2LRUA

Solution structure of the wnk1 autoinhibitory domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
GAMDPQEETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEMVESGYVCEGDHKTMAKAIKDRVSLIKRKREQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase WNK1
publication title Solution Structure of the WNK1 Autoinhibitory Domain, a WNK-Specific PF2 Domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 27
structure length 98
sequence length 98
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12202 OSR1_C Oxidative-stress-responsive kinase 1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2lruA00
2CHXA 3DBSA 3VHTC 4BOZB 2MBOA 3R3MA 3UGBB 1F9JA 2CHWA 3APFA 3IVFA 3DOWA 2ZNVC 1WY8A 2GBKA 1OGWA 2ZCBA 1T0YA 1XD3B 2LD9A 3OJ3A 4DDID 3PTFC 1XQQA 2PJHA 2J0JA 1LXDA 2KDBA 3SHQA 4GDKA 3C0RB 4A3OA 2O6VD 3PVLA 3NZSA 3ZRCA 4MSMB 4KZCA 2IYDB 2RD0A 4F7ZA 2JPHA 3ZIMA 4MDKE 4W9LA 2ZVNA 4IW0A 2MBBB 2DZMA 2MCNB 2N9PC 5J18A 1P3QU 1WGRA 3JW0X 3CF6E 1IP9A 2LVPA 2IY1B 3U8ZA 1WM2A 4TV3A 5IA7A 2XBBC 3QC8B 3M95A 3W1SC 2A4ZA 4NNJB 4NPNA 3N3KB 2K8HA 2LJ5A 3ML8A 5J2RA 1I42A 4FLHA 1UELA 4GMVA 1YD8U 4W9EA 2C9WB 3WAMA 4EOYA 3PT2B 1L7YA 2KJ6A 4W9CA 4BBNF 4KDLB 2MLBA 3M3JA 4AOFA 3PRMB 4MH0E 2JVCA 4HJKA 4KIKA 4WJOA 4CHKA 4DHJB 1C1YB 1TBEA 2HD5B 3NOBA 4FJZA 4OVVA 4W9FA 4ZYNA 2MBEA 2LRUA 1FXTB 5GMVA 4HPMB 2KVRA 4WWNA 1WI0A 2N4FA 1UZXB 1V81A 4FADA 2BYEA 4HK2A 3AI5A 2XK5B 3UINB 4EZKA 3V6CB 2KFJA 2NS5A 4RM8A 4MJSB 3A9KA 3OAWA 2UWQA 4PS8A 3WA0A 1GNUA 3IBEA 1P0RA 3L13A 4NAWA 2MQJA 3KYDD 3VUXA 2O2VB 3DDCB 4IG7B 2DAFA 1WXAA 5AZFA 3VTVA 2WWZA 3QCAA 3WAOA 1I35A 4M0WB 4NJ7A 4ANUA 2WX0A 3ZRFA 3DVGY 4DHZB 4PYZA 2C7MB 3CMMB 4KSLC 3ZTCA 1G6JA 2WX1A 2ZCCA 5KHQA 4ANVA 2C5LC 2GBNA 3MHSD 3V62A 1WZ3A 2UYZB 4MEMA 4AWJA 3T9LA 1A5RA 3OLMD 2WYQA 4BBNC 4A20A 3BINA 3A9JB 4GIVA 3RULA 2NBWB 2KLCA 2KC2A 4FJVB 3N32A 5CHFA 5LXHA 2YLMA 3APDA 5L95C 4GDLA 3KUDB 3DVNV 2KXJA 2GOWA 3H7PA 2AL6A 5DPRA 1WR1A 2DHZA 4TUUA 2FAZA 4MELA 4FHJA 3M63B 4IC7B 4OVUA 4GU2A 3RUIB 3UIOB 4WWPA 4EZLA 3ZKJC 1WMHA 2BPSA 3VDZA 4CO7A 1Z2MA 3M62B 1OEYA 3LJ3A 1LQBA 4ZRIA 3W1YA 3DVGX 4JQWC 3PHWB 1V49A 1Q5WB 2DZKA 1R4MI 1V5TA 4YL8A 4BKTA 1C3TA 3PRZA 1TZ1A 2AEHA 2R2OA 3QIJA 3U30A 1OTRB 2G45B 2L00B 4AP4C 1ZKHA 2K25A 1E5WA 2FIFA 2KOXA 3R7RA 2KANA 3ZTDA 4LCDE 4W9JA 3ZNID 5CX3A 1TTNA 3TCAA 2IO0B 2JF5A 1RFAA 2B3AA 2Z0DB 3HK0A 2JXXA 4BFRA 1KOTA 1WM3A 2D3GA 2N1VA 3V61A 4EEWA 2JWZA 2K6DB 3K9OB 5D94A 1VCBA 2KWCA 3QA8A 4KDIC 2JZ3B 2LASA 4W9GA 1E8XA 4K81A 1RRBA 1KJTA 3ML9A 1WZ0A 1YQBA 3U7DA 2LGDA 3HM3A 4W9DA 1JRUA 3SDLC 2W9NA 4DK5A 2J0KA 3QX1A 1SE9A 2DENB 2GMIC 2K1FA 1WYWB 4W9HA 2KO3A 1V9JA 3K9PB 5DPWA 2LZ6A 2LWPA 3CSTA 3Q3FA 5JZEB 3GZNI 3L16A 3TMPB 3UF8A 1WX9A 3X0WA 2Z0EB 4ASWC 4ICVA 3DBRI 3QAQA 2VRRB 1UBQA 3JVZX 4LJPB 4NQLB 4XZ4A 2AYOB 2LGYA 1Y8RC 3KW5B 2GBMA 3UIPB 4MSQB 2L0FA 2ZPNA 1WXVA 1E7VA 2MBHA 3ALBA 4FJYA 2ZPYA 4HWIB 2IO2B 1LFDA 2KMCA 2LXCA 4LDTB 1YJ1A 3VUWA 4WJPA 3VXWA 3ZNZB 2BKRB 3H9DA 2D11A 2D2QA 2MP2A 1V2YA 5IAAC 4E3CA 3AU4A 3N30A 2MX2A 2NPTB 5AEKB 4WQOB 3IFWB 2JY6A 4PS7A 5KHOA 4ZRKA 5D6JB 2MP2B 2KWVB 3IG3A 2D10A 4WWOA 3NHEB 1RAXA 1SIFA 4G50A 4GN1A 1EUVB 3TIXA 2BGFA 2R2QA 4IWOA 2C7HA 2GBJA 2NR2A 2OOBB 3KH0A 2YVCA 2DYBA 5JHBA 2EKEC 3ZNGC 3VTWA 1WXMA 2KKCA 1WGGA 3GOEA 4FULA 2C60A 2BYVE 2XK5A 3CSFA 3KUCB 3DVNU 3O65B 4G3XB 1J0GA 1H8CA 3PHXB 4MJSA 2BKFA 4PS3A 1EF1A 2KD0A 1NI2A 2O2VA 1WJUA 2KWUB 3UQBA 2FCSA 3QARA 2O6VA 4EUTA 1TGZB 1L2NA 2G4SA 2MW5A 1UGMA 4EFOA 1IYFA 4IWQA 5D7GA 2ZNVB 1X1MA 2A5UA 3DCGA 5JH5C 2O6VB 1WH3A 4E74A 3QQ8B 3IHPC 1V80A 2DYMA 3BY4B 3ECIA 4CYEA 3DBHI 4K7UA 1QZEA 1V5OA 3A4SC 3LDZE 3VVWB 3W1SA 3I3TB 3V60A 3A9JA 4IM3A 2GBRA 2L0TA 2LRWA 4EKUA 2DZIA 4HCPB 4HXDA 1Q0WB 3JSVB 4W9IA 3WALA 2IY0B 2NVUI 2ZZPB 2LI5A 3L10B 2IO1B 1P9DU 2I1KA 4BKSA 1GUAB 2BWES 2KJRA 1ZW7A 4HPLB 2AL3A 5J17A 1GJZA 4DDGD 5DPTA 3ENEA 3UQAA 2IO3B 4ZDVA 2L8JA 4KSKC 4ANWA 4HLEA 4ZRJA 2RGFA 4URKA 2CS4A 1WE6A 2FUHB 4ICUA 5DCNA 4E71A 4FA6A 3A1QB 2XEWA 2FCMA 4AJYB 3QK0A 1WX8A 1BT0A 1AARA 1P1AA 5CHVC 3RZWC 2LVQA 3AXCA 4RMAA 2J0MA 2L7RA 1YIWA 3TJPA 2DYOA 5AZGA 3ZLZA 3PZDA 5E6NA 5E6PA 3P2BA 3ZUNA 2JRHA 5JHAA 2HE7A 2KDIA 4WAAA 5CTRC 4II3B 1J8CA 4XX5A 2PE6B 3A4RA 4JL9A 4XC2A 1WXSA 2M17A 1WF9A 3VH3B 4B6WA 2K6QA 2KQSA 3EFUA 2HTHA 2FNJB 2KLGA 3D32A 4A3PA 1UH6A 1KM7A 3B08A 3L54A 4MGYE 1OEYJ 4JIOU 2KHWB 2KNBA 1V86A 2J7QB 2V3SA 4WJQA 1EO6A 1NDDA 1UBIA 4FN2A 2CU1A 1V6EA 3H7SA 3ZW3A 5HKHA 4TKNA 4IWPA 2DX5B 4TQ1A 5C23A 3DPDA 4I6PA 5AZHA 2BF8B 2KFKB 2CR5A 1OQYA 3JYUA 3WIMA 5BO4B 2ASQA 2K8CA 2QHOA 2KTRB 4AJWA 4K7WA 1WFYA 4M8MA 4NQKE 2M0XA 5FR6A 3EC8A 3KVFB 5DPSA 4DHJD 1WGHA 2EMSA 2LXAA 3QJZA 2MSED 2NPTA 2L3ZA 2DZJA 2REXA 4F1SA 4DHZE 3PPAA 1ZGUB 3EECA 5C1ZA 4JGHB 3VH4B 1WX7A 1E90A 1S1QB 4BVUC 3PLVA 1PQSA 3ZNHB 2IZVB 2JT4B 2ZVOA 2KN5A 2N7EA 1GG3A 4GDLB 2L05A 1WE7A 2KDFB 4GGQA 1U4AA 2G4DB 3HIZA 2LGXA 4GXBA 1IPGA 2D07B 3VQIA 4BOSC 1E7UA 2M1MA 2JRIB 3PSEB 4X57B 4G0NB 2FCQA 2OJRA 4J6IA 3A33B 4W9KA 4HCNB 2CKHB 4GDKB 2Y5BB 5L83A 4IM0A 3ONSA 2KQ7A 3H1UA 1VD2A 1XT9B 3PV1A 5G55A 3DBLI 3V6EB 3NZUA 3L08A 1ISNA 3DQVA 4M8NA 3ZVVA 2KX3A 1E8ZA 4B95A 1RLFA 2M8SA 2MA9B 4I6LB 2CHZA 3NY5A 1K8RB 3RYTA 3L0WB 3RD2A 1WJ6A 3TBLD 2N7DA 2ZEQA 2K39A 1E8WA 5TR5A 2PE9A 4II2B 4BKSD 2PPHA 3JSVA 5LXIB 2KK8A 4GOCA 4KV2A 2M4NA 2N9XA 2HJ8A 1R4NI 1CMXB 5LLIA 2LVOA 3TL5A 2JUOA 2RR9A 3QHTA 3QWZB 3EHVA 3S2AA 2BWFA 1Q1OA 4KIKB 4MM3A 4WJNA 4HDQA 3X23A 4BKGA 1M94A 1NBFC 1D3ZA 2I1JA 3PLUA 1WIAA 2MWSB 3HHMA 4EZJA 3MTNB 4AUQC 2KJHB 5EDSA 4GSWA 3VAWA 2NBVB 2DAJA 3VUYA 1E8YA 4G11A 2RSUA 1WGDA 3A1QA 3HM6X 3RZFA 3VFKA 3PS6A 2K8BA 4NJ6A 2G3QB 2KX0A 3A9KB 1H4RA 4IM2A 2WDTB 4HDOA 4NAWB 4KZ0A 1EF5A 4PYUA 2V4LA 2BYFA 1WR6E 3OJ4B 1SGHA 1YX5B 3APCA 3VTUA 2FCNA 3B1LX 2LUEA 2KDEB 1GC6A 4K1RB 3RCZA 2L76A 2ZJDA 4TQ0A 1J19A 1LM8B 3SU8X 1KLVA 4MGKE 4MGIE 1MG8A 1WJ4A 3H6NA 4DWFA 3AULA 4F8CB 4HVBA 2FIDA 3SD5A 4K7SA 4NY0A 2V1YA 4FHKA 3PGEA 4I6NB 2AWTA 4DBGA 3H7PB 2PEAA 1Z5SB 3ZDMC 4DXAB 2N1WA 4JLCA 4LDTD 2KMAA 2NBUA 5D2MB 2N9EB 1WMHB 4IUMB 2KFKA 1HE8A 2C7NB 3KYCD 1S3SG 3WAPA 1YX6B 3R66C 3AU5A 2KC1A 4P7IA 4RM9A 5CHWA 5G2NA 2MBQA 3WANA 3PRPB 2KTRA 2IBIB 4LJOB 4GB9A 2MRPA 2JZZA 3MJWA 4FBJB 4ANXA 1WRDB 3NS8A 2NCNA 3ZO5B 2KZRA 1P98A 1UD7A 2KTFA 2RPQA 3L17A 3R7QA 3PREA 4B9KA 3RT3B 3T8MA 4MGZE 1WJNA 4KVGB 4N9F4 3B0AA 3Q3JA 3ZDTA 1GC7A 2EMTA 3KUZA 5E6OA 1WGYA 2Z59B
chains in the Genus database with same CATH superfamily
