2LT1A

Solution nmr structure of the 72-residue n-terminal domain of myxococcus xanthus card
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
75
structure length
75
Chain Sequence
AGHMPEGSASLQLAVGDRVVYPNQGVCRVSAIDVKEVAGQKLTFVTMRREEDGAVVMVPEGKVLAIGVRKVASAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CarD protein
publication title Structure-Function Dissection of Myxococcus xanthus CarD N-Terminal Domain, a Defining Member of the CarD_CdnL_TRCF Family of RNA Polymerase Interacting Proteins.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Transcription
total genus 5
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lt1A00
2LQKA 4KBMB 2LT4A 2EYQA 4XAXB 4L5GA 2LT1A
chains in the Genus database with same CATH superfamily
1MMNA 1VQ7A 2K57A 3VRYA 4F7UF 3SFMA 1KD1C 2ZGWA 3E9FA 3NFCA 2ZPHB 5FRNA 2OTLA 2JMCA 1ZSZB 3S3NA 1YITA 1AEYA 4OP0A 1Y0MA 3BDUA 2DEUA 3CMEA 2RJFA 1Y96A 4ZNXA 2DXCA 4C0DC 4J9GA 5DLQE 1N9SA 2ZPIB 2X4WA 1WXUA 1WGSA 3H0FA 2CUBA 3V7RA 1M90C 1BBZA 5FW9A 2VV5A 2QI2A 3OYFA 1IRXA 3EHRA 3MP1A 4PK4A 3JV3A 3V8LA 5GAN2 2EIFA 3GBQA 1Q95G 3JCMg 2EYWA 4PLIA 1VQ7T 3JCMd 2JW4A 2YSQA 4BI8B 2RNAA 1DJ7B 4M78A 2OTLT 2E6NA 4BE1A 2SRCA 2M02A 3E1SA 4P5NA 2X3XD 3MEUA 3EFOB 2Z0WA 4A53A 1VQ6Q 3CMET 3WVDB 4C8QE 2PVOB 2VGMA 1U3OA 5KYNA 2LJ1A 3T9NA 4CC2A 5GMKj 2GTJA 3EG2A 4PJLA 5GAN3 3CCLQ 1WHLA 1IHVA 5FWCA 1VQLA 4JZ3A 2CREA 1VQOA 3NTHA 1D1CA 2DL4A 2SEMA 4IIMA 3GIBA 3OBWA 4NL3A 4FM4B 2Y4YA 1UUEA 1YWOA 3SWNB 1I5OB 1M3AA 2MOXA 5KYUA 5GMKl 1YJNQ 2JS0A 2YT6A 1YIJT 1IO6A 4II1A 2I2LA 5ECAA 5DM7R 1ZUKA 2DILA 1WQWA 2QQRA 1UECA 1QVGA 3OSVA 2A28A 2G6FX 1QKXA 4KH0B 3ZFJA 4BB7A 1G8XA 4MDWA 1NZ9A 3OS2A 1RLPC 5CKEA 2LVMA 1QVGP 4WTOB 2KI7A 3S3OA 1Y96B 2BZXA 1FXXA 2EVRA 3M5AA 3JB9F 4M7DA 2L89A 2KQWA 1SHGA 1VQLT 1Q7YC 2BE9B 2XI9A 4JDSA 1VQOT 3G6EA 1K73U 5LJ3d 2JXBA 3HFOA 4IIOA 3OYHA 2HBWA 4GLMA 4Z8AA 1JB0E 3I55Q 1FMKA 5FU6C 4A63B 2X9HA 4J6XA 1UG1A 3E19A 4RKUE 1YI2A 1BU1A 2GCXA 1QP2A 2HQXA 2X4YA 2XHCA 1UEBA 2K5FA 4C5GA 2E1HA 1JJ2S 2LT1A 2E10A 3VS0A 4JZ4A 1ZSZC 2DJZA 2L3RA 4M78B 4XTYA 1SG5A 4ANJA 2DA9A 3MJXA 2HNIA 2D8JA 4AG2C 3UPUA 3P8DA 1AHJB 4OMPA 1WA7A 1X75C 4GY5A 3JB9D 3OYEA 2O01E 1QMCA 3KBGA 1WJSA 4C92A 1Q82U 2CS7A 2YUQA 1M5Q1 1JQQA 2HQEA 3A1PA 1Y07A 3M59A 3UA6A 2JZ2A 3G6ET 1BB9A 1YHQQ 4AT1B 3HKSA 5KYUB 3QG1A 2V8JA 4C8QG 4Y91A 1UTIA 3ER0A 3X24B 1UE9A 3PFSA 5GANf 5LL6S 3D7SB 2CUDA 1TSFA 4Z88A 1UGSB 4D8KA 2RN8A 4RG2A 4MMKA 1VQ5Q 3NHNA 3FJ5A 1V1CA 3VRZA 2OTJA 1H8KA 2RQWA 5GMKh 1VQ9A 3V7SA 2FZCB 1GRIA 1M1GA 3M53A 1XOVA 4M7DB 2QK0A 4C0ZA 3O8VA 3MP8A 4BDZA 4M75F 1VQNQ 5KH6A 3URGA 3QO3A 1E6HA 3VV0A 3P8HA 2DFUA 3LGFA 3PTAA 1A0NB 2PU9B 3SWNC 3QKJA 3MO8A 5C6SA 2FVUA 1D0XA 1V76A 4C92G 1LPLA 4F7UA 2ECZA 2D6FA 2ZPEB 1GL5A 1X01A 2RF0A 4NOYA 4LD9K 2DERA 2LP5A 2BZYA 2QQAA 2YUPA 3QWYA 4M7AE 2CDTA 2JTFA 3EG9A 2EFIA 3GNGA 4FU6A 3OYBA 2E5KA 2JNGA 3HFNA 3HRSA 3JCMe 3LH0A 2CT3A 3NTKA 3I56Q 3MEAA 2KBTA 1F1BB 1BI3A 1LVKA 3RNJA 3OW2A 2OTJT 1Z9QA 2X4JA 1VQ9T 2YLBA 4M75D 4XTUA 1R0CB 4C92B 3G71Q 3I5RA 2CP6A 4LN2A 2FHDA 1BKBA 3PVQA 5D6WA 3QDFA 3OW2P 2DZ9A 3FEOA 4HVVA 3EG0A 2FG0A 4C5EA 1MV0B 4HA8A 2K9GA 3HSBA 5GAOl 1BCOA 3SHWA 4J9DA 2FZGB 3CCJQ 3M54A 1YIJQ 1VQ6A 4JPBW 1VYTA 4OMFB 3G1JA 5GAOq 3EH2A 5M9OA 2GBQA 4HCKA 4XTWA 3PT9A 3HP9A 4OB0B 3EH1A 2MI6A 2O31A 1K9AA 1VQMA 4EDUA 3H0IA 3RBBB 1ZA2B 2YUOA 1FMVA 2AIRB 1R77A 1ABQA 2MCNA 1YJNA 4FYXB 1QP3A 4J7IA 3FIFA 4LE9A 3MEVA 2GF7A 4ZN3A 2KR3A 1WLPB 2HMAA 2QAZA 4DA4A 2KDSA 2QASA 1NYGA 3MKDA 5IXFA 2LQNA 3H0HA 2V26A 4FYYB 3M0TA 2ZPFB 1MMAA 5LJ3e 4ZTJA 4FW2A 4E7ZA 2Y4XA 2FPFA 3L42A 2FL7A 2J6OA 4F7UB 2GQVA 