  4FLH A;  4JIO U;  2JUO A;  3NZS A;  4AJW A;  5C1Z A;  2K6Q A;  1P3Q U;  1ZKH A;  2FCS A;  3QJZ A;  4JGH B;  4MEL A;  4B9K A;  3L54 A;  4K81 A;  2LJ5 A;  3DVN U;  4PS3 A;  3K9P B;  2MWS B;  1E8X A;  2QHO A;  3TJP A;  1EO6 A;  2DYO A;  2IY1 B;  3PHX B;  4PYU A;  3WAM A;  2BYF A;  3VUX A;  4IW0 A;  3QX1 A;  4W9C A;  2K6D B;  3A9J B;  3WAN A;  2GMI C;  2LVQ A;  3OJ3 A;  3DVG X;  4XX5 A;  4A3O A;  4MDK E;  3VUY A;  3I3T B;  3ZDM C;  4CO7 A;  2GBM A;  2CHZ A;  4CYE A;  4ZRK A;  4A20 A;  2A5U A;  3HK0 A;  3OLM D;  1WE7 A;  4JQW C;  3TMP B;  4TV3 A;  1WGY A;  2JRH A;  4G11 A;  1UBQ A;  2MW5 A;  2N9E B;  1PQS A;  1YJ1 A;  2LI5 A;  1UBI A;  1WI0 A;  2G4S A;  4WQO B;  2L7R A;  3ZIM A;  3U7D A;  3TCA A;  1U4A A;  3W1S A;  2IZV B;  4LJO B;  3QK0 A;  1SIF A;  3TL5 A;  4URK A;  2C7M B;  3DVG Y;  2JZ3 B;  3RZW C;  3OAW A;  3ZKJ C;  2MBQ A;  2LGX A;  1RLF A;  4GIV A;  3UQA A;  4ZRI A;  2AL6 A;  3H1U A;  3QAR A;  4WWO A;  3EC8 A;  2C5L C;  1J0G A;  1UZX B;  4DWF A;  2A4Z A;  3Q3F A;  5D6J B;  5L83 A;  3Q3J A;  3VUW A;  4IWO A;  2IO1 B;  4KZC A;  3V60 A;  2LD9 A;  3RYT A;  2CR5 A;  1WMH A;  3NY5 A;  3B0A A;  1WXS A;  4G50 A;  2JT4 B;  2ASQ A;  3WIM A;  3ZTD A;  4E3C A;  3APC A;  3M3J A;  4F7Z A;  3H9D A;  4FUL A;  1D3Z A;  2N1V A;  4GU2 A;  4RM9 A;  5AZG A;  2KVR A;  1IPG A;  1KLV A;  3N3K B;  5DCN A;  1WGH A;  1NDD A;  2JVC A;  4B6W A;  2C7H A;  2KFK A;  2BWE S;  1H4R A;  1R4N I;  3L08 A;  4E71 A;  1LXD A;  3QAQ A;  1E7U A;  3VH4 B;  1F9J A;  2IO0 B;  3A4R A;  1T0Y A;  1WM3 A;  1V9J A;  4XZ4 A;  3T8M A;  2V4L A;  3UIN B;  2CHW A;  3ZUN A;  3JYU A;  1WJU A;  1K8R B;  1OEY J;  2KD0 A;  2PPH A;  4M8N A;  3LDZ E;  5CHV C;  3R7Q A;  2B3A A;  1M94 A;  1WXV A;  2LAS A;  2ZPY A;  1V86 A;  4MSM B;  3HM6 X;  1UH6 A;  3D32 A;  1Q5W B;  2O6V B;  4HWI B;  1HE8 A;  3VTW A;  4EEW A;  4WJQ A;  3UIO B;  2LZ6 A;  2BYE A;  1C1Y B;  1P0R A;  2L8J A;  2JPH A;  5L95 C;  1NI2 A;  3ALB A;  2AWT A;  2KJR A;  2WDT B;  3MTN B;  1WZ3 A;  3A1Q A;  4II2 B;  2LGD A;  3RUI B;  4K7U A;  2YLM A;  3N30 A;  4K7W A;  5EDS A;  3MHS D;  2EKE C;  3DPD A;  2ZNV B;  2XK5 A;  2FCN A;  3N32 A;  2PE9 A;  4KIK B;  2DAF A;  1WX8 A;  1GG3 A;  3DVN V;  3M63 B;  2L0T A;  2PJH A;  1E8W A;  4BBN F;  2JWZ A;  2OJR A;  5D94 A;  2G45 B;  1WY8 A;  2ZJD A;  4BVU C;  1IP9 A;  3JW0 X;  4MJS B;  2Y5B B;  2KDF B;  