2CHXA 1YMHE 1ZOYB 3R3MA 3UGBB 2CHWA 3IVFA 3GZNB 1YJIA 1XQQA 1DGJA 2O6VD 3FC4A 3ZRCA 2RD0A 2JPHA 4W9LA 2ZVNA 2MBBB 2DZMA 1P3QU 4AS1A 1JWBD 3AEAB 3BYTB 2MJDA 3FAHA 1IP9A 1L5PA 4HRSA 3CWIA 4HPPA 4NNJB 4NPNA 3ML8A 2M56B 5J2RA 2WXKA 4GMVA 4W9EA 1P7EA 1EWYC 2C9WB 3W5VB 2QEJC 1L7YA 2KJ6A 3M3JA 2PW9A 2RDHA 4JWSC 1FNVA 4KIKA 1ROEA 1C1YB 4FJZA 3NOBA 4ZYNA 2LRUA 4HPMB 4WWNA 1ZPSA 2N4FA 3V6CB 2UWQA 3WA0A 2LEKA 3VUXA 1P0RA 2PTLA 4IG7B 1WGKA 2JSVX 3WAOA 4M0WB 1KFYB 3ZRFA 5EE1A 4PYZA 2C7MB 5BMGA 1G6JA 3MHSD 4RGTA 2UYZB 4AWJA 2LUMA 2GI9A 1PGAA 2NBWB 4J3OD 2WU5B 2KLCA 1GAQB 3AB5A 3N32A 3APDA 2KXJA 2GOWA 1F1HA 1HXYD 2AL6A 2GRIA 4DXGA 4FHJA 4IC7B 2X8XX 3ZKJC 4CO7A 1Z2MA 1OEYA 1JWAD 1V49A 4L1BA 1L4DB 1R4MI 3IT4B 4BKTA 3QIJA 2AEHA 4ZOHC 2NTTA 2WDQB 1E5WA 2K25A 2FIFA 2K9XA 1AYFA 4TMAB 3TCAA 2IO0B 1N60A 2JF5A 2N9KA 2BYTA 3HK0A 5EE0A 1L0XB 1C78A 2JWZA 1UWXA 2JZ3B 1HEZE 1RRBA 1KJTA 2LGDA 3HUIA 2RDGA 3SDLC 1JRUA 1PUTA 5LNK1 2DENB 1ZDVA 1V9JA 1BUIC 3Q14C 1C4CA 3X0WA 2Z0EB 4ASWC 1T5XD 1FIQA 2AYOB 4P16A 3GS2A 2WXJA 2QMTA 2V0GA 1ZE3D 3MJ5A 3N9YC 1WXVA 1KH0A 1NENB 1LFDA 2LXCA 2IJ0A 2AQ1B 3VUWA 3VXWA 2JYTA 3ZNZB 4S17A 2D11A 2D2QA 1V2YA 4EE2A 4RCOA 1UF0A 2NPTB 1I4RA 4WQOB 2JY6A 3AE9B 2BVCA 4G50A 1EUVB 1FFUA 2R2QA 4IWOA 3Q6BA 4FULA 1WXMA 2KKCA 2INCC 3KWVA 2BYVE 4G3XB 3PHXB 3AM9A 2FCSA 1UGMA 4M0WA 4EFOA 1IYFA 2Y3AA 1X1MA 3Q8CA 2TSSA 2O6VB 2V3PA 4LLGM 2R61A 3BY4B 3AEFB 3Q3OC 1V5OA 3LDZE 3VVWB 3V60A 4IM3A 4HCPB 4HXDA 2QILA 5D3DA 1HA5A 3WALA 1PFDA 2LI5A 1VJKA 1YQ4B 2IO1B 2I1KA 5GXGB 3AEBB 1T3QA 1XLPA 1DOIA 1ZW7A 5J17A 2AL3A 1GJZA 2E6XA 5DPTA 3RMKC 4ZDVA 2IGGA 1MFWA 4KGRA 4HLEA 2CS4A 4E71A 3A1QB 4AJYB 3AMZA 3QK0A 2AX5A 3AXCA 2J0MA 1WYGA 4MACA 5AZGA 1PGXA 2ZW1A 2KQ4X 3ZUNA 2HE7A 1B9RA 1J8CA 2PE6B 4XC2A 4JL9A 1FRDA 1XLOA 3VH3B 4B6WA 4YXDB 3ZXVA 3EFUA 3L54A 4AQ7A 4P1BC 4JIOU 4A8XC 2V3SA 4WJQA 1QLBB 4FN2A 3LB8C 1V6EA 3TEZA 2G1EA 2DX5B 1FEHA 2CR5A 3JYUA 2WS3B 1L6VA 2ICIA 2QHOA 2K5PA 4BZAA 2KACA 2EMSA 3OWEB 4PT5A 2NPTA 2L3ZA 2DZJA 4F1SA 4DHZE 4JGHB 1PQSA 4D2KA 4LTUA 2DWQA 3C8YA 1IPGA 2WXHA 3UI3A 2JRIB 4G0NB 4GDKB 2WDVB 1JWMD 1TT5B 1BXTA 3V6EB 1ISNA 4M00A 4M8NA 4B95A 3AEEB 3RYTA 2CHZA 3L0WB 1HTQA 2PVOD 3AE4B 2V4IB 4OZBA 4BKSD 2PPHA 5LXIB 2K3UA 1R4NI 2LVOA 1UUPA 2KWDA 3QHTA 4LNNA 2J42A 2QCZA 3X23A 1FCCC 4BKGA 1QILA 1D3ZA 4US9A 2I1JA 2LHDA 2MWSB 3MTNB 4GSWA 2DAJA 3NVZA 3A1QA 1DYQA 3HM6X 5FR3A 2G3QB 1SEBD 1H4RA 4IM2A 4HDOA 4LNOA 1K50A 4KZ0A 1MG4A 1EF5A 1WR6E 1QOGA 1YX5B 1UNSA 2LUEA 4JX1C 4LK0M 3RCZA 1J19A 1N61A 2OHFA 3C19A 3Q8FA 3SU8X 1N6ZA 4DWFA 4IKGA 3Q3NC 2V1YA 3PGEA 4NAMA 2Y5PA 2YEPB 2WXFA 4DBGA 2PEAA 1FMAD 4DXAB 2N1WA 5D2MB 1YN4A 4IUMB 1PGBA 2IPKD 3I5JC 1HE8A 2C7NB 3KYCD 4ACFA 3R66C 2KC1A 3Q3MC 5CHWA 5BYQA 2IBIB 4LJOB 1SE4A 2MRPA 3MJWA 2NTSA 5H92C 1UD7A 4C56C 3R7QA 4B9KA 3ZDTA 1GC7A 2BWES 3KUZA 1C77A 3DHGC 1WGYA 4ZRQA 4IDIA 5IN7A 4BOZB 2MBOA 3DOWA 2ZNVC 2LD9A 1F77A 2J0JA 1LXDA 3SHQA 4GDKA 4A3OA 3PVLA 2N0SB 1GB1A 3W9CB 1VRAB 2N9PC 4YWGG 2L52A 2IY1B 4TV3A 2XBBC 3M95A 1UGJA 2LJ5A 4N59A 1I42A 4FLHA 3PT2B 4R3DA 4W9CA 4BBNF 3ZJVA 1FNWA 4KDLB 3RFZB 2PKOA 4RF1A 4XDCA 4HJKA 4CHKA 2HD5B 3AE2B 3L4PA 4OVVA 2MBEA 5GMVA 1PDXA 3AN1A 1WI0A 4XYCA 1V81A 3AE3B 4HK2A 3UINB 1OQQA 2NS5A 4PS8A 2L83A 3IBEA 2MQJA 4CQNA 5AZFA 3VTVA 2D3BA 4XDDA 4ANUA 3DVGY 4KSLC 2ZCCA 4ANVA 1KLUD 4C80A 1AW7A 3V62A 2HDEA 3OG5A 4BBNC 3RULA 1VZ7A 2CU3A 2KC2A 1JCKB 2D3CA 3BWUD 4WQMA 4C4VA 4KGTA 2V3NA 1WR1A 2DHZA 5T8IA 3M63B 2BB6A 2JU6X 4EZLA 1XLQA 2BPSA 2MHJA 3RNCC 3LJ3A 3DVGX 3CIRB 1YNTE 1Q5WB 1E7PB 1NEKB 2L00B 1NYQA 2HJ1A 4AP4C 1ZKHA 1F2RC 1I4XA 3R7RA 3ZTDA 4LCDE 5IO9A 2SEBD 1SE2A 1TTNA 1CJEA 1ET9A 4BFRA 1J7CA 2D3GA 4Q2JA 1VCBA 3QA8A 4XGAB 4W9GA 4K81A 1TY2A 3ML9A 4HJGE 2W3RA 3U7DA 5E6JA 3IT6B 2BB5A 2J0KA 1SE9A 1WYWB 2KO3A 3K9PB 1J7AA 3Q3FA 3L16A 4TSSA 3U4EG 3MP9A 4YSZB 3DBRB 2WXNA 2GBMA 3UIPB 4MSQB 2L0FA 4FJYA 4HWIB 4BAXA 3N1ZC 4WJPA 1ACCA 3U2SC 2HTME 1L0VB 4ZHOA 1NI3A 3AU4A 3N30A 2MX2A 1TY0A 5AEKB 2KWVB 3IG3A 2D10A 4WWOA 3NHEB 1SIFA 3NVVA 4ITKA 3BVGA 1A70A 5I4DA 2GBJA 2NR2A 5JHBA 3DWMA 2DYBA 4OHJA 3BVZA 3GOEA 1J0GA 1H8CA 1HZ5A 3IAS1 1WJUA 3UQBA 1CQVA 2DBYA 2K22A 4RFBA 1TGZB 4ZRPA 3BIID 1T6BX 2WXIA 3QQ8B 3RN9C 3ECIA 4S0RA 1JRPA 1QZEA 3DBHB 1TS5A 2DZIA 3TEXA 1Q0WB 3JSVB 4NZLB 3L10B 2LJIA 2ZZPB 1CZPA 2QC8A 1P9DU 4BKSA 2WGSA 3ENEA 1L6UA 2LGIA 1XLNA 2RGFA 4L2YA 1WE6A 2AQ2B 4K3BA 5DCNA 4FA6A 2XEWA 2KAJA 1WX8A 5CHVC 2EKIA 2LVQA 3PZDA 5E6PA 3P2BA 2L32A 5JHAA 2KDIA 4WAAA 4II3B 3V05A 4XX5A 1MHXA 3A4RA 1MHHE 2N9LA 1WF9A 4P6VF 3Q8EA 3NUHB 2KLGA 2WXLA 4A3PA 3TEWA 1KM7A 1YOVB 4MGYE 2KNBA 2CU1A 3H7SA 1EU4A 2IDYA 4TQ1A 2XN9C 1L0YB 5AZHA 5BMIA 3WIMA 3Q8BA 4AJWA 1I4HA 1ZDXA 4K7WA 1WFYA 5DPSA 4DHJD 2MSED 4RGMA 5C1ZA 3T3OA 1SXTA 4M01A 1QOBA 2QIEB 5C3JB 2IZVB 1D5ZC 1E9MA 1I7HA 1WE7A 2OJWA 1Q10A 4GXBA 5BMHA 1E7UA 5FK9C 1FXAA 3PSEB 1I4QA 4J6IA 1N5XA 4A90A 3ONSA 5G5GA 2KQ7A 2WQYB 5G55A 1K53A 3KWLA 3NZUA 2KX3A 4A6QA 4ZYSA 1MVKA 2DNFA 3PO0A 4YT0B 1E8WA 4II2B 3JSVA 4GOCA 4KV2A 3AEGB 2N9XA 1CMXB 5LLIA 3AECB 3QWZB 3S2AA 4RGNA 1Q1OA 4WJNA 4HDQA 1J7BA 1AN8A 1NBFC 1WSPA 3I57A 2WXRA 3PLUA 1GB4A 5EDSA 2KJHB 2WXPA 1CK1A 1WGDA 3VRAB 2M0AA 3A9KB 2WDTB 4PYUA 1KTKA 1SGHA 2GB1A 2WDRB 1FO4A 2KDEB 5FKAC 3AV8A 2BW2A 2ZJDA 1LM8B 1KLVA 3B9JA 4HVBA 4K7SA 4FHKA 3U52E 4I6NB 3H7PB 1Z5SB 4HKZE 3ZDMC 3N1YC 2MJ3A 1SSNA 1S3SG 5G5HA 2GLSA 2MBQA 3B2FA 2INDC 3NS1A 2VH1A 4JE3B 4DXFA 3B2GA 1WRDB 3NS8A 1C76A 1P98A 1V97A 1GPXA 3FKYA 3PREA 3T8MA 1WJNA 2OEDA 4KVGB 5H8YE 1FFVA 1RYJA 5E6OA 3CSFA 2FE8A 3DBSA 3VHTC 3NRZA 1F9JA 1WY8A 2JWUA 4N58A 2ZCBA 1T0YA 4DDID 3PTFC 4K3CA 2KDBA 1AWDA 4MSMB 4UDUC 2IYDB 3IXSA 3ZIMA 3ETRA 4IW0A 3KQ4A 3CF6E 3U8ZA 1QOAA 3N3KB 3SFEB 1YD8U 2VH2A 3W2DA 3WAMA 1ZXIA 2J52A 4DHJB 1TBEA 3ZJTA 4W9FA 3E9SA 2G9HD 4M02A 4P1CC 3EA6A 3RNFC 4OVZA 4MJSB 3A9KA 4L23A 2W3SA 3L13A 3KYDD 2ZW0A 5MPOA 3DDCB 2DAFA 1WXAA 2WWZA 3QCAA 1P7FA 4DHZB 3CMMB 1JW9D 4YTNB 1RWSA 3FILB 2W55A 2C5LC 2H89B 2WXGA 3R8BA 2RPVA 1A5RA 3OLMD 2WYQA 4A20A 1VZ6A 3A9JB 4GIVA 1D4BA 3RNAC 4FJVB 5CHFA 2YLMA 5L95C 3KUDB 1EM7A 4YSYB 2KDMA 3H7PA 3EUB2 4MELA 4GU2A 4WWPA 3VDZA 3M62B 4C4VB 3W1YA 4JQWC 3PHWB 2DZKA 1C3TA 1V5TA 3PRZA 1TZ1A 2R2OA 1E6EB 3U30A 1OTRB 1FNUA 1R7SA 1ENFA 1JWSD 1V1PB 3TSSA 1SJED 1YQ3B 3Q8AA 3V61A 2N1VA 1MJDA 3K9OB 5D94A 2KWCA 1D5XC 2JQRB 1C4PA 1QOFA 1E10A 3I63C 1WZ0A 4RH6A 5BYRA 3HM3A 2KMMA 1I4GA 2KN4A 1TKGA 4O1NA 1IBXB 2JXTA 4W9HA 5DPWA 1SJHD 2LWPA 3CSTA 3GZNI 3UF8A 1WX9A 2ONQA 1GOZA 3DBRI 1UBQA 4LJPB 4XZ4A 3U7ZA 1DOYA 1B1ZA 2LGYA 1Y8RC 3KW5B 2N7JA 2WXQA 4RNAA 1E7VA 2ZPYA 4QAYA 2IO2B 5D3IB 4B0MA 5HFYA 1YJ1A 2BS4B 2BKRB 3H9DA 2ACZB 1BMLC 1F2RI 4YTMB 1PYWD 2MP2A 5IAAC 3W5UB 3AE8B 3IFWB 1YN3A 3HRDD 4ZRKA 5D6JB 1STEA 1ESFA 4GN1A 1RAXA 2ON8A 2WXMA 3MC0B 3TIXA 2BGFA 2BBCA 4GLSC 2EKEC 3VTWA 1WGGA 2PVGC 3KUCB 3O65B 3Q69A 4MJSA 4PS3A 1EF1A 1N63A 2KD0A 1NI2A 1VDVA 3MHZA 3RNBC 1L2NA 4A9AA 2MW5A 3P4PB 5D7GA 2ZNVB 3DHHC 3FILA 4E74A 3IHPC 3DBHI 4K7UA 1JALA 3A9JA 4US8A 2RMMA 3AH7A 2L0TA 4EKUA 2IY0B 1GUAB 4MM3B 2KJRA 4JWUC 4DDGD 1FPYA 1VZ8A 4KSKC 3P42A 1SE3A 1V8CA 4ZRJA 2W54A 2B76B 1QF6A 2FCMA 2WXOA 1AARA 1P1AA 1WRIA 1V1PA 4C7ZA 2L7RA 2KT7A 1XCTL 1YIWA 3TJPA 2DYOA 2JRHA 1WWTA 1KRHA 2K6QA 4C00A 2KQSA 1E0ZA 5AUIA 1IBXA 2FNJB 3D32A 3B08A 1OEYJ 4KGSA 4RF0A 4DQOC 1EO6A 1NDDA 1T0QC 4ARIA 1TS2A 3ZW3A 5HKHA 2INPE 5C23A 1VR9A 2BF8B 3R2IA 3N20C 3ZYYX 1JMLA 5AUKA 4M8MA 2UU7A 1UWMA 4LNFA 3KVFB 2LXAA 2JX5A 3VR9B 3PZ8A 3MC9A 3VH4B 1E90A 1XF5L 4H2AA 2JT4B 4XE0A 1T0SC 4GDLB 2KYWA 1EWCA 4HEA1 1U4AA 2LGXA 2AQ3B 3VQIA 2H88B 2M1MA 2FCQA 4W9KA 4HCNB 3AEDB 2CKHB 2WNMA 2Y5BB 5L83A 4IM0A 1FRRA 1VD2A 1XT9B 2QSDA 3DBLB 1RLFA 4I6LB 1K8RB 4FXCA 2ZEQA 2K39A 3LXFA 2PE9A 2SAKA 2KK8A 2M4NA 4NJCA 1EU3A 2BWFA 4MM3A 1NYRA 3P4SB 1WIAA 3HHMA 4EZJA 3VUYA 1E8YA 3IAM1 4G11A 2RSUA 3VFKA 3RZFA 3PS6A 2KX0A 3MFGA 2MJEA 1IGDA 4NAWB 3OJ4B 5JXVA 3APCA 2Z8LA 1M4VA 2PMVA 1GC6A 