5D6YA 2QDYB 1X2QA 2A37A 2DZCA 3M0SA 3OQ5A 1WZOA 5CKBA 2MIOA 4M77E 3OYJA 1AWJA 2IPOB 2X4XA 1Q86R 1FWZA 2B8AA 1I5LA 1Q81C 3CCLT 2KAFA 1H3HA 3GF5A 4A54A 3QUIA 4A4EA 3OBYA 3TSWA 2BZ8A 2CZ1B 4C8QF 3I55A 1HYOA 4PFZA 2LX7A 2LQKA 3L2UA 1HJDA 2AZSA 1YJNT 2V1QA 5D6XA 2XKOC 4C8QC 2FPDA 4MZTA 2KMTA 2GFAA 1MV3A 3H41A 3IQLA 1AWOA 4QT7A 1YFNA 1PC0A 3A8MB 2EYQA 8ATCB 3MHXA 2LQWA 3CCQQ 5A0GA 4ESRA 8AT1B 4WCIA 1RUWA 1AD5A 1PSFA 2QXFA 4PJOE 4JRIA 4JJNK 1BIBA 4XU3A 1RAHB 5HK0A 1NJIU 1K8AU 2RJDA 2DO3A 4F16A 2LJ0A 4IUQA 3FC3A 1B34A 2EQUA 1BIAA 5LJ5d 3QJ6A 1AVZC 1OU8A 1YNZA 2PVDB 1YHQA 3PNWC 1D1BA 3HTRA 3TU4K 2EQIA 2CP7A 3OS5A 1VQPQ 4C92C 1PM3A 4XTXA 2E5QA 3JCMX 4PL6A 1OX8A 1VIFA 1TOVA 5KCOA 5IT9E 4QVZA 5FU7B 4MZPA 4QW2A 5CIUA 5KYYA 3JB9G 3M55A 3NTIA 2ZAEA 5IHIA 4NS5A 1M90U 1QVGS 1VQ5A 3JCMc 1XJWB 2F2WA 3OYDA 2RK2A 1OQKA 2MWOA 1V29B 2FB7A 2EKHA 4ZGJB 1WNLA 1ZBJA 5GMKi 2D0NA 3PMTA 1C6VX 4J9CA 1VQNA 4DBFA 2A08A 1M1KC 3REAB 5IN1A 4CRIA 1T3SA 1X27A 1NPPA 1YHQT 1HD3A 4XTVA 2L3SA 3G4SQ 5FU6B 2NUTA 1IXDA 4M75A 5GAOn 1JRIA 3VUZA 1KK7A 4J9FA 2J7IA 4VUBA 4L5GA 3THKA 1VQ8T 4C0FA 3VS4A 3M4YA 3QPHA 4JRPA 1W4SA 1QCNA 1G3SA 2RB6A 3FRNA 1VQ5T 3I56A 2EYXA 4M78E 3BDLA 2X35A 1KC8C 4PFOA 5GAMg 4EPCA 5GAMd 4IKFA 2DYBA 4HXJA 3EGUA 1G3TA 2DAQA 4V2SA 3P8BB 1B34B 1IHWA 4FYVB 1EIFA 2IVWA 1VQNT 1W6XA 1VA7A 1WYXA 2JM9A 3DLLA 4J5YA 1JEGA 4D8DA 3CCVQ 2QEXQ 3CCJA 1YIJA 1ABOA 4KRTA 2YDLA 4DOVA 3M56A 3JB9H 5CKHA 2HZYA 4LD6A 2CH4W 1XQHA 2DIQA 2LCCA 2P84A 2RO0A 5CKDA 3RIRA 3OYCA 2HDAA 4QVDA 5KYYB 4RUGA 4RTYA 1G5VA 1Q7YU 1TWBA 2XDBA 5I22A 4HT8A 4M75G 2RH2A 3CXCA 2HKQB 3ZBDA 5A0DA 1N9RA 4Q5WA 4LNPA 3M4GA 1OEBA 2RI2A 3I56T 3RERA 1WXTA 2CP2A 5EG2A 4M7AF 1O9SA 1SEMA 2HSPA 3CXCP 2VC8A 2H3EB 2DPPB 3G71T 1OI1A 1TXQA 1RACB 1KHCA 2K5LA 3GP8A 5KCHA 1VOMA 1KHIA 4J9BA 3TSZA 4DOWA 2GGRA 2O88A 1T3LA 2M16A 4JJDA 4AG1C 1OZ3A 2DXUA 3M0RA 4MMLA 1X6GA 1ZBXA 3CCJT 2NUTB 5A2QE 4M75B 4Y28E 2WSEE 1W2BA 5FU7C 2VWFA 4X1VA 7AT1B 2ED1A 2K6DA 2RHIA 2OAWA 4AMCA 4C5HA 3CC4T 1K9MR 1I8FA 1M4ZA 1OPKA 1N27A 3DKMA 3OMCA 4UC4A 1W2BP 2L3QA 4M7AD 1K0XA 2XMFA 5HK3A 3OYMA 2E3IA 5CKFA 1K9MU 2KYBA 3GPLA 3CCEQ 1I0CA 1JXMA 1K73R 1FYNA 1C0MA 1EZZB 4JS4A 2EGAA 3C0CA 1VYVA 4OMNA 5LJ3j 5DLOA 4C8QA 2IIMA 3L2QA 1VQKQ 3OYYA 4RTVA 5LJ3g 4FIBA 4R55A 4DBRA 3OYLA 3ME9A 4PKCC 4D6WA 2E6ZA 5LJ5e 3LX7A 2E12A 1WHHA 2P0QA 3CCQA 3MCAB 4FW1A 2COWA 3CPWA 3X28B 1LNXA 1UHCA 3E9GA 4AFSC 2KT8A 2O2OA 3C4SA 4ATOA 2K2MA 4O6JA 2HL5C 4YTLA 5GAOm 2JMAA 5CR2A 3CPWP 3C12A 3X26B 3FLGA 4AFUC 2YHTA 2QGGA 2VVKA 4XQ3A 3SDZA 1KIKA 3CCMQ 2LCLA 1Q82R 1MMDA 1NPRA 3EHQA 4M77F 1Y7XA 2LQ8A 1QCFA 3ASKA 2OX7A 1VQPA 1D1AA 2W0ZA 4ZGDB 1UGQB 4FYWB 3PIPA 3HRTA 1GFCA 2K3XA 4N4IA 4C0GA 4A4HA 5KE2A 3EFSA 1BI1A 2DVJA 2CSQA 4MDXA 1ZX6A 3JCMQ 1X6OA 5KYXA 3V7CA 3TEEA 1B3QA 1TS9A 3JB9J 4OMOA 4J9HA 3CCQT 3JCMh 2B86A 1MGQA 2F1LA 3I5SA 1D0YA 5CQXA 1N8RR 4QVCA 1Y57A 2ESWA 1SPKA 4E7LA 2VUBA 2F2XA 4PFPA 4X9DA 1VQ8Q 1VYUA 2C0TA 3RKWA 4E7HA 1YP5A 4M77D 3QYHB 1N8RU 1PKSA 2PUKB 2DNUA 1B7TA 2L5QA 2AK5A 4PJOF 1HXDA 4OMMA 2KEAA 1VIEA 2DTHA 3G4SA 2M51A 5HCKA 4EMHA 1VQPT 1QKWA 4IUTA 2DEQA 3UT1A 3RR6A 3EG1A 1IZ6A 5GAMe 3R6NA 1ZA1B 4C8QB 5C0MA 3HL8A 1UJYA 1M1FA 4IUUA 2RJCA 4FT2A 2ROTA 2L8DA 2PZ1A 4JUVA 4M75C 2KE9A 4R56A 3GNFB 2XDDA 4XU2A 2P4TA 4OB1B 3DB4A 3SB2A 1RADB 4PJOD 2LRQA 4KGZB 1MNEA 3CCSQ 2VGNA 1I4K1 1JU5C 1NLPC 3CC2Q 2CH4A 3ZL7C 2QEXA 5J26A 2DD5A 3VS1A 4FL6A 1PG5B 1PNJA 1D09B 2M9UA 2HBPA 2K4YA 2PNIA 3G4ST 1G3YA 2EJFA 2J06A 2XICA 5LJ3h 5GANg 1SHFA 2NUPB 3V8JA 1QLYA 5GANd 1Q81U 2YWWA 2KT1A 1YITQ 2KXCA 1WIEA 1KQSS 1KJWA 1RI0A 5KYXB 2CP5A 1GBRA 2LJ3A 1QVPA 4BI3A 2OAUA 