2DEN B;  2L3Z A;  2M4N A;  2UYZ B;  2CU1 A;  4NY0 A;  5CTR C;  1WX7 A;  2L00 B;  1Z5S B;  4GDK A;  2KAN A;  2KZR A;  4FJY A;  2NBW B;  4J6I A;  4FN2 A;  2MA9 B;  2KWC A;  3ZTC A;  2KXJ A;  1WGG A;  1WXM A;  3R3M A;  4DBG A;  1WYW B;  1P98 A;  3L13 A;  4TUU A;  2KDB A;  3HIZ A;  4AP4 C;  2LVP A;  3PRP B;  2GOW A;  4NAW B;  5J18 A;  2KOX A;  1WGR A;  3HM3 A;  3ML9 A;  3PSE B;  3APD A;  4E74 A;  2JF5 A;  1UD7 A;  1YD8 U;  4ZRJ A;  3OJ4 B;  3T9L A;  2IBI B;  5LXI B;  5KHQ A;  3ZNG C;  4NJ7 A;  3UGB B;  3NS8 A;  1GC6 A;  1WZ0 A;  2KO3 A;  2KNB A;  2MP2 B;  2MQJ A;  3L17 A;  4WJP A;  2KLC A;  3H7P B;  4PYZ A;  4EFO A;  4HVB A;  1J8C A;  1GUA B;  1GC7 A;  2Z0D B;  3V62 A;  2GBR A;  1SE9 A;  4YL8 A;  1WM2 A;  2HE7 A;  1S1Q B;  2K8C A;  2NR2 A;  2ZNV C;  1OEY A;  3L16 A;  2N9P C;  4MGI E;  3VH3 B;  2KQS A;  4AWJ A;  2K25 A;  2M1M A;  2HJ8 A;  5AZF A;  1J19 A;  5BO4 B;  4ZDV A;  3KVF B;  2LXC A;  4BBN C;  2ZPN A;  3C0R B;  4LDT B;  3PVL A;  3DBL I;  1Y8R C;  2V1Y A;  2BKR B;  3WAP A;  2KHW B;  2HD5 B;  3VFK A;  2KTR B;  2NBU A;  2DAJ A;  1UGM A;  4W9L A;  2MRP A;  1EF1 A;  5E6N A;  4GOC A;  4WJO A;  1V49 A;  3QCA A;  1WH3 A;  3MJW A;  2WYQ A;  4W9I A;  3H7S A;  2O2V B;  4FJV B;  4II3 B;  4PS8 A;  1WR6 E;  2N9X A;  2GBN A;  1I42 A;  1WE6 A;  4I6N B;  1BT0 A;  4G3X B;  1E8Y A;  2DZM A;  4JL9 A;  4NJ6 A;  2IY0 B;  3U8Z A;  1RAX A;  1YX6 B;  3B1L X;  3ZNZ B;  2KFJ A;  1MG8 A;  3CMM B;  4HDO A;  4OVV A;  4X57 B;  2AEH A;  4IM2 A;  2MX2 A;  4K1R B;  2J0K A;  4NNJ B;  3VTU A;  1UEL A;  4BOZ B;  2CKH B;  2C60 A;  2D10 A;  1TZ1 A;  3KUD B;  3ZO5 B;  2LRU A;  3QIJ A;  4JLC A;  5DPR A;  3IFW B;  2KTF A;  5JH5 C;  5IA7 A;  5DPT A;  2LGY A;  4GDL B;  3L10 B;  3ONS A;  1E5W A;  3WAL A;  1QZE A;  4KVG B;  2BYV E;  2KC2 A;  4MGK E;  1ZGU B;  3QC8 B;  4G0N B;  4IM3 A;  4P7I A;  1KOT A;  4MGZ E;  2RD0 A;  4DHZ B;  3DBR I;  2FCM A;  4ICV A;  4MJS A;  2C7N B;  2V3S A;  3X23 A;  3UIP B;  2IYD B;  2I1K A;  1AAR A;  4WJN A;  3W1Y A;  3RZF A;  5TR5 A;  4LJP B;  4WAA A;  1GNU A;  3LJ3 A;  3APF A;  2N7D A;  3KW5 B;  5D2M B;  3EEC A;  3PT2 B;  2KMC A;  1LM8 B;  1WX9 A;  3PRE A;  3B08 A;  1V5O A;  4DK5 A;  1NBF C;  3TBL D;  2K39 A;  4W9F A;  3EHV A;  5AZH A;  4EZL A;  4KZ0 A;  4BFR A;  4GSW A;  1EUV B;  4HCP B;  4W9D A;  1ZW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...