1K52A 2QDFA 2L76A 1TS3A 2JZPA 3E56A 1TKYA 1C79A 4MGKE 1WJ4A 3AULA 4F8CB 2FIDA 4NY0A 2BT6A 2LGSA 2BQQA 4KKIA 4JLCA 4LDTD 2PIAA 1WMHB 1HTOA 1QT9A 1YX6B 2CJNA 3Q2AC 4LNIA 2MH7A 2J53A 3PRPB 4KKJA 2D3AA 5C2TB 4ANXA 2KZRA 1N5WA 3P63A 3RT3B 4N9F4 3Q3JA 5IKCM 2EMTA 4GDLA 3WANA 3LYYA 3N1XC 2BTEA 3APFA 3GE3C 2GBKA 1OGWA 1XD3B 3OJ3A 3SR6A 1QQRA 2PJHA 3C0RB 3NZSA 4KZCA 4F7ZA 1TZOA 4MDKE 3HVDA 2MCNB 3TEYA 5J18A 1WGRA 3JW0X 2LVPA 1WM2A 5IA7A 3QC8B 3W1SC 2A4ZA 4PK1A 2K8HA 3I9V1 1UELA 3AE7B 4EOYA 3GE8C 1IUEA 3ABVB 2W82A 2DLBA 2MLBA 3VRBB 4AOFA 3PRMB 4MH0E 2JVCA 4WJOA 3BZDB 1FXTB 5EE9A 4N6EB 2KVRA 4B0EA 1RM6C 1UZXB 4FADA 2BYEA 3AI5A 3P4QB 2MEKA 2XK5B 3BK2A 4EZKA 2L1AA 2KFJA 4RM8A 3OAWA 1GNUA 1XO3A 2INNE 4NAWA 2O2VB 3DWGC 1ET6A 3T3NA 1I35A 4C7YA 4NJ7A 1DOXA 2WX0A 2VZKD 3ZTCA 2WX1A 3RI7C 4WIPA 5KHQA 2GBNA 3EFCA 1YJJA 1D6EC 1WZ3A 4MEMA 3T9LA 1NVID 2WLBA 3BINA 4XWWA 5LXHA 1KLGD 3DVNV 1ZXHA 3KLSX 2LFIA 5DPRA 5BYSA 2BS2B 4A55A 4TUUA 2FAZA 4OVUA 3UIOB 3HVZA 3RUIB 3WCQA 2QJLA 1WMHA 1FXIA 4ZRIA 1LQBA 4WH4A 4YL8A 1R4MB 2G45B 3J9CA 2KOXA 2KANA 3AE5B 2NMQA 3PZ7A 4W9JA 3ZNID 5CX3A 1SF0A 3NZ3A 1RFAA 2B3AA 2Z0DB 2JXXA 1MPEA 1KOTA 1TS4A 1WM3A 4EEWA 2K6DB 2Y5CA 4KDIC 2LASA 1E8XA 2I38A 1YQBA 2BS3B 2JYEA 4W9DA 2W9NA 4DK5A 3QX1A 1JROA 1OQRA 2GMIC 2K1FA 2RDBC 3NG0A 1XCQL 4HKQA 2LZ6A 5JZEB 3V3XA 1SBBB 5HI1A 3TMPB 4OZAA 4ICVA 3QAQA 1F0ZA 2VRRB 3JVZX 4NQLB 5TSSA 1L4ZB 1TIFA 1QKZA 3SFDB 2ZPNA 2MBHA 3ALBA 3NVWA 2KMCA 4LDTB 3DHIC 2YEPF 2J4XA 4E3CA 1N62A 4PS7A 1FCLA 5KHOA 2MP2B 1XXGA 3NJTA 2LHEA 1ZUD2 3AE1B 1JQ4A 2C7HA 3EGRA 2OOBB 3KH0A 2YVCA 3ZNGC 2C60A 2XK5A 3DVNU 2BKFA 4ZHPA 2O2VA 2KWUB 3QARA 2O6VA 4EUTA 3ZGZA 2G4SA 2I2YA 4IWQA 2A5UA 3DCGA 5HHDG 5JH5C 1WH3A 3RNEC 1V80A 2DYMA 3TUOA 4CYEA 1SIJA 3A4SC 4WWMA 3W1SA 3I3TB 2K0PA 1VLBA 2GBRA 2LRWA 4OZCA 2FUG1 4W9IA 3NVYA 2Z59B 2NVUI 1FM0D 2KVZA 1OFFA 4HPLB 3UQAA 2IO3B 4MT5A 2L8JA 4ANWA 4URKA 5EE3A 4ICUA 2FUHB 4RGOS 1LO5D 1BT0A 3RZWC 4HROA 2EELA 3R2TA 4REZA 4RMAA 1IGCA 3ZLZA 5E6NA 2CJOA 2WHIA 5CTRC 3RNGC 1WXSA 2M17A 3ZXRA 2VZKB 2HTHA 1UH6A 4WAFA 2KHWB 1V86A 2J7QB 1HQRD 2FBWB 3VR8B 1UBIA 1YN5A 4TKNA 4IWPA 3DPDA 4I6PA 2KFKB 1OQYA 3BYYB 3O13A 1K51A 5BO4B 5IP4D 2ASQA 2K8CA 1C9FA 2KTRB 4NQKE 3URYA 2M0XA 5FR6A 1KF6B 4MH8A 3EC8A 1WGHA 3QJZA 1D5MC 2REXA 1WXQA 3PPAA 4LNKA 1ZGUB 3EECA 1WX7A 1S1QB 4BVUC 3PLVA 3ZNHB 2XNAC 2ZVOA 3BVMA 2KN5A 2N7EA 1GG3A 2L05A 2KDFB 4GGQA 3HIZA 2G4DB 4ARCA 2D07B 1TJEA 4BOSC 1RFKA 4X57B 2OJRA 3A33B 2Q5WD 3AE6B 3H1UA 3PV1A 2WU2B 4IOIE 5HG2A 3DBLI 1XEEA 3L08A 3DQVA 3ZVVA 1E8ZA 3P1MA 2M8SA 1HZ6A 2MA9B 3NY5A 1Y56A 3RD2A 1WJ6A 3TBLD 2N7DA 3ZJUA 5TR5A 1C4AA 2PLPA 4YTPB 2HJ8A 2X38A 3TL5A 2JUOA 3H8HA 2RR9A 1R4NB 3EHVA 4KIKB 1M94A 4YSXB 1FD6A 4AUQC 3VAWA 2NBVB 3RPFC 2K8BA 4NJ6A 1TKEA 2V4LA 2BYFA 2LMCA 1SB3C 3VTUA 2FCNA 3B1LX 1I4PA 4K1RB 4JPSA 3MC8A 4TQ0A 3P4RB 4WURA 4MGIE 1MG8A 3H6NA 1MI0A 2E3TA 2WP9B 4XWTA 3SD5A 1TYGB 2IGDA 1ZP0B 3ZQ4A 2V9HA 2AWTA 3GP7A 1F52A 3SEBA 2KMAA 2NBUA 2N9EB 2KFKA 3WAPA 1JWUD 3AU5A 4KX6B 2D5GA 4P7IA 4RM9A 1V1OA 5G2NA 2IGHA 2KTRA 4GB9A 2JZZA 4FBJB 3BK1A 2NCNA 3ZO5B 3GB1A 2KTFA 2RPQA 3L17A 4OW0A 5IOIA 4MGZE 3B0AA 1T0RC 1LGRA 4USAA 2M19A
chains in the Genus database with same CATH topology
2CHXA 3DBSA 3VHTC 4BOZB 2MBOA 3R3MA 3UGBB 1F9JA 2CHWA 3APFA 3IVFA 3DOWA 2ZNVC 1WY8A 2GBKA 1OGWA 2ZCBA 1T0YA 1XD3B 2LD9A 3OJ3A 4DDID 3PTFC 1XQQA 2PJHA 2J0JA 1LXDA 2KDBA 3SHQA 4GDKA 3C0RB 4A3OA 2O6VD 3PVLA 3NZSA 3ZRCA 4MSMB 4KZCA 2IYDB 2RD0A 4F7ZA 2JPHA 3ZIMA 4MDKE 4W9LA 2ZVNA 4IW0A 2MBBB 2DZMA 2MCNB 2N9PC 5J18A 1P3QU 1WGRA 3JW0X 3CF6E 1IP9A 2LVPA 2IY1B 3U8ZA 1WM2A 4TV3A 5IA7A 2XBBC 3QC8B 3M95A 3W1SC 2A4ZA 4NNJB 4NPNA 3N3KB 2K8HA 2LJ5A 3ML8A 5J2RA 1I42A 4FLHA 1UELA 4GMVA 1YD8U 4W9EA 2C9WB 3WAMA 4EOYA 3PT2B 1L7YA 2KJ6A 4W9CA 4BBNF 4KDLB 2MLBA 3M3JA 4AOFA 3PRMB 4MH0E 2JVCA 4HJKA 4KIKA 4WJOA 4CHKA 4DHJB 1C1YB 1TBEA 2HD5B 3NOBA 4FJZA 4OVVA 4W9FA 4ZYNA 2MBEA 2LRUA 1FXTB 5GMVA 4HPMB 2KVRA 4WWNA 1WI0A 2N4FA 1UZXB 1V81A 4FADA 2BYEA 4HK2A 3AI5A 2XK5B 3UINB 4EZKA 3V6CB 2KFJA 2NS5A 4RM8A 4MJSB 3A9KA 3OAWA 2UWQA 4PS8A 3WA0A 1GNUA 3IBEA 1P0RA 3L13A 4NAWA 2MQJA 3KYDD 3VUXA 2O2VB 3DDCB 4IG7B 2DAFA 1WXAA 5AZFA 3VTVA 2WWZA 3QCAA 3WAOA 1I35A 4M0WB 4NJ7A 4ANUA 2WX0A 3ZRFA 3DVGY 4DHZB 4PYZA 2C7MB 3CMMB 4KSLC 3ZTCA 1G6JA 2WX1A 2ZCCA 5KHQA 4ANVA 2C5LC 2GBNA 3MHSD 3V62A 1WZ3A 2UYZB 4MEMA 4AWJA 3T9LA 1A5RA 3OLMD 2WYQA 4BBNC 4A20A 3BINA 3A9JB 4GIVA 3RULA 2NBWB 2KLCA 2KC2A 4FJVB 3N32A 5CHFA 5LXHA 2YLMA 3APDA 5L95C 4GDLA 3KUDB 3DVNV 2KXJA 2GOWA 3H7PA 2AL6A 5DPRA 1WR1A 2DHZA 4TUUA 2FAZA 4MELA 4FHJA 3M63B 4IC7B 4OVUA 4GU2A 3RUIB 3UIOB 4WWPA 4EZLA 3ZKJC 1WMHA 2BPSA 3VDZA 4CO7A 1Z2MA 3M62B 1OEYA 3LJ3A 1LQBA 4ZRIA 3W1YA 3DVGX 4JQWC 3PHWB 1V49A 1Q5WB 2DZKA 1R4MI 1V5TA 4YL8A 4BKTA 1C3TA 3PRZA 1TZ1A 2AEHA 2R2OA 3QIJA 3U30A 1OTRB 2G45B 2L00B 4AP4C 1ZKHA 2K25A 1E5WA 2FIFA 2KOXA 3R7RA 2KANA 3ZTDA 4LCDE 4W9JA 3ZNID 5CX3A 1TTNA 3TCAA 2IO0B 2JF5A 1RFAA 2B3AA 2Z0DB 3HK0A 2JXXA 4BFRA 1KOTA 1WM3A 2D3GA 2N1VA 3V61A 4EEWA 2JWZA 2K6DB 3K9OB 5D94A 1VCBA 2KWCA 3QA8A 4KDIC 2JZ3B 2LASA 4W9GA 1E8XA 4K81A 1RRBA 1KJTA 3ML9A 1WZ0A 1YQBA 3U7DA 2LGDA 3HM3A 4W9DA 1JRUA 3SDLC 2W9NA 4DK5A 2J0KA 3QX1A 1SE9A 2DENB 2GMIC 2K1FA 1WYWB 4W9HA 2KO3A 1V9JA 3K9PB 5DPWA 2LZ6A 2LWPA 3CSTA 3Q3FA 5JZEB 3GZNI 3L16A 3TMPB 3UF8A 1WX9A 3X0WA 2Z0EB 4ASWC 4ICVA 3DBRI 3QAQA 2VRRB 1UBQA 3JVZX 4LJPB 4NQLB 4XZ4A 2AYOB 2LGYA 1Y8RC 3KW5B 2GBMA 3UIPB 4MSQB 2L0FA 2ZPNA 1WXVA 1E7VA 2MBHA 3ALBA 4FJYA 2ZPYA 4HWIB 2IO2B 1LFDA 2KMCA 2LXCA 4LDTB 1YJ1A 3VUWA 4WJPA 3VXWA 3ZNZB 2BKRB 3H9DA 2D11A 2D2QA 2MP2A 1V2YA 5IAAC 4E3CA 3AU4A 3N30A 2MX2A 2NPTB 5AEKB 4WQOB 3IFWB 2JY6A 4PS7A 5KHOA 4ZRKA 5D6JB 2MP2B 2KWVB 3IG3A 2D10A 4WWOA 3NHEB 1RAXA 1SIFA 4G50A 4GN1A 1EUVB 3TIXA 2BGFA 2R2QA 4IWOA 2C7HA 2GBJA 2NR2A 2OOBB 3KH0A 2YVCA 2DYBA 5JHBA 2EKEC 3ZNGC 3VTWA 1WXMA 2KKCA 1WGGA 3GOEA 4FULA 2C60A 2BYVE 2XK5A 3CSFA 3KUCB 3DVNU 3O65B 4G3XB 1J0GA 1H8CA 3PHXB 4MJSA 2BKFA 4PS3A 1EF1A 2KD0A 1NI2A 2O2VA 1WJUA 2KWUB 3UQBA 2FCSA 3QARA 2O6VA 4EUTA 1TGZB 1L2NA 2G4SA 2MW5A 1UGMA 4EFOA 1IYFA 4IWQA 5D7GA 2ZNVB 1X1MA 2A5UA 3DCGA 5JH5C 2O6VB 1WH3A 4E74A 3QQ8B 3IHPC 1V80A 2DYMA 3BY4B 3ECIA 4CYEA 3DBHI 4K7UA 1QZEA 1V5OA 3A4SC 3LDZE 3VVWB 3W1SA 3I3TB 3V60A 3A9JA 4IM3A 2GBRA 2L0TA 2LRWA 4EKUA 2DZIA 4HCPB 4HXDA 1Q0WB 3JSVB 4W9IA 3WALA 2IY0B 2NVUI 2ZZPB 2LI5A 3L10B 2IO1B 1P9DU 2I1KA 4BKSA 1GUAB 2BWES 2KJRA 1ZW7A 4HPLB 2AL3A 5J17A 1GJZA 4DDGD 5DPTA 3ENEA 3UQAA 2IO3B 4ZDVA 2L8JA 4KSKC 4ANWA 4HLEA 4ZRJA 2RGFA 4URKA 2CS4A 1WE6A 2FUHB 4ICUA 5DCNA 4E71A 4FA6A 3A1QB 2XEWA 2FCMA 4AJYB 3QK0A 1WX8A 1BT0A 1AARA 1P1AA 5CHVC 3RZWC 2LVQA 3AXCA 4RMAA 2J0MA 2L7RA 1YIWA 3TJPA 2DYOA 5AZGA 3ZLZA 3PZDA 5E6NA 5E6PA 3P2BA 3ZUNA 2JRHA 5JHAA 2HE7A 2KDIA 4WAAA 5CTRC 4II3B 1J8CA 4XX5A 2PE6B 3A4RA 4JL9A 4XC2A 1WXSA 2M17A 1WF9A 3VH3B 4B6WA 2K6QA 2KQSA 3EFUA 2HTHA 2FNJB 2KLGA 3D32A 4A3PA 1UH6A 1KM7A 3B08A 3L54A 4MGYE 1OEYJ 4JIOU 2KHWB 2KNBA 1V86A 2J7QB 2V3SA 4WJQA 1EO6A 1NDDA 1UBIA 4FN2A 2CU1A 1V6EA 3H7SA 3ZW3A 5HKHA 4TKNA 4IWPA 2DX5B 4TQ1A 5C23A 3DPDA 4I6PA 5AZHA 2BF8B 2KFKB 2CR5A 1OQYA 3JYUA 3WIMA 5BO4B 2ASQA 2K8CA 2QHOA 2KTRB 4AJWA 