2DMOA 2CYZB 2LMJA 2K2VA 3JSCA 2LC4A 1UDLA 4LUEA 3VU3C 1WJRA 2MPXC 2EGCA 1AZEA 1QQJA 3CCLA 3SD4A 2P0PA 1OPLA 4JRKA 2DKGA 3CC4Q 2DL8A 4FSXA 4HCCA 1UGVA 4J6YA 1AWWA 2HL3A 2EKOA 1JJ2A 4M78F 3LGLA 2MAMA 2RI3A 4OF1A 2BUDA 2VASA 5GAN5 1RAIB 2LTOA 3CCVT 2EGEA 2QEXT 1QVFS 4B6MA 2DETA 2E3HA 2YXYA 1JJ2P 2DVEA 2DK3A 2DM1A 4M4ZA 3X20B 4XU0A 2IG0A 1S72Q 5IXBA 4F17A 3M9QA 4RTUA 1OOTA 2XDPA 3QWXX 1OYXA 2KY9A 4J6WA 4HCBA 2KGTA 9ATCB 4A4KA 4Z89A 3CCEA 2BKDN 2V1RA 3OMGA 3LWHA 4EMKA 5CK9A 2F5KA 4F14A 1RL2A 1G2BA 3M0PA 1PKTA 4M78D 4CC4B 2VB6A 1UHFA 1VQKA 3PGGA 2O4XA 4RTWA 4DBQA 1M8MA 2ZZDA 3NMZC 1YJWQ 1PSEA 2I0NA 1LJOA 1M2OA 3UDCA 4E7SA 2L3PA 3O5ZA 4J7FA 2XD0A 2LX9A 4HKEA 1RABB 3VS7A 3EAEA 2C06A 3VJPA 1K4US 1HK9A 4XTZA 3UWNA 1OV3A 4M7AG 2CP0A 1X43A 4M7DF 1ACMB 1YBYA 3JRZA 3OS0A 3M58A 1M1KU 3EFRA 3TQ7P 2RM4A 3LWIA 3CCMA 1NJIR 1K8AR 1ZHIA 1UJ0A 1KD1R 4AFQC 1C1AA 2CGHA 4B9WA 1FX7A 2DE0X 1D0ZA 2JS2A 1NYFA 1K76A 3CCET 2DL3A 3CD6Q 5LJ5j 1KD1U 3LYIA 1G3WA 2E65A 3EG3A 1WI7A 5LJ5g 3X25B 1VQKT 4M77A 3S3MA 2QA4Q 3DB3A 2ROLA 3J7AF 4M7AB 3CCUQ 4LDYA 2VXEA 1YI2Q 3RKXA 1K1ZA 2HSEB 1KC8U 3KUFA 3JCMb 3AHUA 4KT0E 4M7DD 4J9EA 4XK8E 1TUGB 3JCMP 1M90R 1H3ZA 2QG9B 1I81A 4BE0A 1YCSB 4PJMA 1VQ8A 3BFMA 2COZA 1W2BS 1QW1A 4OGCA 3PE0A 2R5MA 2O9SA 2PUOB 2PVGB 2KNBB 2ZCFB 3CCMT 5GJVB 2O9VA 2QDLA 1BYMA 3L2WA 2DYIA 5L8RE 1YWPA 3EGXB 4EMKB 3NGPA 3QDRB 3L2VA 3N5BB 2CKKA 1M2VA 2WACA 4PJJA 2E4HA 2O4XB 4N0AA 1Q86C 2MK5A 1XNIA 4ZGEB 3UATA 3OYAA 2RD1A 2DIGA 4PJNA 3JCMV 1W1FA 2GFUA 3PIOA 4JLGA 1S1NA 1VQ4Q 3L2RA 2KK4A 4E2FB 3JCMf 3CC7Q 4XAXB 1OZ2A 2EJGA 3LH5A 1OULA 4N4GA 4M77G 1RLQC 1MMGA 4DBHA 1U1TA 2PTKA 2E41A 2ED0A 2NWMA 1M3BA 1NEGA 1WHMA 5I11A 4TVRA 5GANe 2RQRA 2DRMA 4ME7A 3CCSA 5HY6A 4A4FA 1EX4A 2DBMA 5GAMj 3J80E 2AKKA 2JN0A 2EAYA 3LLRA 1BI2A 5CQYA 1WHJA 3M0QA 3G71A 1SRLA 1ZQ1A 2KYMA 3LW5E 3A5ZB 3FDRA 1W70A 3MEWA 3RDVA 2VKNA 4M77B 5KYWB 3Q1JA 2DLPA 1XTDA 2KROA 2NUZA 3TREA 4BY6B 1Z9ZA 5GAN6 1U06A 3OYGA 4X9CA 1H92A 2EQKA 2HQHA 3QXEB 2CT4A 1Q7YR 5CVIA 4QQDA 3VKIA 4RTXA 4PJOG 2KRNA 3QBYA 1TUDA 1PWTA 4KGXB 2FO0A 3WVEB 3CC4A 1TG0A 3GLXA 3META 2P0KA 2QQ9A 3H9NA 3CCST 4Z02A 3QHSA 1P92A 3QZ5B 2RHXA 2CP3A 3GOXA 3CC2T 1KSWA 5GAN4 1WXBA 2V8IA 2JTEA 5LJ5h 2VYTA 2X51A 5LJ3f 1M2VB 1S72A 4MZMA 4PJOB 2MWPA 5IHNA 3JB9I 1YITT 2RA2A 2CZ6B 4M7AC 1EFNA 4M7DE 1SSHA 2FZKB 3VYHB 2A0FB 2F69A 1AT1B 4K11A 2EWNA 1X6BA 4GLKA 1TU0B 4A4GA 3KFVA 2JJ9A 1VQMQ 1LCKA 5IAYA 1QWEA 1PD0A 3CMAQ 2HEQA 2LT4A 5FWBA 3RUXA 4KUIA 2YRDA 4KH1B 2RHZA 4ELZC 1WX6A 1YJWA 2QQBA 4EMKC 5J39A 1QCOA 4JS5A 2FRYA 4IUVA 3EGDA 4QQGA 4B9XA 1ZSGA 1AZGB 3OW2S 2RQUA 3RESA 4J9IA 3CPFA 1SRMA 1S72T 2A3LA 4C92E 3OS1A 3HHTB 3VUBA 2YRCA 2LZ6B 2KRSA 2GTOA 2EW3A 4M78G 2G3RA 4KGVB 5EC7A 3VS5A 2DJQA 2NLUA 2X3WD 1N6AA 1MHNA 2EBPA 3OA6A 3CD6A 2FPEA 1YJ9Q 1AOJA 4X34A 1GBQA 2COYA 2D8HA 1RAAB 4HVUA 1G83A 1CKAA 1CSKA 5I2MA 2XG8D 1H641 1GFDA 5GAMh 2KSSA 2NYSA 3TCJA 4CI0C 4PNOA 2QA4A 2E64A 2LCSA 3CCUA 3M57A 1M3CA 1UGPB 2DBKA 1YJWT 4F04B 4OGEA 4BUGA 3RKYA 2K3BA 2HCKA 2RHYA 2RMOA 2AT1B 1VUBA 3KXTA 3MPUB 3QZ9B 2AZVA 2EYZA 2NUPA 4OB2B 4M77C 4BI4A 2WSFE 1KQ1A 2EQJA 4BY6C 5GAOp 2HAXA 4HCZA 4BE2A 4E7JA 2F2VA 1RAFB 3J81E 3WXMB 2DTOA 2RQVA 3JCMW 4EMGA 2V8KA 4BD3A 4GBQA 4OMQA 2CZ7B 1MNDA 2ABLA 4NL2A 2GNCA 3CD6T 2H8HA 3OB9A 4F7UE 4O5VA 1U8RA 4RTZA 3INZA 2A36A 3OYKA 3CCRQ 5FRMA 1QWFA 3A8OB 2JVVA 4M7DG 1K9MC 2QA4T 3FB9A 1NEBA 3CCUT 4ORZA 3E2UA 2J6KA 5GAOr 1VQ4A 2PQWA 1YI2T 1KG1A 2DF6A 3M0UA 3CC7A 2M1HA 2LNHB 3EGDB 2FEIA 5CAIA 4ELYC 1PHTA 1HSQA 1KQ2A 2JOYA 2OI3A 4CC3A 2RJEA 1K73C 2J6FA 4N0AC 4PJOC 1J3TA 4R0KA 4QKUA 2DX1A 3U23A 4C5IA 3JCMJ 2FRWA 4JRQA 