4K7WA 1WFYA 4M8MA 4NQKE 2M0XA 5FR6A 3EC8A 3KVFB 5DPSA 4DHJD 1WGHA 2EMSA 2LXAA 3QJZA 2MSED 2NPTA 2L3ZA 2DZJA 2REXA 4F1SA 4DHZE 3PPAA 1ZGUB 3EECA 5C1ZA 4JGHB 3VH4B 1WX7A 1E90A 1S1QB 4BVUC 3PLVA 1PQSA 3ZNHB 2IZVB 2JT4B 2ZVOA 2KN5A 2N7EA 1GG3A 4GDLB 2L05A 1WE7A 2KDFB 4GGQA 1U4AA 2G4DB 3HIZA 2LGXA 4GXBA 1IPGA 2D07B 3VQIA 4BOSC 1E7UA 2M1MA 2JRIB 3PSEB 4X57B 4G0NB 2FCQA 2OJRA 4J6IA 3A33B 4W9KA 4HCNB 2CKHB 4GDKB 2Y5BB 5L83A 4IM0A 3ONSA 2KQ7A 3H1UA 1VD2A 1XT9B 3PV1A 5G55A 3DBLI 3V6EB 3NZUA 3L08A 1ISNA 3DQVA 4M8NA 3ZVVA 2KX3A 1E8ZA 4B95A 1RLFA 2M8SA 2MA9B 4I6LB 2CHZA 3NY5A 1K8RB 3RYTA 3L0WB 3RD2A 1WJ6A 3TBLD 2N7DA 2ZEQA 2K39A 1E8WA 5TR5A 2PE9A 4II2B 4BKSD 2PPHA 3JSVA 5LXIB 2KK8A 4GOCA 4KV2A 2M4NA 2N9XA 2HJ8A 1R4NI 1CMXB 5LLIA 2LVOA 3TL5A 2JUOA 2RR9A 3QHTA 3QWZB 3EHVA 3S2AA 2BWFA 1Q1OA 4KIKB 4MM3A 4WJNA 4HDQA 3X23A 4BKGA 1M94A 1NBFC 1D3ZA 2I1JA 3PLUA 1WIAA 2MWSB 3HHMA 4EZJA 3MTNB 4AUQC 2KJHB 5EDSA 4GSWA 3VAWA 2NBVB 2DAJA 3VUYA 1E8YA 4G11A 2RSUA 1WGDA 3A1QA 3HM6X 3RZFA 3VFKA 3PS6A 2K8BA 4NJ6A 2G3QB 2KX0A 3A9KB 1H4RA 4IM2A 2WDTB 4HDOA 4NAWB 4KZ0A 1EF5A 4PYUA 2V4LA 2BYFA 1WR6E 3OJ4B 1SGHA 1YX5B 3APCA 3VTUA 2FCNA 3B1LX 2LUEA 2KDEB 1GC6A 4K1RB 3RCZA 2L76A 2ZJDA 4TQ0A 1J19A 1LM8B 3SU8X 1KLVA 4MGKE 4MGIE 1MG8A 1WJ4A 3H6NA 4DWFA 3AULA 4F8CB 4HVBA 2FIDA 3SD5A 4K7SA 4NY0A 2V1YA 4FHKA 3PGEA 4I6NB 2AWTA 4DBGA 3H7PB 2PEAA 1Z5SB 3ZDMC 4DXAB 2N1WA 4JLCA 4LDTD 2KMAA 2NBUA 5D2MB 2N9EB 1WMHB 4IUMB 2KFKA 1HE8A 2C7NB 3KYCD 1S3SG 3WAPA 1YX6B 3R66C 3AU5A 2KC1A 4P7IA 4RM9A 5CHWA 5G2NA 2MBQA 3WANA 3PRPB 2KTRA 2IBIB 4LJOB 4GB9A 2MRPA 2JZZA 3MJWA 4FBJB 4ANXA 1WRDB 3NS8A 2NCNA 3ZO5B 2KZRA 1P98A 1UD7A 2KTFA 2RPQA 3L17A 3R7QA 3PREA 4B9KA 3RT3B 3T8MA 4MGZE 1WJNA 4KVGB 4N9F4 3B0AA 3Q3JA 3ZDTA 1GC7A 2EMTA 3KUZA 5E6OA 1WGYA 2Z59B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CHX A;  3DBS A;  3VHT C;  4BOZ B;  2MBO A;  3R3M A;  3UGB B;  1F9J A;  2CHW A;  3APF A;  3IVF A;  3DOW A;  2ZNV C;  1WY8 A;  2GBK A;  1OGW A;  2ZCB A;  1T0Y A;  1XD3 B;  2LD9 A;  3OJ3 A;  4DDI D;  3PTF C;  1XQQ A;  2PJH A;  2J0J A;  1LXD A;  2KDB A;  3SHQ A;  4GDK A;  3C0R B;  4A3O A;  2O6V D;  3PVL A;  3NZS A;  3ZRC A;  4MSM B;  4KZC A;  2IYD B;  2RD0 A;  4F7Z A;  2JPH A;  3ZIM A;  4MDK E;  4W9L A;  2ZVN A;  4IW0 A;  2MBB B;  2DZM A;  2MCN B;  2N9P C;  5J18 A;  1P3Q U;  1WGR A;  3JW0 X;  3CF6 E;  1IP9 A;  2LVP A;  2IY1 B;  3U8Z A;  1WM2 A;  4TV3 A;  5IA7 A;  2XBB C;  3QC8 B;  3M95 A;  3W1S C;  2A4Z A;  4NNJ B;  4NPN A;  3N3K B;  2K8H A;  2LJ5 A;  3ML8 A;  5J2R A;  1I42 A;  4FLH A;  1UEL A;  4GMV A;  1YD8 U;  4W9E A;  2C9W B;  3WAM A;  4EOY A;  3PT2 B;  1L7Y A;  2KJ6 A;  4W9C A;  4BBN F;  4KDL B;  2MLB A;  3M3J A;  4AOF A;  3PRM B;  4MH0 E;  2JVC A;  4HJK A;  4KIK A;  4WJO A;  4CHK A;  4DHJ B;  1C1Y B;  1TBE A;  2HD5 B;  3NOB A;  4FJZ A;  4OVV A;  4W9F A;  4ZYN A;  2MBE A;  2LRU A;  1FXT B;  5GMV A;  4HPM B;  2KVR A;  4WWN A;  1WI0 A;  2N4F A;  1UZX B;  1V81 A;  4FAD A;  2BYE A;  4HK2 A;  3AI5 A;  2XK5 B;  3UIN B;  4EZK A;  3V6C B;  2KFJ A;  2NS5 A;  4RM8 A;  4MJS B;  3A9K A;  3OAW A;  2UWQ A;  4PS8 A;  3WA0 A;  1GNU A;  3IBE A;  1P0R A;  3L13 A;  4NAW A;  2MQJ A;  3KYD D;  3VUX A;  2O2V B;  3DDC B;  4IG7 B;  2DAF A;  1WXA A;  5AZF A;  3VTV A;  2WWZ A;  3QCA A;  3WAO A;  1I35 A;  4M0W B;  4NJ7 A;  4ANU A;  2WX0 A;  3ZRF A;  3DVG Y;  4DHZ B;  4PYZ A;  2C7M B;  3CMM B;  4KSL C;  3ZTC A;  1G6J A;  2WX1 A;  2ZCC A;  5KHQ A;  4ANV A;  2C5L C;  2GBN A;  3MHS D;  3V62 A;  1WZ3 A;  2UYZ B;  4MEM A;  4AWJ A;  3T9L A;  1A5R A;  3OLM D;  2WYQ A;  4BBN C;  4A20 A;  3BIN A;  3A9J B;  4GIV A;  3RUL A;  2NBW B;  2KLC A;  2KC2 A;  4FJV B;  3N32 A;  5CHF A;  5LXH A;  2YLM A;  3APD A;  5L95 C;  4GDL A;  3KUD B;  3DVN V;  2KXJ A;  2GOW A;  3H7P A;  2AL6 A;  5DPR A;  1WR1 A;  2DHZ A;  4TUU A;  2FAZ A;  4MEL A;  4FHJ A;  3M63 B;  4IC7 B;  4OVU A;  4GU2 A;  3RUI B;  3UIO B;  4WWP A;  4EZL A;  3ZKJ C;  1WMH A;  2BPS A;  3VDZ A;  4CO7 A;  1Z2M A;  3M62 B;  1OEY A;  3LJ3 A;  1LQB A;  4ZRI A;  3W1Y A;  3DVG X;  4JQW C;  3PHW B;  1V49 A;  1Q5W B;  2DZK A;  1R4M I;  1V5T A;  4YL8 A;  4BKT A;  1C3T A;  3PRZ A;  1TZ1 A;  2AEH A;  2R2O A;  3QIJ A;  3U30 A;  1OTR B;  2G45 B;  2L00 B;  4AP4 C;  1ZKH A;  2K25 A;  1E5W A;  2FIF A;  2KOX A;  3R7R A;  2KAN A;  3ZTD A;  4LCD E;  4W9J A;  3ZNI D;  5CX3 A;  1TTN A;  3TCA A;  2IO0 B;  2JF5 A;  1RFA A;  2B3A A;  2Z0D B;  3HK0 A;  2JXX A;  4BFR A;  1KOT A;  1WM3 A;  2D3G A;  2N1V A;  3V61 A;  4EEW A;  2JWZ A;  2K6D B;  3K9O B;  5D94 A;  1VCB A;  2KWC A;  3QA8 A;  4KDI C;  2JZ3 B;  2LAS A;  4W9G A;  1E8X A;  4K81 A;  1RRB A;  1KJT A;  3ML9 A;  1WZ0 A;  1YQB A;  3U7D A;  2LGD A;  3HM3 A;  4W9D A;  1JRU A;  3SDL C;  2W9N A;  4DK5 A;  2J0K A;  3QX1 A;  1SE9 A;  2DEN B;  2GMI C;  2K1F A;  1WYW B;  4W9H A;  2KO3 A;  1V9J A;  3K9P B;  5DPW A;  2LZ6 A;  2LWP A;  3CST A;  3Q3F A;  5JZE B;  3GZN I;  3L16 A;  3TMP B;  3UF8 A;  1WX9 A;  3X0W A;  2Z0E B;  4ASW C;  4ICV A;  3DBR I;  3QAQ A;  2VRR B;  1UBQ A;  3JVZ X;  4LJP B;  4NQL B;  4XZ4 A;  2AYO B;  2LGY A;  1Y8R C;  3KW5 B;  2GBM A;  3UIP B;  4MSQ B;  2L0F A;  2ZPN A;  1WXV A;  1E7V A;  2MBH A;  3ALB A;  4FJY A;  2ZPY A;  4HWI B;  2IO2 B;  1LFD A;  2KMC A;  2LXC A;  4LDT B;  1YJ1 A;  3VUW A;  4WJP A;  3VXW A;  3ZNZ B;  2BKR B;  3H9D A;  2D11 A;  2D2Q A;  2MP2 A;  1V2Y A;  5IAA C;  4E3C A;  3AU4 A;  3N30 A;  2MX2 A;  2NPT B;  5AEK B;  4WQO B;  3IFW B;  2JY6 A;  4PS7 A;  5KHO A;  4ZRK A;  5D6J B;  2MP2 B;  2KWV B;  3IG3 A;  2D10 A;  4WWO A;  3NHE B;  1RAX A;  1SIF A;  4G50 A;  4GN1 A;  1EUV B;  3TIX A;  2BGF A;  2R2Q A;  4IWO A;  2C7H A;  2GBJ A;  2NR2 A;  2OOB B;  3KH0 A;  2YVC A;  2DYB A;  5JHB A;  2EKE C;  3ZNG C;  3VTW A;  1WXM A;  2KKC A;  1WGG A;  3GOE A;  4FUL A;  2C60 A;  2BYV E;  2XK5 A;  3CSF A;  3KUC B;  3DVN U;  3O65 B;  4G3X B;  1J0G A;  1H8C A;  3PHX B;  4MJS A;  2BKF A;  4PS3 A;  1EF1 A;  2KD0 A;  1NI2 A;  2O2V A;  1WJU A;  2KWU B;  3UQB A;  2FCS A;  3QAR A;  2O6V A;  4EUT A;  1TGZ B;  1L2N A;  2G4S A;  2MW5 A;  1UGM A;  4EFO A;  1IYF A;  4IWQ A;  5D7G A;  2ZNV B;  1X1M A;  2A5U A;  3DCG A;  5JH5 C;  2O6V B;  1WH3 A;  4E74 A;  3QQ8 B;  3IHP C;  1V80 A;  2DYM A;  3BY4 B;  3ECI A;  4CYE A;  3DBH I;  4K7U A;  1QZE A;  1V5O A;  3A4S C;  3LDZ E;  3VVW B;  3W1S A;  3I3T B;  3V60 A;  3A9J A;  4IM3 A;  2GBR A;  2L0T A;  2LRW A;  4EKU A;  2DZI A;  4HCP B;  4HXD A;  1Q0W B;  3JSV B;  4W9I A;  3WAL A;  2IY0 B;  2NVU I;  2ZZP B;  2LI5 A;  3L10 B;  2IO1 B;  1P9D U;  2I1K A;  4BKS A;  1GUA B;  2BWE S;  2KJR A;  1ZW7 A;  4HPL B;  2AL3 A;  5J17 A;  1GJZ A;  4DDG D;  5DPT A;  3ENE A;  3UQA A;  2IO3 B;  4ZDV A;  2L8J A;  4KSK C;  4ANW A;  4HLE A;  4ZRJ A;  2RGF A;  4URK A;  2CS4 A;  1WE6 A;  2FUH B;  4ICU A;  5DCN A;  4E71 A;  4FA6 A;  3A1Q B;  2XEW A;  2FCM A;  4AJY B;  3QK0 A;  1WX8 A;  1BT0 A;  1AAR A;  1P1A A;  5CHV C;  3RZW C;  2LVQ A;  3AXC A;  4RMA A;  2J0M A;  2L7R A;  1YIW A;  3TJP A;  2DYO A;  5AZG A;  3ZLZ A;  3PZD A;  5E6N A;  5E6P A;  3P2B A;  3ZUN A;  2JRH A;  5JHA A;  2HE7 A;  2KDI A;  4WAA A;  5CTR C;  4II3 B;  1J8C A;  4XX5 A;  2PE6 B;  3A4R A;  4JL9 A;  4XC2 A;  1WXS A;  2M17 A;  1WF9 A;  3VH3 B;  4B6W A;  2K6Q A;  2KQS A;  3EFU A;  2HTH A;  2FNJ B;  2KLG A;  3D32 A;  4A3P A;  1UH6 A;  1KM7 A;  3B08 A;  3L54 A;  4MGY E;  1OEY J;  4JIO U;  2KHW B;  2KNB A;  1V86 A;  2J7Q B;  2V3S A;  4WJQ A;  1EO6 A;  1NDD A;  1UBI A;  4FN2 A;  2CU1 A;  1V6E A;  3H7S A;  3ZW3 A;  5HKH A;  4TKN A;  4IWP A;  2DX5 B;  4TQ1 A;  5C23 A;  3DPD A;  4I6P A;  5AZH A;  2BF8 B;  2KFK B;  2CR5 A;  1OQY A;  3JYU A;  3WIM A;  5BO4 B;  2ASQ A;  2K8C A;  2QHO A;  2KTR B;  4AJW A;  4K7W A;  1WFY A;  4M8M A;  4NQK E;  2M0X A;  5FR6 A;  3EC8 A;  3KVF B;  5DPS A;  4DHJ D;  1WGH A;  2EMS A;  2LXA A;  3QJZ A;  2MSE D;  2NPT A;  2L3Z A;  2DZJ A;  2REX A;  4F1S A;  4DHZ E;  3PPA A;  1ZGU B;  3EEC A;  5C1Z A;  4JGH B;  3VH4 B;  1WX7 A;  1E90 A;  1S1Q B;  4BVU C;  3PLV A;  1PQS A;  3ZNH B;  2IZV B;  2JT4 B;  2ZVO A;  2KN5 A;  2N7E A;  1GG3 A;  4GDL B;  2L05 A;  1WE7 A;  2KDF B;  4GGQ A;  1U4A A;  2G4D B;  3HIZ A;  2LGX A;  4GXB A;  1IPG A;  2D07 B;  3VQI A;  4BOS C;  1E7U A;  2M1M A;  2JRI B;  3PSE B;  4X57 B;  4G0N B;  2FCQ A;  2OJR A;  4J6I A;  3A33 B;  4W9K A;  4HCN B;  2CKH B;  4GDK B;  2Y5B B;  5L83 A;  4IM0 A;  3ONS A;  2KQ7 A;  3H1U A;  1VD2 A;  1XT9 B;  3PV1 A;  5G55 A;  3DBL I;  3V6E B;  3NZU A;  3L08 A;  1ISN A;  3DQV A;  4M8N A;  3ZVV A;  2KX3 A;  1E8Z A;  4B95 A;  1RLF A;  2M8S A;  2MA9 B;  4I6L B;  2CHZ A;  3NY5 A;  1K8R B;  3RYT A;  3L0W B;  3RD2 A;  1WJ6 A;  3TBL D;  2N7D A;  2ZEQ A;  2K39 A;  1E8W A;  5TR5 A;  2PE9 A;  4II2 B;  4BKS D;  2PPH A;  3JSV A;  5LXI B;  2KK8 A;  4GOC A;  4KV2 A;  2M4N A;  2N9X A;  2HJ8 A;  1R4N I;  1CMX B;  5LLI A;  2LVO A;  3TL5 A;  2JUO A;  2RR9 A;  3QHT A;  3QWZ B;  3EHV A;  3S2A A;  2BWF A;  1Q1O A;  4KIK B;  4MM3 A;  4WJN A;  4HDQ A;  3X23 A;  4BKG A;  1M94 A;  1NBF C;  1D3Z A;  2I1J A;  3PLU A;  1WIA A;  2MWS B;  3HHM A;  4EZJ A;  3MTN B;  4AUQ C;  2KJH B;  5EDS A;  4GSW A;  3VAW A;  2NBV B;  2DAJ A;  3VUY A;  1E8Y A;  4G11 A;  2RSU A;  1WGD A;  3A1Q A;  3HM6 X;  3RZF A;  3VFK A;  3PS6 A;  2K8B A;  4NJ6 A;  2G3Q B;  2KX0 A;  3A9K B;  1H4R A;  4IM2 A;  2WDT B;  4HDO A;  4NAW B;  4KZ0 A;  1EF5 A;  4PYU A;  2V4L A;  2BYF A;  1WR6 E;  3OJ4 B;  1SGH A;  1YX5 B;  3APC A;  3VTU A;  2FCN A;  3B1L X;  2LUE A;  2KDE B;  1GC6 A;  4K1R B;  3RCZ A;  2L76 A;  2ZJD A;  4TQ0 A;  1J19 A;  1LM8 B;  3SU8 X;  1KLV A;  4MGK E;  4MGI E;  1MG8 A;  1WJ4 A;  3H6N A;  4DWF A;  3AUL A;  4F8C B;  4HVB A;  2FID A;  3SD5 A;  4K7S A;  4NY0 A;  2V1Y A;  4FHK A;  3PGE A;  4I6N B;  2AWT A;  4DBG A;  3H7P B;  2PEA A;  1Z5S B;  3ZDM C;  4DXA B;  2N1W A;  4JLC A;  4LDT D;  2KMA A;  2NBU A;  5D2M B;  2N9E B;  1WMH B;  4IUM B;  2KFK A;  1HE8 A;  2C7N B;  3KYC D;  1S3S G;  3WAP A;  1YX6 B;  3R66 C;  3AU5 A;  2KC1 A;  4P7I A;  4RM9 A;  5CHW A;  5G2N A;  2MBQ A;  3WAN A;  3PRP B;  2KTR A;  2IBI B;  4LJO B;  4GB9 A;  2MRP A;  2JZZ A;  3MJW A;  4FBJ B;  4ANX A;  1WRD B;  3NS8 A;  2NCN A;  3ZO5 B;  2KZR A;  1P98 A;  1UD7 A;  2KTF A;  2RPQ A;  3L17 A;  3R7Q A;  3PRE A;  4B9K A;  3RT3 B;  3T8M A;  4MGZ E;  1WJN A;  4KVG B;  4N9F 4;  3B0A A;  3Q3J A;  3ZDT A;  1GC7 A;  2EMT A;  3KUZ A;  5E6O A;  1WGY A;  2Z59 B; 
#chains in the Genus database with same CATH topology
 2CHX A;  1YMH E;  1ZOY B;  3R3M A;  3UGB B;  2CHW A;  3IVF A;  3GZN B;  1YJI A;  1XQQ A;  1DGJ A;  2O6V D;  3FC4 A;  3ZRC A;  2RD0 A;  2JPH A;  4W9L A;  2ZVN A;  2MBB B;  2DZM A;  1P3Q U;  4AS1 A;  1JWB D;  3AEA B;  3BYT B;  2MJD A;  3FAH A;  1IP9 A;  1L5P A;  4HRS A;  3CWI A;  4HPP A;  4NNJ B;  4NPN A;  3ML8 A;  2M56 B;  5J2R A;  2WXK A;  4GMV A;  4W9E A;  1P7E A;  1EWY C;  2C9W B;  3W5V B;  2QEJ C;  1L7Y A;  2KJ6 A;  3M3J A;  2PW9 A;  2RDH A;  4JWS C;  1FNV A;  4KIK A;  1ROE A;  1C1Y B;  4FJZ A;  3NOB A;  4ZYN A;  2LRU A;  4HPM B;  4WWN A;  1ZPS A;  2N4F A;  3V6C B;  2UWQ A;  3WA0 A;  2LEK A;  3VUX A;  1P0R A;  2PTL A;  4IG7 B;  1WGK A;  2JSV X;  3WAO A;  4M0W B;  1KFY B;  3ZRF A;  5EE1 A;  4PYZ A;  2C7M B;  5BMG A;  1G6J A;  3MHS D;  4RGT A;  2UYZ B;  4AWJ A;  2LUM A;  2GI9 A;  1PGA A;  2NBW B;  4J3O D;  2WU5 B;  2KLC A;  1GAQ B;  3AB5 A;  3N32 A;  3APD A;  2KXJ A;  2GOW A;  1F1H A;  1HXY D;  2AL6 A;  2GRI A;  4DXG A;  4FHJ A;  4IC7 B;  2X8X X;  3ZKJ C;  4CO7 A;  1Z2M A;  1OEY A;  1JWA D;  1V49 A;  4L1B A;  1L4D B;  1R4M I;  3IT4 B;  4BKT A;  3QIJ A;  2AEH A;  4ZOH C;  2NTT A;  2WDQ B;  1E5W A;  2K25 A;  2FIF A;  2K9X A;  1AYF A;  4TMA B;  3TCA A;  2IO0 B;  1N60 A;  2JF5 A;  2N9K A;  2BYT A;  3HK0 A;  5EE0 A;  1L0X B;  1C78 A;  2JWZ A;  1UWX A;  2JZ3 B;  1HEZ E;  1RRB A;  1KJT A;  2LGD A;  3HUI A;  2RDG A;  3SDL C;  1JRU A;  1PUT A;  5LNK 1;  2DEN B;  1ZDV A;  1V9J A;  1BUI C;  3Q14 C;  1C4C A;  3X0W A;  2Z0E B;  4ASW C;  1T5X D;  1FIQ A;  2AYO B;  4P16 A;  3GS2 A;  2WXJ A;  2QMT A;  2V0G A;  1ZE3 D;  3MJ5 A;  3N9Y C;  1WXV A;  1KH0 A;  1NEN B;  1LFD A;  2LXC A;  2IJ0 A;  2AQ1 B;  3VUW A;  3VXW A;  2JYT A;  3ZNZ B;  4S17 A;  2D11 A;  2D2Q A;  1V2Y A;  4EE2 A;  4RCO A;  1UF0 A;  2NPT B;  1I4R A;  4WQO B;  2JY6 A;  3AE9 B;  2BVC A;  4G50 A;  1EUV B;  1FFU A;  2R2Q A;  4IWO A;  3Q6B A;  4FUL A;  1WXM A;  2KKC A;  2INC C;  3KWV A;  2BYV E;  4G3X B;  3PHX B;  3AM9 A;  2FCS A;  1UGM A;  4M0W A;  4EFO A;  1IYF A;  2Y3A A;  1X1M A;  3Q8C A;  2TSS A;  2O6V B;  2V3P A;  4LLG M;  2R61 A;  3BY4 B;  3AEF B;  3Q3O C;  1V5O A;  3LDZ E;  3VVW B;  3V60 A;  4IM3 A;  4HCP B;  4HXD A;  2QIL A;  5D3D A;  1HA5 A;  3WAL A;  1PFD A;  2LI5 A;  1VJK A;  1YQ4 B;  2IO1 B;  2I1K A;  5GXG B;  3AEB B;  1T3Q A;  1XLP A;  1DOI A;  1ZW7 A;  5J17 A;  2AL3 A;  1GJZ A;  2E6X A;  5DPT A;  3RMK C;  4ZDV A;  2IGG A;  1MFW A;  4KGR A;  4HLE A;  2CS4 A;  4E71 A;  3A1Q B;  4AJY B;  3AMZ A;  3QK0 A;  2AX5 A;  3AXC A;  2J0M A;  1WYG A;  4MAC A;  5AZG A;  1PGX A;  2ZW1 A;  2KQ4 X;  3ZUN A;  2HE7 A;  1B9R A;  1J8C A;  2PE6 B;  4XC2 A;  4JL9 A;  1FRD A;  1XLO A;  3VH3 B;  4B6W A;  4YXD B;  3ZXV A;  3EFU A;  3L54 A;  4AQ7 A;  4P1B C;  4JIO U;  4A8X C;  2V3S A;  4WJQ A;  1QLB B;  4FN2 A;  3LB8 C;  1V6E A;  3TEZ A;  2G1E A;  2DX5 B;  1FEH A;  2CR5 A;  3JYU A;  2WS3 B;  1L6V A;  2ICI A;  2QHO A;  2K5P A;  4BZA A;  2KAC A;  2EMS A;  3OWE B;  4PT5 A;  2NPT A;  2L3Z A;  2DZJ A;  4F1S A;  4DHZ E;  4JGH B;  1PQS A;  4D2K A;  4LTU A;  2DWQ A;  3C8Y A;  1IPG A;  2WXH A;  3UI3 A;  2JRI B;  4G0N B;  4GDK B;  2WDV B;  1JWM D;  1TT5 B;  1BXT A;  3V6E B;  1ISN A;  4M00 A;  4M8N A;  4B95 A;  3AEE B;  3RYT A;  2CHZ A;  3L0W B;  1HTQ A;  2PVO D;  3AE4 B;  2V4I B;  4OZB A;  4BKS D;  2PPH A;  5LXI B;  2K3U A;  1R4N I;  2LVO A;  1UUP A;  2KWD A;  3QHT A;  4LNN A;  2J42 A;  2QCZ A;  3X23 A;  1FCC C;  4BKG A;  1QIL A;  1D3Z A;  4US9 A;  2I1J A;  2LHD A;  2MWS B;  3MTN B;  4GSW A;  2DAJ A;  3NVZ A;  3A1Q A;  1DYQ A;  3HM6 X;  5FR3 A;  2G3Q B;  1SEB D;  1H4R A;  4IM2 A;  4HDO A;  4LNO A;  1K50 A;  4KZ0 A;  1MG4 A;  1EF5 A;  1WR6 E;  1QOG A;  1YX5 B;  1UNS A;  2LUE A;  4JX1 C;  4LK0 M;  3RCZ A;  1J19 A;  1N61 A;  2OHF A;  3C19 A;  