1OU9A 4BACA 2L2PA 1GCQC 2XU8A 4KUDK 2DTIA 4DQ2A 3VS2A 2MF2A 2EJ9A 3R6OA 5AYFA 3SEMA 2CSIA 5I21A 2DXBA 1GCPA 1NG2A 1JXOA 1OX9A 4WF2A 2Y90A 2RHUA 1Y71A 4OB3B 3A8HB 1SKUB 1PRLC 2R5AA 3OSSC 1WHKA 1JBMA 1ARKA 4N4HA 3VS6A 3I35A 1WDXA 4AFZC 2F5TX 2MYSA 2YRVA 3CCVA 1T0JA 3HPWA 4LDVA 4RCCA 1Q81R 2DL5A 3VS3A 2ZPGB 5CCAA 1VQ4T 2C0IA 3UF4A 1Q82C 1VQ7Q 1MUZA 5GANj 2RK1A 2RPNA 2CZ0B 3CC7T 1I1JA 4LDUA 6AT1B 2OTLQ 1M8VA 4L59A 1KFZA 4E7IA 1TH7A 2W10A 2GQIA 3ZEHA 2BIVA 3CMEQ 4E6RA 2WSCE 2KVQG 3QYGB 1JO8A 2YUNA 1RAEB 4QQ6A 4E47A 1UGRB 1T0HA 2D1XA 2KXDA 5A0LA 2M0OA 1NBEB 4DEXA 5GAN8 1N8RC 1RI9A 2K3YA 5GMKe 3VYGA 2VXFA 2LNVA 4LDWA 4XU1A 2AHJB 4DEYA 1K0SA 3RMQA 4M7AA 4OMLA 2D9TA 1B07A 3CBOA 2AKLA 4RG8A 1U5SA 1IGQA 2QGFB 2K79A 4M78C 1D3BA 3H6ZA 1LOJA 1ZUUA 4F7UG 2C0OA 2DRKA 3H8ZA 2OJ2A 2HD0A 3CMAA 2JM8A 2FYKA 2R57A 5CO7A 2ZPBB 2DXTA 3OYNA 5L23A 2EQMA 4ZTFA 1CKBA 5FROA 5D7UA 1TTHB 2H3JA 4RTTA 4E7KA 4FCYA 3EGXA 1VQLQ 1R0BG 1X69A 5LJ5f 2JT4A 1VQOQ 2DL7A 3A98A 4CC7A 3F70A 2LDMA 3TVTA 5GAN7 2XIDA 1U1SA 2RQTA 4FSSA 3C95A 2ENMA 2J05A 1I07A 1SSFA 2EPDA 1VQ6T 2E70A 2K7AA 4RCBA 1PD1A 1M30A 3NPFA 2QTVA 5AT1B 3EG9B 1M1KR 2EYYA 2ATCB 1YN8A 2BTTA 4C0DB 5IHKA 4OVAA 1ZLMA 4JJCA 1YJ9A 4Y92A 4J83A 1RAGB 1VQMT 2BE7D 1Q86U 4JLIA 1FMWA 5FLXE 1IB8A 5J3BA 3CMAT 3V8KA 3L2ZA 1NLOC 2RI5A 1SF9A 3A8GB 2DD4A 2KRMA 4LXCA 4RMOA 4KBMB 4M7DC 3BY7A 2L0AA 3CXCS 1UB4A 3G7ZA 4HT9A 3BW1A 3UA7A 1WJQA 3I9QA 3G6EQ 3A8LB 3CEYA 3MP6A 1ZSZA 4EIKA 1KC8R 2R58A 3S6WA 5KE3A 3OYIA 1WFWA 5KYWA 4PLLA 4L6V5 3FJPA 3L1AA 2QYZA 1M9SA 2JUFA 1BI0A 5GANh 3JAME 3BE3A 3C94A 1NE8A 4C8QD 1E6GA 3PMIA 3QJYA 1PRMC 1D3BB 1M27C 1NM7A 4C92F 1YJ9T 3ULRB 4ZN1A 4IUPA 2MMPA 3CCRA 4M75E 1E7OA 5HKCA 3CQTA 3QSUA 1R8OB 3I55T 5GAMf 5I2SA 3CBPA 1PCXA 1IREB 3OY9A 3PVLA 1KQSA 2HKNA 3QIIA 4BDYA 1X2KA 5GMKm 3CBMA 1GXIE 4J8OA 4PJOA 1WPYA 4LUDA 1TUCA 1KQSP 1IGUA 3EFOA 2K5IA 3RMSA 1WHGA 3HRUA 5DY9A 1AWXA 1WQ7A 2D0QB 4IURA 4JJBA 3AT1B 1GCQA 1YCYA 4C92D 5GJWB 2P4RA 1BCMA 1O75A 1N5ZA 4LDXA 3CPWS 2M0YA 2XK0A 1QVFA 3SWNA 1BK2A 3CCRT 1UFFA 4KULA 2QTXA 4FT4A 2YLCA 5IH2A 2OTJQ 4HVWA 3REBB 1VQ9Q 3CC2A 2JTMA 2QQSA 1QVFP 2A7YA 1NJIC 3DLMA 1K8AC 1ZUYA
chains in the Genus database with same CATH topology
2A3LA 4XU2A 4C92E 1VQ7A 2CZ1B 2K57A 3HHTB 3VUBA 4C8QF 3SFMA 4F7UF 2P4TA 2ZGWA 3OS1A 1KD1C 4OB1B 3I55A 2LQKA 3E9FA 3NFCA 2ZPHB 5FRNA 2OTLA 3L2UA 3DB4A 3SB2A 4PJOD 1YJNT 2LRQA 4M78G 2G3RA 3S3NA 5D6XA 2NLUA 2XKOC 1N6AA 1MHNA 1YITA 2VGNA 4OP0A 4C8QC 1I4K1 3BDUA 4MZTA 3OA6A 2KMTA 2GFAA 2RJFA 3CMEA 3CD6A 4X34A 2QEXA 5J26A 2DD5A 4FL6A 1Y96A 2M9UA 2HBPA 2K4YA 3A8MB 3G4ST 5I2MA 1G3YA 2EJFA 2DXCA 2EYQA 2XG8D 4C0DC 2XICA 1H641 5LJ3h 3MHXA 5GAMh 2KSSA 2QA4A 3TCJA 4CI0C 4PNOA 5GANg 3V8JA 5DLQE 2E64A 4RMOA 3CCUA 3M57A 5A0GA 1S72T 1N9SA 5GANd 1UGPB 1Q81U 2ZPIB 1YJWT 2X4WA 1PSFA 2QXFA 1WGSA 3V7RA 4PJOE 4JRIA 4OGEA 1BIBA 4JJNK 1M90C 4BUGA 3RKYA 4XU3A 5HK0A 1KQSS 1NJIU 1RI0A 1K8AU 2RJDA 2DO3A 2RHYA 1VUBA 3JCMe 2VV5A 3KXTA 2QI2A 3OYFA 4BI3A 1QVPA 3QZ9B 4IUQA 3FC3A 4OB2B 3MP1A 1B34A 2EQUA 1BIAA 5LJ5d 2OAUA 2CYZB 2K2VA 4M77C 3JSCA 4BI4A 2LC4A 3V8LA 5GAN2 3QJ6A 2WSFE 2EIFA 1WJRA 3JCMg 2PVDB 3VU3C 1YHQA 3PNWC 1KQ1A 2EQJA 4PLIA 4BY6C 5GAOp 3JCMd 3TU4K 1VQ7T 2HAXA 4HCZA 4BI8B 3CCLA 4BE2A 3SD4A 4E7JA 2P0PA 4JRKA 2DKGA 3OS5A 1DJ7B 4M78A 2OTLT 4FSXA 2E6NA 3J81E 4HCCA 3WXMB 4J6YA 4C92C 3JCMX 2DTOA 2E5QA 4XTXA 4EMGA 2V8KA 4PL6A 4BE1A 3JCMW 4BD3A 3E1SA 1VIFA 2EKOA 1JJ2A 4M78F 5KCOA 4P5NA 5IT9E 4QVZA 5FU7B 2CZ7B 3LGLA 3MEUA 2MAMA 4MZPA 4QW2A 5CIUA 4NL2A 4A53A 2RI3A 4OF1A 3CMET 3CD6T 2BUDA 3WVDB 3OB9A 4C8QE 4F7UE 2PVOB 2VGMA 5GAN5 2LTOA 4O5VA 3T9NA 3CCVT 1U8RA 2QEXT 3INZA 1QVFS 3JB9G 3M55A 5GMKj 3NTIA 3OYKA 4NS5A 1M90U 5GAN3 5FRMA 3A8OB 2DVEA 2DK3A 1QVGS 1VQ5A 3JCMc 3X20B 2JVVA 1VQLA 4XU0A 4M7DG 2IG0A 2QA4T 1K9MC 3FB9A 1VQOA 3OYDA 3NTHA 3CCUT 2RK2A 3GIBA 5GAOr 1YI2T 3OBWA 2PQWA 4NL3A 1VQ4A 1KG1A 2MWOA 4FM4B 1V29B 2FB7A 2Y4YA 3DLMA 1K8AC 3M9QA 3CC7A 2M1HA 1WNLA 3SWNB 4ZGJB 5GMKi 2XDPA 5CAIA 5GMKl 4ELYC 1KQ2A 3PMTA 2JOYA 1OYXA 2KY9A 4J6WA 4HCBA 2RJEA 1YIJT 1K73C 4N0AC 4II1A 1VQNA 2I2LA 4PJOC 4A4KA 5DM7R 1M1KC 3CCEA 2BKDN 3OMGA 5IN1A 4CRIA 4EMKA 3LWHA 5CK9A 2F5KA 4C5IA 1WQWA 1NPPA 1RL2A 2QQRA 3JCMJ 1YHQT 4JRQA 4BACA 4M78D 4XTVA 3OSVA 1QVGA 2XU8A 5FU6B 1VQKA 4KUDK 2DTIA 3PGGA 4DQ2A 2MF2A 2O4XA 2EJ9A 3R6OA 5AYFA 4M75A 5GAOn 1JRIA 3ZFJA 4BB7A 4MDWA 1NZ9A 2ZZDA 3OS2A 3VUZA 5I21A 4VUBA 5CKEA 2LVMA 2DXBA 1PSEA 4L5GA 1LJOA 4WF2A 2Y90A 2RHUA 1Y71A 4OB3B 3UDCA 3S3OA 1VQ8T 4J7FA 1Y96B 2XD0A 4C0FA 2LX9A 3A8HB 4HKEA 1FXXA 2R5AA 3EAEA 3M4YA 3QPHA 4JRPA 3OSSC 1JBMA 1W4SA 3M5AA 2C06A 3JB9F 4N4HA 4M7DA 3VJPA 1G3SA 2L89A 2RB6A 2KQWA 1HK9A 3FRNA 4XTZA 1VQ5T 2F5TX 3I56A 1VQLT 3UWNA 2YRVA 1Q7YC 4M78E 3BDLA 2X35A 2XI9A 5GAMg 3CCVA 4JDSA 1KC8C 4M7AG 3HPWA 4LDVA 4RCCA 4EPCA 3G6EA 1VQOT 1K73U 5LJ3d 4M7DF 3HFOA 2ZPGB 5GAMd 4IKFA 5CCAA 1VQ4T 1YBYA 3JRZA 3OS0A 1Q82C 3M58A 1M1KU 3EFRA 3OYHA 5GANj 1G3TA 2RK1A 2RM4A 2DAQA 1JB0E 2CZ0B 3LWIA 3CCMA 3CC7T 4LDUA 5FU6C 1ZHIA 4V2SA 3CPWA 3P8BB 4J6XA 1M8VA 4L59A 3E19A 1B34B 4RKUE 1YI2A 2GCXA 1QP2A 2CGHA 4B9WA 2HQXA 2X4YA 1EIFA 2IVWA 1UEBA 1FX7A 2K5FA 2XHCA 4C5GA 2E1HA 4E7IA 1TH7A 1JJ2S 3CCET 3ZEHA 2BIVA 3DLLA 2LT1A 2E10A 4J5YA 2WSCE 5LJ5j 2KVQG 3QYGB 3CCJA 1KD1U 3LYIA 1G3WA 4QQ6A 4E47A 1YIJA 2E65A 2DJZA 2L3RA 5LJ5g 4M78B 3X25B 4DOVA 3M56A 4XTYA 3JB9H 5CKHA 1UGRB 1VQKT 4LD6A 3UPUA 2HNIA 4M77A 1XQHA 2DIQA 2LCCA 2RO0A 5CKDA 3P8DA 1AHJB 3S3MA 3RIRA 3DB3A 3OYCA 3J7AF 4QVDA 4M7AB 5A0LA 1X75C 2M0OA 4GY5A 4LDYA 2VXEA 3JB9D 3OYEA 1G5VA 5GAN8 3RKXA 2O01E 1N8RC 1Q7YU 2K3YA 5GMKe 3KBGA 3KUFA 3JCMb 1KC8U 3AHUA 3VYGA 2VXFA 2LNVA 4KT0E 2XDBA 4M7DD 1WJSA 4LDWA 4XK8E 1NJIC 4C92A 4XU1A 1Q82U 4HT8A 2AHJB 2CS7A 4M75G 2RH2A 3CXCA 3JCMP 1M5Q1 1H3ZA 5A0DA 3ZBDA 3RMQA 1N9RA 4Q5WA 4M7AA 1I81A 4BE0A 2HQEA 2D9TA 2RI2A 3M4GA 3I56T 1VQ8A 3RERA 1Y07A 3BFMA 3M59A 5EG2A 3CBOA 2JZ2A 1W2BS 4RG8A 1QW1A 3G6ET 4M7AF 4OGCA 1O9SA 2R5MA 3HKSA 2PUOB 2PVGB 2VC8A 4M78C 2DPPB 2ZCFB 1OI1A 3G71T 3CCMT 1D3BA 1BYMA 2K5LA 1KHCA 3QG1A 3GP8A 3H6ZA 2V8JA 4C8QG 1LOJA 4F7UG 4Y91A 5KCHA 3L2WA 3H8ZA 1KHIA 5L8RE 3ER0A 2HD0A 3X24B 4DOWA 4EMKB 3CMAA 2FYKA 2R57A 3QDRB 3L2VA 3PFSA 5CO7A 2M16A 5GANf 2ZPBB 2DXTA 5LL6S 3OYNA 1OZ3A 2DXUA 3N5BB 4MMLA 1UGSB 2CKKA 1ZBXA 2EQMA 2WACA 3CCJT 4ZTFA 5FROA 2O4XB 4N0AA 1Q86C 5A2QE 4M75B 4Y28E 1XNIA 4ZGEB 4RG2A 2H3JA 3OYAA 2RD1A 2WSEE 1W2BA 5FU7C 4E7KA 4MMKA 2DIGA 3JCMV 5LJ5f 2GFUA 3PIOA 4JLGA 2OTJA 2RHIA 5GMKh 3F70A 2LDMA 3V7SA 4C5HA 1VQ9A 3L2RA 2KK4A 5GAN7 3CC4T 2XIDA 1U1SA 1I8FA 1M4ZA 3OMCA 1N27A 3DKMA 1M1GA 4UC4A 3JCMf 3M53A 1XOVA 4XAXB 1OZ2A 3C95A 4M7AD 2EJGA 4M7DB 4N4GA 1SSFA 4M77G 5HK3A 3OYMA 4C0ZA 3O8VA 5CKFA 1VQ6T 3MP8A 1U1TA 4M75F 4BDZA 5KH6A 2E70A 2E41A 3QO3A 3URGA 3VV0A 3P8HA 1K9MU 4RCBA 3GPLA 3LGFA 3PTAA 2PU9B 3SWNC 3QKJA 4TVRA 5GANe 4JS4A 3MO8A 5C6SA 4ME7A 2FVUA 3CCSA 5HY6A 4A4FA 4C0DB 4C92G 4OVAA 5LJ3j 5DLOA 5GAMj 1YJ9A 4C8QA 4F7UA 3L2QA 2D6FA 2ZPEB 3OYYA 1X01A 4J83A 4NOYA 5LJ3g 4FIBA 4LD9K 3J80E 4R55A 1VQMT 2JN0A 3OYLA 1Q86U 2EAYA 4JLIA 5FLXE 5J3BA 3LLRA 3ME9A 3CMAT 2QQAA 4PKCC 4D6WA 2E6ZA 1BI2A 3V8KA 5LJ5e 3L2ZA 3LX7A 5CQYA 2E12A 4M7AE 2JTFA 2RI5A 3G71A 2P0QA 3CCQA 3MCAB 3A8GB 2DD4A 1ZQ1A 2EFIA 3LW5E 1VQNT 3GNGA 4FU6A 3OYBA 2JNGA 3A5ZB 3FDRA 