3Q8F A;  3SU8 X;  1N6Z A;  4DWF A;  4IKG A;  3Q3N C;  2V1Y A;  3PGE A;  4NAM A;  2Y5P A;  2YEP B;  2WXF A;  4DBG A;  2PEA A;  1FMA D;  4DXA B;  2N1W A;  5D2M B;  1YN4 A;  4IUM B;  1PGB A;  2IPK D;  3I5J C;  1HE8 A;  2C7N B;  3KYC D;  4ACF A;  3R66 C;  2KC1 A;  3Q3M C;  5CHW A;  5BYQ A;  2IBI B;  4LJO B;  1SE4 A;  2MRP A;  3MJW A;  2NTS A;  5H92 C;  1UD7 A;  4C56 C;  3R7Q A;  4B9K A;  3ZDT A;  1GC7 A;  2BWE S;  3KUZ A;  1C77 A;  3DHG C;  1WGY A;  4ZRQ A;  4IDI A;  5IN7 A;  4BOZ B;  2MBO A;  3DOW A;  2ZNV C;  2LD9 A;  1F77 A;  2J0J A;  1LXD A;  3SHQ A;  4GDK A;  4A3O A;  3PVL A;  2N0S B;  1GB1 A;  3W9C B;  1VRA B;  2N9P C;  4YWG G;  2L52 A;  2IY1 B;  4TV3 A;  2XBB C;  3M95 A;  1UGJ A;  2LJ5 A;  4N59 A;  1I42 A;  4FLH A;  3PT2 B;  4R3D A;  4W9C A;  4BBN F;  3ZJV A;  1FNW A;  4KDL B;  3RFZ B;  2PKO A;  4RF1 A;  4XDC A;  4HJK A;  4CHK A;  2HD5 B;  3AE2 B;  3L4P A;  4OVV A;  2MBE A;  5GMV A;  1PDX A;  3AN1 A;  1WI0 A;  4XYC A;  1V81 A;  3AE3 B;  4HK2 A;  3UIN B;  1OQQ A;  2NS5 A;  4PS8 A;  2L83 A;  3IBE A;  2MQJ A;  4CQN A;  5AZF A;  3VTV A;  2D3B A;  4XDD A;  4ANU A;  3DVG Y;  4KSL C;  2ZCC A;  4ANV A;  1KLU D;  4C80 A;  1AW7 A;  3V62 A;  2HDE A;  3OG5 A;  4BBN C;  3RUL A;  1VZ7 A;  2CU3 A;  2KC2 A;  1JCK B;  2D3C A;  3BWU D;  4WQM A;  4C4V A;  4KGT A;  2V3N A;  1WR1 A;  2DHZ A;  5T8I A;  3M63 B;  2BB6 A;  2JU6 X;  4EZL A;  1XLQ A;  2BPS A;  2MHJ A;  3RNC C;  3LJ3 A;  3DVG X;  3CIR B;  1YNT E;  1Q5W B;  1E7P B;  1NEK B;  2L00 B;  1NYQ A;  2HJ1 A;  4AP4 C;  1ZKH A;  1F2R C;  1I4X A;  3R7R A;  3ZTD A;  4LCD E;  5IO9 A;  2SEB D;  1SE2 A;  1TTN A;  1CJE A;  1ET9 A;  4BFR A;  1J7C A;  2D3G A;  4Q2J A;  1VCB A;  3QA8 A;  4XGA B;  4W9G A;  4K81 A;  1TY2 A;  3ML9 A;  4HJG E;  2W3R A;  3U7D A;  5E6J A;  3IT6 B;  2BB5 A;  2J0K A;  1SE9 A;  1WYW B;  2KO3 A;  3K9P B;  1J7A A;  3Q3F A;  3L16 A;  4TSS A;  3U4E G;  3MP9 A;  4YSZ B;  3DBR B;  2WXN A;  2GBM A;  3UIP B;  4MSQ B;  2L0F A;  4FJY A;  4HWI B;  4BAX A;  3N1Z C;  4WJP A;  1ACC A;  3U2S C;  2HTM E;  1L0V B;  4ZHO A;  1NI3 A;  3AU4 A;  3N30 A;  2MX2 A;  1TY0 A;  5AEK B;  2KWV B;  3IG3 A;  2D10 A;  4WWO A;  3NHE B;  1SIF A;  3NVV A;  4ITK A;  3BVG A;  1A70 A;  5I4D A;  2GBJ A;  2NR2 A;  5JHB A;  3DWM A;  2DYB A;  4OHJ A;  3BVZ A;  3GOE A;  1J0G A;  1H8C A;  1HZ5 A;  3IAS 1;  1WJU A;  3UQB A;  1CQV A;  2DBY A;  2K22 A;  4RFB A;  1TGZ B;  4ZRP A;  3BII D;  1T6B X;  2WXI A;  3QQ8 B;  3RN9 C;  3ECI A;  4S0R A;  1JRP A;  1QZE A;  3DBH B;  1TS5 A;  2DZI A;  3TEX A;  1Q0W B;  3JSV B;  4NZL B;  3L10 B;  2LJI A;  2ZZP B;  1CZP A;  2QC8 A;  1P9D U;  4BKS A;  2WGS A;  3ENE A;  1L6U A;  2LGI A;  1XLN A;  2RGF A;  4L2Y A;  1WE6 A;  2AQ2 B;  4K3B A;  5DCN A;  4FA6 A;  2XEW A;  2KAJ A;  1WX8 A;  5CHV C;  2EKI A;  2LVQ A;  3PZD A;  5E6P A;  3P2B A;  2L32 A;  5JHA A;  2KDI A;  4WAA A;  4II3 B;  3V05 A;  4XX5 A;  1MHX A;  3A4R A;  1MHH E;  2N9L A;  1WF9 A;  4P6V F;  3Q8E A;  3NUH B;  2KLG A;  2WXL A;  4A3P A;  3TEW A;  1KM7 A;  1YOV B;  4MGY E;  2KNB A;  2CU1 A;  3H7S A;  1EU4 A;  2IDY A;  4TQ1 A;  2XN9 C;  1L0Y B;  5AZH A;  5BMI A;  3WIM A;  3Q8B A;  4AJW A;  1I4H A;  1ZDX A;  4K7W A;  1WFY A;  5DPS A;  4DHJ D;  2MSE D;  4RGM A;  5C1Z A;  3T3O A;  1SXT A;  4M01 A;  1QOB A;  2QIE B;  5C3J B;  2IZV B;  1D5Z C;  1E9M A;  1I7H A;  1WE7 A;  2OJW A;  1Q10 A;  4GXB A;  5BMH A;  1E7U A;  5FK9 C;  1FXA A;  3PSE B;  1I4Q A;  4J6I A;  1N5X A;  4A90 A;  3ONS A;  5G5G A;  2KQ7 A;  2WQY B;  5G55 A;  1K53 A;  3KWL A;  3NZU A;  2KX3 A;  4A6Q A;  4ZYS A;  1MVK A;  2DNF A;  3PO0 A;  4YT0 B;  1E8W A;  4II2 B;  3JSV A;  4GOC A;  4KV2 A;  3AEG B;  2N9X A;  1CMX B;  5LLI A;  3AEC B;  3QWZ B;  3S2A A;  4RGN A;  1Q1O A;  4WJN A;  4HDQ A;  1J7B A;  1AN8 A;  1NBF C;  1WSP A;  3I57 A;  2WXR A;  3PLU A;  1GB4 A;  5EDS A;  2KJH B;  2WXP A;  1CK1 A;  1WGD A;  3VRA B;  2M0A A;  3A9K B;  2WDT B;  4PYU A;  1KTK A;  1SGH A;  2GB1 A;  2WDR B;  1FO4 A;  2KDE B;  5FKA C;  3AV8 A;  2BW2 A;  2ZJD A;  1LM8 B;  1KLV A;  3B9J A;  4HVB A;  4K7S A;  4FHK A;  3U52 E;  4I6N B;  3H7P B;  1Z5S B;  4HKZ E;  3ZDM C;  3N1Y C;  2MJ3 A;  1SSN A;  1S3S G;  5G5H A;  2GLS A;  2MBQ A;  3B2F A;  2IND C;  3NS1 A;  2VH1 A;  4JE3 B;  4DXF A;  3B2G A;  1WRD B;  3NS8 A;  1C76 A;  1P98 A;  1V97 A;  1GPX A;  3FKY A;  3PRE A;  3T8M A;  1WJN A;  2OED A;  4KVG B;  5H8Y E;  1FFV A;  1RYJ A;  5E6O A;  3CSF A;  2FE8 A;  3DBS A;  3VHT C;  3NRZ A;  1F9J A;  1WY8 A;  2JWU A;  4N58 A;  2ZCB A;  1T0Y A;  4DDI D;  3PTF C;  4K3C A;  2KDB A;  1AWD A;  4MSM B;  4UDU C;  2IYD B;  3IXS A;  3ZIM A;  3ETR A;  4IW0 A;  3KQ4 A;  3CF6 E;  3U8Z A;  1QOA A;  3N3K B;  3SFE B;  1YD8 U;  2VH2 A;  3W2D A;  3WAM A;  1ZXI A;  2J52 A;  4DHJ B;  1TBE A;  3ZJT A;  4W9F A;  3E9S A;  2G9H D;  4M02 A;  4P1C C;  3EA6 A;  3RNF C;  4OVZ A;  4MJS B;  3A9K A;  4L23 A;  2W3S A;  3L13 A;  3KYD D;  2ZW0 A;  5MPO A;  3DDC B;  2DAF A;  1WXA A;  2WWZ A;  3QCA A;  1P7F A;  4DHZ B;  3CMM B;  1JW9 D;  4YTN B;  1RWS A;  3FIL B;  2W55 A;  2C5L C;  2H89 B;  2WXG A;  3R8B A;  2RPV A;  1A5R A;  3OLM D;  2WYQ A;  4A20 A;  1VZ6 A;  3A9J B;  4GIV A;  1D4B A;  3RNA C;  4FJV B;  5CHF A;  2YLM A;  5L95 C;  3KUD B;  1EM7 A;  4YSY B;  2KDM A;  3H7P A;  3EUB 2;  4MEL A;  4GU2 A;  4WWP A;  3VDZ A;  3M62 B;  4C4V B;  3W1Y A;  4JQW C;  3PHW B;  2DZK A;  1C3T A;  1V5T A;  3PRZ A;  1TZ1 A;  2R2O A;  1E6E B;  3U30 A;  1OTR B;  1FNU A;  1R7S A;  1ENF A;  1JWS D;  1V1P B;  3TSS A;  1SJE D;  1YQ3 B;  3Q8A A;  3V61 A;  2N1V A;  1MJD A;  3K9O B;  5D94 A;  2KWC A;  1D5X C;  2JQR B;  1C4P A;  1QOF A;  1E10 A;  3I63 C;  1WZ0 A;  4RH6 A;  5BYR A;  3HM3 A;  2KMM A;  1I4G A;  2KN4 A;  1TKG A;  4O1N A;  1IBX B;  2JXT A;  4W9H A;  5DPW A;  1SJH D;  2LWP A;  3CST A;  3GZN I;  3UF8 A;  1WX9 A;  2ONQ A;  1GOZ A;  3DBR I;  1UBQ A;  4LJP B;  4XZ4 A;  3U7Z A;  1DOY A;  1B1Z A;  2LGY A;  1Y8R C;  3KW5 B;  2N7J A;  2WXQ A;  4RNA A;  1E7V A;  2ZPY A;  4QAY A;  2IO2 B;  5D3I B;  4B0M A;  5HFY A;  1YJ1 A;  2BS4 B;  2BKR B;  3H9D A;  2ACZ B;  1BML C;  1F2R I;  4YTM B;  1PYW D;  2MP2 A;  5IAA C;  3W5U B;  3AE8 B;  3IFW B;  1YN3 A;  3HRD D;  4ZRK A;  5D6J B;  1STE A;  1ESF A;  4GN1 A;  1RAX A;  2ON8 A;  2WXM A;  3MC0 B;  3TIX A;  2BGF A;  2BBC A;  4GLS C;  2EKE C;  3VTW A;  1WGG A;  2PVG C;  3KUC B;  3O65 B;  3Q69 A;  4MJS A;  4PS3 A;  1EF1 A;  1N63 A;  2KD0 A;  1NI2 A;  1VDV A;  3MHZ A;  3RNB C;  1L2N A;  4A9A A;  2MW5 A;  3P4P B;  5D7G A;  2ZNV B;  3DHH C;  3FIL A;  4E74 A;  3IHP C;  3DBH I;  4K7U A;  1JAL A;  3A9J A;  4US8 A;  2RMM A;  3AH7 A;  2L0T A;  4EKU A;  2IY0 B;  1GUA B;  4MM3 B;  2KJR A;  4JWU C;  4DDG D;  1FPY A;  1VZ8 A;  4KSK C;  3P42 A;  1SE3 A;  1V8C A;  4ZRJ A;  2W54 A;  2B76 B;  1QF6 A;  2FCM A;  2WXO A;  1AAR A;  1P1A A;  1WRI A;  1V1P A;  4C7Z A;  2L7R A;  2KT7 A;  1XCT L;  1YIW A;  3TJP A;  2DYO A;  2JRH A;  1WWT A;  1KRH A;  2K6Q A;  4C00 A;  2KQS A;  1E0Z A;  5AUI A;  1IBX A;  2FNJ B;  3D32 A;  3B08 A;  1OEY J;  4KGS A;  4RF0 A;  4DQO C;  1EO6 A;  1NDD A;  1T0Q C;  4ARI A;  1TS2 A;  3ZW3 A;  5HKH A;  2INP