3HFNA 3HRSA 4KBMB 3LH0A 3MEWA 3X28B 1LNXA 3E9GA 4M7DC 4M77B 3BY7A 3CXCS 1UB4A 3Q1JA 3G7ZA 3NTKA 1XTDA 4HT9A 3TREA 3MEAA 3BW1A 3C4SA 4BY6B 4ATOA 5GAN6 4O6JA 1WJQA 3OYGA 5GAOm 1BI3A 4X9CA 4YTLA 2EQKA 3QXEB 3OW2A 2OTJT 3A8LB 2X4JA 3CEYA 3MP6A 5CR2A 2YLBA 3C12A 4M75D 4XTUA 3X26B 1VQ9T 5CVIA 3FLGA 4QQDA 2YHTA 3VKIA 2R58A 4C92B 4XQ3A 3SDZA 4PJOG 3S6WA 5KE3A 3OYIA 3QBYA 2LCLA 2FHDA 1BKBA 4PLLA 5D6WA 1NPRA 4L6V5 3FJPA 2DZ9A 3FEOA 4M77F 3WVEB 1Y7XA 2LQ8A 3ASKA 3L1AA 3CC4A 1M9SA 2JUFA 1BI0A 3GLXA 3META 5GANh 1VQPA 4ZGDB 4C5EA 2P0KA 3JAME 3C94A 4HA8A 1NE8A 1UGQB 3HSBA 2QQ9A 5GAOl 3PIPA 3HRTA 4C8QD 2K3XA 4N4IA 4C0GA 3PMIA 3QJYA 3CCST 3M54A 4Z02A 3QHSA 1D3BB 1VQ6A 1P92A 4A4HA 4C92F 3QZ5B 2RHXA 1YJ9T 4OMFB 3GOXA 3CC2T 5KE2A 3EFSA 4ZN1A 4IUPA 2MMPA 5GAN4 5GAOq 3CCRA 4M75E 1BI1A 2V8IA 4MDXA 5HKCA 5M9OA 5LJ5h 3JCMQ 2VYTA 1X6OA 3V7CA 3QSUA 1R8OB 3TEEA 3I55T 5LJ3f 3JB9J 4XTWA 5GAMf 5I2SA 3PT9A 3CCQT 3JCMh 3CBPA 3HP9A 4OB0B 1S72A 1MGQA 2MI6A 4MZMA 4PJOB 1VQMA 2MWPA 4EDUA 3JB9I 5CQXA 1IREB 3OY9A 1YITT 4QVCA 2RA2A 2CZ6B 4M7AC 1KQSA 4M7DE 4E7LA 2VUBA 4X9DA 3QIIA 4BDYA 1YJNA 5GMKm 3CBMA 3RKWA 1QP3A 3VYHB 2F69A 4J7IA 4E7HA 2EWNA 3FIFA 4J8OA 1GXIE 4M77D 3MEVA 2GF7A 4ZN3A 3QYHB 1N8RU 4PJOA 1WPYA 2PUKB 2L5QA 4GLKA 4A4GA 2K5IA 3RMSA 4PJOF 4DA4A 1HXDA 2KDSA 3HRUA 5DY9A 1WQ7A 4IURA 2D0QB 1VIEA 2DTHA 5IAYA 3G4SA 1YCYA 4C92D 2LT4A 3RUXA 4KUIA 4EMHA 1VQPT 4IUTA 2DEQA 3UT1A 2RHZA 2ZPFB 4ELZC 1O75A 5LJ3e 4ZTJA 1IZ6A 5GAMe 2Y4XA 1YJWA 2QQBA 3L42A 2FL7A 4C8QB 4F7UB 3HL8A 5C0MA 2GQVA 5D6YA 2QDYB 4LDXA 3CPWS 2DZCA 4EMKC 5J39A 2XK0A 3OQ5A 5CKBA 1QVFA 4JS5A 1M1FA 4M77E 3OYJA 3SWNA 3CCRT 4IUUA 2RJCA 4IUVA 2X4XA 4QQGA 4KULA 2QTXA 1FWZA 4FT2A 4FT4A 4B9XA 2B8AA 1I5LA 2YLCA 1Q81C 3CCLT 2KAFA 3OW2S 2L8DA 3GF5A 4A54A 3QUIA 3CC2A 3RESA 2JTMA 4JUVA 4M75C 2QQSA 4R56A 2A7YA 3GNFB 3OBYA 4A4EA 3CPFA 2XDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQK A;  4KBM B;  2LT4 A;  2EYQ A;  4XAX B;  4L5G A;  2LT1 A; 
#chains in the Genus database with same CATH topology
 1MMN A;  1VQ7 A;  2K57 A;  3VRY A;  4F7U F;  3SFM A;  1KD1 C;  2ZGW A;  3E9F A;  3NFC A;  2ZPH B;  5FRN A;  2OTL A;  2JMC A;  1ZSZ B;  3S3N A;  1YIT A;  1AEY A;  4OP0 A;  1Y0M A;  3BDU A;  2DEU A;  3CME A;  2RJF A;  1Y96 A;  4ZNX A;  2DXC A;  4C0D C;  4J9G A;  5DLQ E;  1N9S A;  2ZPI B;  2X4W A;  1WXU A;  1WGS A;  3H0F A;  2CUB A;  3V7R A;  1M90 C;  1BBZ A;  5FW9 A;  2VV5 A;  2QI2 A;  3OYF A;  1IRX A;  3EHR A;  3MP1 A;  4PK4 A;  3JV3 A;  3V8L A;  5GAN 2;  2EIF A;  3GBQ A;  1Q95 G;  3JCM g;  2EYW A;  4PLI A;  1VQ7 T;  3JCM d;  2JW4 A;  2YSQ A;  4BI8 B;  2RNA A;  1DJ7 B;  4M78 A;  2OTL T;  2E6N A;  4BE1 A;  2SRC A;  2M02 A;  3E1S A;  4P5N A;  2X3X D;  3MEU A;  3EFO B;  2Z0W A;  4A53 A;  1VQ6 Q;  3CME T;  3WVD B;  4C8Q E;  2PVO B;  2VGM A;  1U3O A;  5KYN A;  2LJ1 A;  3T9N A;  4CC2 A;  5GMK j;  2GTJ A;  3EG2 A;  4PJL A;  5GAN 3;  3CCL Q;  1WHL A;  1IHV A;  5FWC A;  1VQL A;  4JZ3 A;  2CRE A;  1VQO A;  3NTH A;  1D1C A;  2DL4 A;  2SEM A;  4IIM A;  3GIB A;  3OBW A;  4NL3 A;  4FM4 B;  2Y4Y A;  1UUE A;  1YWO A;  3SWN B;  1I5O B;  1M3A A;  2MOX A;  5KYU A;  5GMK l;  1YJN Q;  2JS0 A;  2YT6 A;  1YIJ T;  1IO6 A;  4II1 A;  2I2L A;  5ECA A;  5DM7 R;  1ZUK A;  2DIL A;  1WQW A;  2QQR A;  1UEC A;  1QVG A;  3OSV A;  2A28 A;  2G6F X;  1QKX A;  4KH0 B;  3ZFJ A;  4BB7 A;  1G8X A;  4MDW A;  1NZ9 A;  3OS2 A;  1RLP C;  5CKE A;  2LVM A;  1QVG P;  4WTO B;  2KI7 A;  3S3O A;  1Y96 B;  2BZX A;  1FXX A;  2EVR A;  3M5A A;  3JB9 F;  4M7D A;  2L89 A;  2KQW A;  1SHG A;  1VQL T;  1Q7Y C;  2BE9 B;  2XI9 A;  4JDS A;  1VQO T;  3G6E A;  1K73 U;  5LJ3 d;  2JXB A;  3HFO A;  4IIO A;  3OYH A;  2HBW A;  4GLM A;  4Z8A A;  1JB0 E;  3I55 Q;  1FMK A;  5FU6 C;  4A63 B;  2X9H A;  4J6X A;  1UG1 A;  3E19 A;  4RKU E;  1YI2 A;  1BU1 A;  2GCX A;  1QP2 A;  2HQX A;  2X4Y A;  2XHC A;  1UEB A;  2K5F A;  4C5G A;  2E1H A;  1JJ2 S;  2LT1 A;  2E10 A;  3VS0 A;  4JZ4 A;  1ZSZ C;  2DJZ A;  2L3R A;  4M78 B;  4XTY A;  1SG5 A;  4ANJ A;  2DA9 A;  3MJX A;  2HNI A;  2D8J A;  4AG2 C;  3UPU A;  3P8D A;  1AHJ B;  4OMP A;  1WA7 A;  1X75 C;  4GY5 A;  3JB9 D;  3OYE A;  2O01 E;  1QMC A;  3KBG A;  1WJS A;  4C92 A;  1Q82 U;  2CS7 A;  2YUQ A;  1M5Q 1;  1JQQ A;  2HQE A;  3A1P A;  1Y07 A;  3M59 A;  3UA6 A;  2JZ2 A;  3G6E T;  1BB9 A;  1YHQ Q;  4AT1 B;  3HKS A;  5KYU B;  3QG1 A;  2V8J A;  4C8Q G;  4Y91 A;  1UTI A;  3ER0 A;  3X24 B;  1UE9 A;  3PFS A;  5GAN f;  5LL6 S;  3D7S B;  2CUD A;  1TSF A;  4Z88 A;  1UGS B;  4D8K A;  2RN8 A;  4RG2 A;  4MMK A;  1VQ5 Q;  3NHN A;  3FJ5 A;  1V1C A;  3VRZ A;  2OTJ A;  1H8K A;  2RQW A;  5GMK h;  1VQ9 A;  3V7S A;  2FZC B;  1GRI A;  1M1G A;  3M53 A;  1XOV A;  4M7D B;  2QK0 A;  4C0Z A;  3O8V A;  3MP8 A;  4BDZ A;  4M75 F;  1VQN Q;  5KH6 A;  3URG A;  3QO3 A;  1E6H A;  3VV0 A;  3P8H A;  2DFU A;  3LGF A;  3PTA A;  1A0N B;  2PU9 B;  3SWN C;  3QKJ A;  3MO8 A;  5C6S A;  2FVU A;  1D0X A;  1V76 A;  4C92 G;  1LPL A;  4F7U A;  2ECZ A;  2D6F A;  2ZPE B;  1GL5 A;  1X01 A;  2RF0 A;  4NOY A;  4LD9 K;  2DER A;  2LP5 A;  2BZY A;  2QQA A;  2YUP A;  3QWY A;  4M7A E;  2CDT A;  2JTF A;  3EG9 A;  2EFI A;  3GNG A;  4FU6 A;  3OYB A;  2E5K A;  2JNG A;  3HFN A;  3HRS A;  3JCM e;  3LH0 A;  2CT3 A;  3NTK A;  3I56 Q;  3MEA A;  2KBT A;  1F1B B;  1BI3 A;  1LVK A;  3RNJ A;  3OW2 A;  2OTJ T;  1Z9Q A;  2X4J A;  1VQ9 T;  2YLB A;  4M75 D;  4XTU A;  1R0C B;  4C92 B;  3G71 Q;  3I5R A;  2CP6 A;  4LN2 A;  2FHD A;  1BKB A;  3PVQ A;  5D6W A;  3QDF A;  3OW2 P;  2DZ9 A;  3FEO A;  4HVV A;  3EG0 A;  2FG0 A;  4C5E A;  1MV0 B;  4HA8 A;  2K9G A;  3HSB A;  5GAO l;  1BCO A;  3SHW A;  4J9D A;  2FZG B;  3CCJ Q;  3M54 A;  1YIJ Q;  1VQ6 A;  4JPB W;  1VYT A;  4OMF B;  3G1J A;  5GAO q;  3EH2 A;  5M9O A;  2GBQ A;  4HCK A;  4XTW A;  3PT9 A;  3HP9 A;  4OB0 B;  3EH1 A;  2MI6 A;  2O31 A;  1K9A A;  1VQM A;  4EDU A;  3H0I A;  3RBB B;  1ZA2 B;  2YUO A;  1FMV A;  2AIR B;  1R77 A;  1ABQ A;  2MCN A;  1YJN A;  4FYX B;  1QP3 A;  4J7I A;  3FIF A;  4LE9 A;  3MEV A;  2GF7 A;  4ZN3 A;  2KR3 A;  1WLP B;  2HMA A;  2QAZ A;  4DA4 A;  2KDS A;  2QAS A;  1NYG A;  3MKD A;  5IXF A;  2LQN A;  3H0H A;  2V26 A;  4FYY B;  3M0T A;  2ZPF B;  1MMA A;  5LJ3 e;  4ZTJ A;  4FW2 A;  4E7Z A;  2Y4X A;  2FPF A;  3L42 A;  2FL7 A;  2J6O A;  4F7U B;  2GQV A;  5D6Y A;  2QDY B;  1X2Q A;  2A37 A;  2DZC A;  3M0S A;  3OQ5 A;  1WZO A;  5CKB A;  2MIO A;  4M77 E;  3OYJ A;  1AWJ A;  2IPO B;  2X4X A;  1Q86 R;  1FWZ A;  2B8A A;  1I5L A;  1Q81 C;  3CCL T;  2KAF A;  1H3H A;  3GF5 A;  4A54 A;  3QUI A;  4A4E A;  3OBY A;  3TSW A;  2BZ8 A;  2CZ1 B;  4C8Q F;  3I55 A;  1HYO A;  4PFZ A;  2LX7 A;  2LQK A;  3L2U A;  1HJD A;  2AZS A;  1YJN T;  2V1Q A;  5D6X A;  2XKO C;  4C8Q C;  2FPD A;  4MZT A;  2KMT A;  2GFA A;  1MV3 A;  3H41 A;  3IQL A;  1AWO A;  4QT7 A;  1YFN A;  1PC0 A;  3A8M B;  2EYQ A;  8ATC B;  3MHX A;  2LQW A;  3CCQ Q;  5A0G A;  4ESR A;  8AT1 B;  4WCI A;  1RUW A;  1AD5 A;  1PSF A;  2QXF A;  4PJO E;  4JRI A;  4JJN K;  1BIB A;  4XU3 A;  1RAH B;  5HK0 A;  1NJI U;  1K8A U;  2RJD A;  2DO3 A;  4F16 A;  2LJ0 A;  4IUQ A;  3FC3 A;  1B34 A;  2EQU A;  1BIA A;  5LJ5 d;  3QJ6 A;  1AVZ C;  1OU8 A;  1YNZ A;  2PVD B;  1YHQ A;  3PNW C;  1D1B A;  3HTR A;  3TU4 K;  2EQI