E;  5C23 A;  1VR9 A;  2BF8 B;  3R2I A;  3N20 C;  3ZYY X;  1JML A;  5AUK A;  4M8M A;  2UU7 A;  1UWM A;  4LNF A;  3KVF B;  2LXA A;  2JX5 A;  3VR9 B;  3PZ8 A;  3MC9 A;  3VH4 B;  1E90 A;  1XF5 L;  4H2A A;  2JT4 B;  4XE0 A;  1T0S C;  4GDL B;  2KYW A;  1EWC A;  4HEA 1;  1U4A A;  2LGX A;  2AQ3 B;  3VQI A;  2H88 B;  2M1M A;  2FCQ A;  4W9K A;  4HCN B;  3AED B;  2CKH B;  2WNM A;  2Y5B B;  5L83 A;  4IM0 A;  1FRR A;  1VD2 A;  1XT9 B;  2QSD A;  3DBL B;  1RLF A;  4I6L B;  1K8R B;  4FXC A;  2ZEQ A;  2K39 A;  3LXF A;  2PE9 A;  2SAK A;  2KK8 A;  2M4N A;  4NJC A;  1EU3 A;  2BWF A;  4MM3 A;  1NYR A;  3P4S B;  1WIA A;  3HHM A;  4EZJ A;  3VUY A;  1E8Y A;  3IAM 1;  4G11 A;  2RSU A;  3VFK A;  3RZF A;  3PS6 A;  2KX0 A;  3MFG A;  2MJE A;  1IGD A;  4NAW B;  3OJ4 B;  5JXV A;  3APC A;  2Z8L A;  1M4V A;  2PMV A;  1GC6 A;  1K52 A;  2QDF A;  2L76 A;  1TS3 A;  2JZP A;  3E56 A;  1TKY A;  1C79 A;  4MGK E;  1WJ4 A;  3AUL A;  4F8C B;  2FID A;  4NY0 A;  2BT6 A;  2LGS A;  2BQQ A;  4KKI A;  4JLC A;  4LDT D;  2PIA A;  1WMH B;  1HTO A;  1QT9 A;  1YX6 B;  2CJN A;  3Q2A C;  4LNI A;  2MH7 A;  2J53 A;  3PRP B;  4KKJ A;  2D3A A;  5C2T B;  4ANX A;  2KZR A;  1N5W A;  3P63 A;  3RT3 B;  4N9F 4;  3Q3J A;  5IKC M;  2EMT A;  4GDL A;  3WAN A;  3LYY A;  3N1X C;  2BTE A;  3APF A;  3GE3 C;  2GBK A;  1OGW A;  1XD3 B;  3OJ3 A;  3SR6 A;  1QQR A;  2PJH A;  3C0R B;  3NZS A;  4KZC A;  4F7Z A;  1TZO A;  4MDK E;  3HVD A;  2MCN B;  3TEY A;  5J18 A;  1WGR A;  3JW0 X;  2LVP A;  1WM2 A;  5IA7 A;  3QC8 B;  3W1S C;  2A4Z A;  4PK1 A;  2K8H A;  3I9V 1;  1UEL A;  3AE7 B;  4EOY A;  3GE8 C;  1IUE A;  3ABV B;  2W82 A;  2DLB A;  2MLB A;  3VRB B;  4AOF A;  3PRM B;  4MH0 E;  2JVC A;  4WJO A;  3BZD B;  1FXT B;  5EE9 A;  4N6E B;  2KVR A;  4B0E A;  1RM6 C;  1UZX B;  4FAD A;  2BYE A;  3AI5 A;  3P4Q B;  2MEK A;  2XK5 B;  3BK2 A;  4EZK A;  2L1A A;  2KFJ A;  4RM8 A;  3OAW A;  1GNU A;  1XO3 A;  2INN E;  4NAW A;  2O2V B;  3DWG C;  1ET6 A;  3T3N A;  1I35 A;  4C7Y A;  4NJ7 A;  1DOX A;  2WX0 A;  2VZK D;  3ZTC A;  2WX1 A;  3RI7 C;  4WIP A;  5KHQ A;  2GBN A;  3EFC A;  1YJJ A;  1D6E C;  1WZ3 A;  4MEM A;  3T9L A;  1NVI D;  2WLB A;  3BIN A;  4XWW A;  5LXH A;  1KLG D;  3DVN V;  1ZXH A;  3KLS X;  2LFI A;  5DPR A;  5BYS A;  2BS2 B;  4A55 A;  4TUU A;  2FAZ A;  4OVU A;  3UIO B;  3HVZ A;  3RUI B;  3WCQ A;  2QJL A;  1WMH A;  1FXI A;  4ZRI A;  1LQB A;  4WH4 A;  4YL8 A;  1R4M B;  2G45 B;  3J9C A;  2KOX A;  2KAN A;  3AE5 B;  2NMQ A;  3PZ7 A;  4W9J A;  3ZNI D;  5CX3 A;  1SF0 A;  3NZ3 A;  1RFA A;  2B3A A;  2Z0D B;  2JXX A;  1MPE A;  1KOT A;  1TS4 A;  1WM3 A;  4EEW A;  2K6D B;  2Y5C A;  4KDI C;  2LAS A;  1E8X A;  2I38 A;  1YQB A;  2BS3 B;  2JYE A;  4W9D A;  2W9N A;  4DK5 A;  3QX1 A;  1JRO A;  1OQR A;  2GMI C;  2K1F A;  2RDB C;  3NG0 A;  1XCQ L;  4HKQ A;  2LZ6 A;  5JZE B;  3V3X A;  1SBB B;  5HI1 A;  3TMP B;  4OZA A;  4ICV A;  3QAQ A;  1F0Z A;  2VRR B;  3JVZ X;  4NQL B;  5TSS A;  1L4Z B;  1TIF A;  1QKZ A;  3SFD B;  2ZPN A;  2MBH A;  3ALB A;  3NVW A;  2KMC A;  4LDT B;  3DHI C;  2YEP F;  2J4X A;  4E3C A;  1N62 A;  4PS7 A;  1FCL A;  5KHO A;  2MP2 B;  1XXG A;  3NJT A;  2LHE A;  1ZUD 2;  3AE1 B;  1JQ4 A;  2C7H A;  3EGR A;  2OOB B;  3KH0 A;  2YVC A;  3ZNG C;  2C60 A;  2XK5 A;  3DVN U;  2BKF A;  4ZHP A;  2O2V A;  2KWU B;  3QAR A;  2O6V A;  4EUT A;  3ZGZ A;  2G4S A;  2I2Y A;  4IWQ A;  2A5U A;  3DCG A;  5HHD G;  5JH5 C;  1WH3 A;  3RNE C;  1V80 A;  2DYM A;  3TUO A;  4CYE A;  1SIJ A;  3A4S C;  4WWM A;  3W1S A;  3I3T B;  2K0P A;  1VLB A;  2GBR A;  2LRW A;  4OZC A;  2FUG 1;  4W9I A;  3NVY A;  2Z59 B;  2NVU I;  1FM0 D;  2KVZ A;  1OFF A;  4HPL B;  3UQA A;  2IO3 B;  4MT5 A;  2L8J A;  4ANW A;  4URK A;  5EE3 A;  4ICU A;  2FUH B;  4RGO S;  1LO5 D;  1BT0 A;  3RZW C;  4HRO A;  2EEL A;  3R2T A;  4REZ A;  4RMA A;  1IGC A;  3ZLZ A;  5E6N A;  2CJO A;  2WHI A;  5CTR C;  3RNG C;  1WXS A;  2M17 A;  3ZXR A;  2VZK B;  2HTH A;  1UH6 A;  4WAF A;  2KHW B;  1V86 A;  2J7Q B;  1HQR D;  2FBW B;  3VR8 B;  1UBI A;  1YN5 A;  4TKN A;  4IWP A;  3DPD A;  4I6P A;  2KFK B;  1OQY A;  3BYY B;  3O13 A;  1K51 A;  5BO4 B;  5IP4 D;  2ASQ A;  2K8C A;  1C9F A;  2KTR B;  4NQK E;  3URY A;  2M0X A;  5FR6 A;  1KF6 B;  4MH8 A;  3EC8 A;  1WGH A;  3QJZ A;  1D5M C;  2REX A;  1WXQ A;  3PPA A;  4LNK A;  1ZGU B;  3EEC A;  1WX7 A;  1S1Q B;  4BVU C;  3PLV A;  3ZNH B;  2XNA C;  2ZVO A;  3BVM A;  2KN5 A;  2N7E A;  1GG3 A;  2L05 A;  2KDF B;  4GGQ A;  3HIZ A;  2G4D B;  4ARC A;  2D07 B;  1TJE A;  4BOS C;  1RFK A;  4X57 B;  2OJR A;  3A33 B;  2Q5W D;  3AE6 B;  3H1U A;  3PV1 A;  2WU2 B;  4IOI E;  5HG2 A;  3DBL I;  1XEE A;  3L08 A;  3DQV A;  3ZVV A;  1E8Z A;  3P1M A;  2M8S A;  1HZ6 A;  2MA9 B;  3NY5 A;  1Y56 A;  3RD2 A;  1WJ6 A;  3TBL D;  2N7D A;  3ZJU A;  5TR5 A;  1C4A A;  2PLP A;  4YTP B;  2HJ8 A;  2X38 A;  3TL5 A;  2JUO A;  3H8H A;  2RR9 A;  1R4N B;  3EHV A;  4KIK B;  1M94 A;  4YSX B;  1FD6 A;  4AUQ C;  3VAW A;  2NBV B;  3RPF C;  2K8B A;  4NJ6 A;  1TKE A;  2V4L A;  2BYF A;  2LMC A;  1SB3 C;  3VTU A;  2FCN A;  3B1L X;  1I4P A;  4K1R B;  4JPS A;  3MC8 A;  4TQ0 A;  3P4R B;  4WUR A;  4MGI E;  1MG8 A;  3H6N A;  1MI0 A;  2E3T A;  2WP9 B;  4XWT A;  3SD5 A;  1TYG B;  2IGD A;  1ZP0 B;  3ZQ4 A;  2V9H A;  2AWT A;  3GP7 A;  1F52 A;  3SEB A;  2KMA A;  2NBU A;  2N9E B;  2KFK A;  3WAP A;  1JWU D;  3AU5 A;  4KX6 B;  2D5G A;  4P7I A;  4RM9 A;  1V1O A;  5G2N A;  2IGH A;  2KTR A;  4GB9 A;  2JZZ A;  4FBJ B;  3BK1 A;  2NCN A;  3ZO5 B;  3GB1 A;  2KTF A;  2RPQ A;  3L17 A;  4OW0 A;  5IOI A;  4MGZ E;  3B0A A;  1T0R C;  1LGR A;  4USA A;  2M19 A; 
#chains in the Genus database with same CATH homology
 2CHX A;  3DBS A;  3VHT C;  4BOZ B;  2MBO A;  3R3M A;  3UGB B;  1F9J A;  2CHW A;  3APF A;  3IVF A;  3DOW A;  2ZNV C;  1WY8 A;  2GBK A;  1OGW A;  2ZCB A;  1T0Y A;  1XD3 B;  2LD9 A;  3OJ3 A;  4DDI D;  3PTF C;  1XQQ A;  2PJH A;  2J0J A;  1LXD A;  2KDB A;  3SHQ A;  4GDK A;  3C0R B;  4A3O A;  2O6V D;  3PVL A;  3NZS A;  3ZRC A;  4MSM B;  4KZC A;  2IYD B;  2RD0 A;  4F7Z A;  2JPH A;  3ZIM A;  4MDK E;  4W9L A;  2ZVN A;  4IW0 A;  2MBB B;  2DZM A;  2MCN B;  2N9P C;  5J18 A;  1P3Q U;  1WGR A;  3JW0 X;  3CF6 E;  1IP9 A;  2LVP A;  2IY1 B;  3U8Z A;  1WM2 A;  4TV3 A;  5IA7 A;  2XBB C;  3QC8 B;  3M95 A;  3W1S C;  2A4Z A;  4NNJ B;  4NPN A;  3N3K B;  2K8H A;  2LJ5 A;  3ML8 A;  5J2R A;  1I42 A;  4FLH A;  1UEL A;  4GMV A;  1YD8 U;  4W9E A;  2C9W B;  3WAM A;  4EOY A;  3PT2 B;  1L7Y A;  2KJ6 A;  4W9C A;  4BBN F;  4KDL B;  2MLB A;  3M3J A;  4AOF A;  3PRM B;  4MH0 E;  2JVC A;  4HJK A;  4KIK A;  4WJO A;  4CHK A;  4DHJ B;  1C1Y B;  1TBE A;  2HD5 B;  3NOB A;  4FJZ A;  4OVV A;  4W9F A;  4ZYN A;  2MBE A;  2LRU A;  1FXT B;  5GMV A;  4HPM B;  2KVR A;  4WWN A;  1WI0 A;  2N4F A;  1UZX B;  1V81 A;  4FAD A;  2BYE A;  4HK2 A;  3AI5 A;  2XK5 B;  3UIN B;  4EZK A;  3V6C B;  2KFJ A;  2NS5 A;  4RM8 A;  4MJS B;  3A9K A;  3OAW A;  2UWQ A;  4PS8 A;  3WA0 A;  1GNU A;  3IBE A;  1P0R A;  3L13 A;  4NAW A;  2MQJ A;  3KYD D;  3VUX A;  2O2V B;  3DDC B;  4IG7 B;  2DAF A;  1WXA A;  5AZF A;  3VTV A;  2WWZ A;  3QCA A;  3WAO A;  1I35 A;  4M0W B;  4NJ7 A;  4ANU A;  2WX0 A;  3ZRF A;  3DVG Y;  4DHZ B;  4PYZ A;  2C7M B;  3CMM B;  4KSL C;  3ZTC A;  1G6J A;  2WX1 A;  2ZCC A;  5KHQ A;  4ANV A;  2C5L C;  2GBN A;  3MHS D;  3V62 A;  1WZ3 A;  2UYZ B;  4MEM A;  4AWJ A;  3T9L A;  1A5R A;  3OLM D;  2WYQ A;  4BBN C;  4A20 A;  3BIN A;  3A9J B;  4GIV A;  3RUL A;  2NBW B;  2KLC A;  2KC2 A;  4FJV B;  3N32 A;  5CHF A;  5LXH A;  2YLM A;  3APD A;  5L95 C;  4GDL A;  3KUD B;  3DVN V;  2KXJ A;  2GOW A;  3H7P A;  2AL6 A;  5DPR A;  1WR1 A;  2DHZ A;  4TUU A;  2FAZ A;  4MEL A;  4FHJ A;  3M63 B;  4IC7 B;  4OVU A;  4GU2 A;  3RUI B;  3UIO B;  4WWP A;  4EZL A;  3ZKJ C;  1WMH A;  2BPS A;  3VDZ A;  4CO7 A;  1Z2M A;  3M62 B;  1OEY A;  3LJ3 A;  1LQB A;  4ZRI A;  3W1Y A;  3DVG X;  4JQW C;  3PHW B;  1V49 A;  1Q5W B;  2DZK A;  1R4M I;  1V5T A;  4YL8 A;  4BKT A;  1C3T A;  3PRZ A;  1TZ1 A;  2AEH A;  2R2O A;  3QIJ A;  3U30 A;  1OTR B;  2G45 B;  2L00 B;  4AP4 C;  1ZKH A;  2K25 A;  1E5W A;  2FIF A;  2KOX A;  3R7R A;  2KAN A;  3ZTD A;  4LCD E;  4W9J A;  3ZNI D;  5CX3 A;  1TTN A;  3TCA A;  2IO0 B;  2JF5 A;  1RFA A;  2B3A A;  2Z0D B;  3HK0 A;  2JXX A;  4BFR A;  1KOT A;  1WM3 A;  2D3G A;  2N1V A;  3V61 A;  4EEW A;  2JWZ A;  2K6D B;  3K9O B;  5D94 A;  1VCB A;  2KWC A;  3QA8 A;  4KDI C;  2JZ3 B;  2LAS A;  4W9G A;  1E8X A;  4K81 A;  1RRB A;  1KJT A;  3ML9 A;  1WZ0 A;  1YQB A;  3U7D A;  2LGD A;  3HM3 A;  4W9D A;  1JRU A;  3SDL C;  2W9N A;  4DK5 A;  2J0K A;  3QX1 A;  1SE9 A;  2DEN B;  2GMI C;  2K1F A;  1WYW B;  4W9H A;  2KO3 A;  1V9J A;  3K9P B;  5DPW A;  2LZ6 A;  2LWP A;  3CST A;  3Q3F A;  5JZE B;  3GZN I;  3L16 A;  3TMP B;  3UF8 A;  1WX9 A;  3X0W A;  2Z0E B;  4ASW C;  4ICV A;  3DBR I;  3QAQ A;  2VRR B;  1UBQ A;  3JVZ X;  4LJP B;  4NQL B;  4XZ4 A;  2AYO B;  2LGY A;  1Y8R C;  3KW5 B;  2GBM A;  3UIP B;  4MSQ B;  2L0F A;  2ZPN A;  1WXV A;  1E7V A;  2MBH A;  3ALB A;  4FJY A;  2ZPY A;  4HWI B;  2IO2 B;  1LFD A;  2KMC A;  2LXC A;  4LDT B;  1YJ1 A;  3VUW A;  4WJP A;  3VXW A;  3ZNZ B;  2BKR B;  3H9D A;  2D11 A;  2D2Q A;  2MP2 A;  1V2Y A;  5IAA C;  4E3C A;  3AU4 A;  3N30 A;  2MX2 A;  2NPT B;  5AEK B;  4WQO B;  3IFW B;  2JY6 A;  4PS7 A;  5KHO A;  4ZRK A;  5D6J B;  2MP2 B;  2KWV B;  3IG3 A;  2D10 A;  4WWO A;  3NHE B;  1RAX A;  1SIF A;  4G50 A;  4GN1 A;  1EUV B;  3TIX A;  2BGF A;  2R2Q A;  4IWO A;  2C7H A;  2GBJ A;  2NR2 A;  2OOB B;  3KH0 A;  2YVC A;  2DYB A;  5JHB A;  2EKE C;  3ZNG C;  3VTW A;  1WXM A;  2KKC A;  1WGG A;  3GOE A;  4FUL A;  2C60 A;  2BYV E;  2XK5 A;  3CSF A;  3KUC B;  3DVN U;  3O65 B;  4G3X B;  1J0G A;  1H8C A;  3PHX B;  4MJS A;  2BKF A;  4PS3 A;  1EF1 A;  2KD0 A;  1NI2 A;  2O2V A;  1WJU A;  2KWU B;  3UQB A;  2FCS A;  3QAR A;  2O6V A;  4EUT A;  1TGZ B;  1L2N A;  2G4S A;  2MW5 A;  1UGM A;  4EFO A;  1IYF A;  4IWQ A;  5D7G A;  2ZNV B;  1X1M A;  2A5U A;  3DCG A;  5JH5 C;  2O6V B;  1WH3 A;  4E74 A;  3QQ8 B;  3IHP C;  1V80 A;  2DYM A;  3BY4 B;  3ECI A;  4CYE A;  3DBH I;  4K7U A;  1QZE A;  1V5O A;  3A4S C;  3LDZ E;  3VVW B;  3W1S A;  3I3T B;  3V60 A;  3A9J A;  4IM3 A;  2GBR A;  2L0T A;  2LRW A;  4EKU A;  2DZI A;  4HCP B;  4HXD A;  1Q0W B;  3JSV B;  4W9I A;  3WAL A;  2IY0 B;  2NVU I;  2ZZP B;  2LI5 A;  3L10 B;  2IO1 B;  1P9D U;  2I1K A;  4BKS A;  1GUA B;  2BWE S;  2KJR A;  1ZW7 A;  4HPL B;  2AL3 A;  5J17 A;  1GJZ A;  4DDG D;  5DPT A;  3ENE A;  3UQA A;  2IO3 B;  4ZDV A;  2L8J A;  4KSK C;  4ANW A;  4HLE A;  4ZRJ A;  2RGF A;  4URK A;  2CS4 A;  1WE6 A;  2FUH B;  4ICU A;  5DCN A;  4E71 A;  4FA6 A;  3A1Q B;  2XEW A;  2FCM A;  4AJY B;  3QK0 A;  1WX8 A;  1BT0 A;  1AAR A;  1P1A A;  5CHV C;  3RZW C;  2LVQ A;  3AXC A;  4RMA A;  2J0M A;  2L7R A;  1YIW A;  3TJP A;  2DYO A;  5AZG A;  3ZLZ A;  3PZD A;  5E6N A;  5E6P A;  3P2B A;  3ZUN A;  2JRH A;  5JHA A;  2HE7 A;  2KDI A;  4WAA A;  5CTR C;  4II3 B;  1J8C A;  4XX5 A;  2PE6 B;  3A4R A;  4JL9 A;  4XC2 A;  1WXS A;  2M17 A;  1WF9 A;  3VH3 B;  4B6W A;  2K6Q A;  2KQS A;  3EFU A;  2HTH A;  2FNJ B;  2KLG A;  3D32 A;  4A3P A;  1UH6 A;  1KM7 A;  3B08 A;  3L54 A;  4MGY E;  1OEY J;  4JIO U;  2KHW B;  2KNB A;  1V86 A;  2J7Q B;  2V3S A;  4WJQ A;  1EO6 A;  1NDD A;  1UBI A;  4FN2 A;  2CU1 A;  1V6E A;  3H7S A;  3ZW3 A;  5HKH A;  4TKN A;  4IWP A;  2DX5 B;  4TQ1 A;  5C23 A;  3DPD A;  4I6P A;  5AZH A;  2BF8 B;  2KFK B;  2CR5 A;  1OQY A;  3JYU A;  3WIM A;  5BO4 B;  2ASQ A;  2K8C A;  2QHO A;  2KTR B;  4AJW A;  4K7W A;  1WFY A;  4M8M A;  4NQK E;  2M0X A;  5FR6 A;  3EC8 A;  3KVF B;  5DPS A;  4DHJ D;  1WGH A;  2EMS A;  2LXA A;  3QJZ A;  2MSE D;  2NPT A;  2L3Z A;  2DZJ A;  2REX A;  4F1S A;  4DHZ E;  3PPA A;  1ZGU B;  3EEC A;  5C1Z A;  4JGH B;  3VH4 B;  1WX7 A;  1E90 A;  1S1Q B;  4BVU C;  3PLV A;  1PQS A;  3ZNH B;  2IZV B;  2JT4 B;  2ZVO A;  2KN5 A;  2N7E A;  1GG3 A;  4GDL B;  2L05 A;  1WE7 A;  2KDF B;  4GGQ A;  1U4A A;  2G4D B;  3HIZ A;  2LGX A;  4GXB A;  1IPG A;  2D07 B;  3VQI A;  4BOS C;  1E7U A;  2M1M A;  2JRI B;  3PSE B;  4X57 B;  4G0N B;  2FCQ A;  2OJR A;  4J6I A;  3A33 B;  4W9K A;  4HCN B;  2CKH B;  4GDK B;  2Y5B B;  5L83 A;  4IM0 A;  3ONS A;  2KQ7 A;  3H1U A;  1VD2 A;  1XT9 B;  3PV1 A;  5G55 A;  3DBL I;  3V6E B;  3NZU A;  3L08 A;  1ISN A;  3DQV A;  4M8N A;  3ZVV A;  2KX3 A;  1E8Z A;  4B95 A;  1RLF A;  2M8S A;  2MA9 B;  4I6L B;  2CHZ A;  3NY5 A;  1K8R B;  3RYT A;  3L0W B;  3RD2 A;  1WJ6 A;  3TBL D;  2N7D A;  2ZEQ A;  2K39 A;  1E8W A;  5TR5 A;  2PE9 A;  4II2 B;  4BKS D;  2PPH A;  3JSV A;  5LXI B;  2KK8 A;  4GOC A;  4KV2 A;  2M4N A;  2N9X A;  2HJ8 A;  1R4N I;  1CMX B;  5LLI A;  2LVO A;  3TL5 A;  2JUO A;  2RR9 A;  3QHT A;  3QWZ B;  3EHV A;  3S2A A;  2BWF A;  1Q1O A;  4KIK B;  4MM3 A;  4WJN A;  4HDQ A;  3X23 A;  4BKG A;  1M94 A;  1NBF C;  1D3Z A;  2I1J A;  3PLU A;  1WIA A;  2MWS B;  3HHM A;  4EZJ A;  3MTN B;  4AUQ C;  2KJH B;  5EDS A;  4GSW A;  3VAW A;  2NBV B;  2DAJ A;  3VUY A;  1E8Y A;  4G11 A;  2RSU A;  1WGD A;  3A1Q A;  3HM6 X;  3RZF A;  3VFK A;  3PS6 A;  2K8B A;  4NJ6 A;  2G3Q B;  2KX0 A;  3A9K B;  1H4R A;  4IM2 A;  2WDT B;  4HDO A;  4NAW B;  4KZ0 A;  1EF5 A;  4PYU A;  2V4L A;  2BYF A;  1WR6 E;  3OJ4 B;  1SGH A;  1YX5 B;  3APC A;  3VTU A;  2FCN A;  3B1L X;  2LUE A;  2KDE B;  1GC6 A;  4K1R B;  3RCZ A;  2L76 A;  2ZJD A;  4TQ0 A;  1J19 A;  1LM8 B;  3SU8 X;  1KLV A;  4MGK E;  4MGI E;  1MG8 A;  1WJ4 A;  3H6N A;  4DWF A;  3AUL A;  4F8C B;  4HVB A;  2FID A;  3SD5 A;  4K7S A;  4NY0 A;  2V1Y A;  4FHK A;  3PGE A;  4I6N B;  2AWT A;  4DBG A;  3H7P B;  2PEA A;  1Z5S B;  3ZDM C;  4DXA B;  2N1W A;  4JLC A;  4LDT D;  2KMA A;  2NBU A;  5D2M B;  2N9E B;  1WMH B;  4IUM B;  2KFK A;  1HE8 A;  2C7N B;  3KYC D;  1S3S G;  3WAP A;  1YX6 B;  3R66 C;  3AU5 A;  2KC1 A;  4P7I A;  4RM9 A;  5CHW A;  5G2N A;  2MBQ A;  3WAN A;  3PRP B;  2KTR A;  2IBI B;  4LJO B;  4GB9 A;  2MRP A;  2JZZ A;  3MJW A;  4FBJ B;  4ANX A;  1WRD B;  3NS8 A;  2NCN A;  3ZO5 B;  2KZR A;  1P98 A;  1UD7 A;  2KTF A;  2RPQ A;  3L17 A;  3R7Q A;  3PRE A;  4B9K A;  3RT3 B;  3T8M A;  4MGZ E;  1WJN A;  4KVG B;  4N9F 4;  3B0A A;  3Q3J A;  3ZDT A;  1GC7 A;  2EMT A;  3KUZ A;  5E6O A;  1WGY A;  2Z59 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...