A;  2CP7 A;  3OS5 A;  1VQP Q;  4C92 C;  1PM3 A;  4XTX A;  2E5Q A;  3JCM X;  4PL6 A;  1OX8 A;  1VIF A;  1TOV A;  5KCO A;  5IT9 E;  4QVZ A;  5FU7 B;  4MZP A;  4QW2 A;  5CIU A;  5KYY A;  3JB9 G;  3M55 A;  3NTI A;  2ZAE A;  5IHI A;  4NS5 A;  1M90 U;  1QVG S;  1VQ5 A;  3JCM c;  1XJW B;  2F2W A;  3OYD A;  2RK2 A;  1OQK A;  2MWO A;  1V29 B;  2FB7 A;  2EKH A;  4ZGJ B;  1WNL A;  1ZBJ A;  5GMK i;  2D0N A;  3PMT A;  1C6V X;  4J9C A;  1VQN A;  4DBF A;  2A08 A;  1M1K C;  3REA B;  5IN1 A;  4CRI A;  1T3S A;  1X27 A;  1NPP A;  1YHQ T;  1HD3 A;  4XTV A;  2L3S A;  3G4S Q;  5FU6 B;  2NUT A;  1IXD A;  4M75 A;  5GAO n;  1JRI A;  3VUZ A;  1KK7 A;  4J9F A;  2J7I A;  4VUB A;  4L5G A;  3THK A;  1VQ8 T;  4C0F A;  3VS4 A;  3M4Y A;  3QPH A;  4JRP A;  1W4S A;  1QCN A;  1G3S A;  2RB6 A;  3FRN A;  1VQ5 T;  3I56 A;  2EYX A;  4M78 E;  3BDL A;  2X35 A;  1KC8 C;  4PFO A;  5GAM g;  4EPC A;  5GAM d;  4IKF A;  2DYB A;  4HXJ A;  3EGU A;  1G3T A;  2DAQ A;  4V2S A;  3P8B B;  1B34 B;  1IHW A;  4FYV B;  1EIF A;  2IVW A;  1VQN T;  1W6X A;  1VA7 A;  1WYX A;  2JM9 A;  3DLL A;  4J5Y A;  1JEG A;  4D8D A;  3CCV Q;  2QEX Q;  3CCJ A;  1YIJ A;  1ABO A;  4KRT A;  2YDL A;  4DOV A;  3M56 A;  3JB9 H;  5CKH A;  2HZY A;  4LD6 A;  2CH4 W;  1XQH A;  2DIQ A;  2LCC A;  2P84 A;  2RO0 A;  5CKD A;  3RIR A;  3OYC A;  2HDA A;  4QVD A;  5KYY B;  4RUG A;  4RTY A;  1G5V A;  1Q7Y U;  1TWB A;  2XDB A;  5I22 A;  4HT8 A;  4M75 G;  2RH2 A;  3CXC A;  2HKQ B;  3ZBD A;  5A0D A;  1N9R A;  4Q5W A;  4LNP A;  3M4G A;  1OEB A;  2RI2 A;  3I56 T;  3RER A;  1WXT A;  2CP2 A;  5EG2 A;  4M7A F;  1O9S A;  1SEM A;  2HSP A;  3CXC P;  2VC8 A;  2H3E B;  2DPP B;  3G71 T;  1OI1 A;  1TXQ A;  1RAC B;  1KHC A;  2K5L A;  3GP8 A;  5KCH A;  1VOM A;  1KHI A;  4J9B A;  3TSZ A;  4DOW A;  2GGR A;  2O88 A;  1T3L A;  2M16 A;  4JJD A;  4AG1 C;  1OZ3 A;  2DXU A;  3M0R A;  4MML A;  1X6G A;  1ZBX A;  3CCJ T;  2NUT B;  5A2Q E;  4M75 B;  4Y28 E;  2WSE E;  1W2B A;  5FU7 C;  2VWF A;  4X1V A;  7AT1 B;  2ED1 A;  2K6D A;  2RHI A;  2OAW A;  4AMC A;  4C5H A;  3CC4 T;  1K9M R;  1I8F A;  1M4Z A;  1OPK A;  1N27 A;  3DKM A;  3OMC A;  4UC4 A;  1W2B P;  2L3Q A;  4M7A D;  1K0X A;  2XMF A;  5HK3 A;  3OYM A;  2E3I A;  5CKF A;  1K9M U;  2KYB A;  3GPL A;  3CCE Q;  1I0C A;  1JXM A;  1K73 R;  1FYN A;  1C0M A;  1EZZ B;  4JS4 A;  2EGA A;  3C0C A;  1VYV A;  4OMN A;  5LJ3 j;  5DLO A;  4C8Q A;  2IIM A;  3L2Q A;  1VQK Q;  3OYY A;  4RTV A;  5LJ3 g;  4FIB A;  4R55 A;  4DBR A;  3OYL A;  3ME9 A;  4PKC C;  4D6W A;  2E6Z A;  5LJ5 e;  3LX7 A;  2E12 A;  1WHH A;  2P0Q A;  3CCQ A;  3MCA B;  4FW1 A;  2COW A;  3CPW A;  3X28 B;  1LNX A;  1UHC A;  3E9G A;  4AFS C;  2KT8 A;  2O2O A;  3C4S A;  4ATO A;  2K2M A;  4O6J A;  2HL5 C;  4YTL A;  5GAO m;  2JMA A;  5CR2 A;  3CPW P;  3C12 A;  3X26 B;  3FLG A;  4AFU C;  2YHT A;  2QGG A;  2VVK A;  4XQ3 A;  3SDZ A;  1KIK A;  3CCM Q;  2LCL A;  1Q82 R;  1MMD A;  1NPR A;  3EHQ A;  4M77 F;  1Y7X A;  2LQ8 A;  1QCF A;  3ASK A;  2OX7 A;  1VQP A;  1D1A A;  2W0Z A;  4ZGD B;  1UGQ B;  4FYW B;  3PIP A;  3HRT A;  1GFC A;  2K3X A;  4N4I A;  4C0G A;  4A4H A;  5KE2 A;  3EFS A;  1BI1 A;  2DVJ A;  2CSQ A;  4MDX A;  1ZX6 A;  3JCM Q;  1X6O A;  5KYX A;  3V7C A;  3TEE A;  1B3Q A;  1TS9 A;  3JB9 J;  4OMO A;  4J9H A;  3CCQ T;  3JCM h;  2B86 A;  1MGQ A;  2F1L A;  3I5S A;  1D0Y A;  5CQX A;  1N8R R;  4QVC A;  1Y57 A;  2ESW A;  1SPK A;  4E7L A;  2VUB A;  2F2X A;  4PFP A;  4X9D A;  1VQ8 Q;  1VYU A;  2C0T A;  3RKW A;  4E7H A;  1YP5 A;  4M77 D;  3QYH B;  1N8R U;  1PKS A;  2PUK B;  2DNU A;  1B7T A;  2L5Q A;  2AK5 A;  4PJO F;  1HXD A;  4OMM A;  2KEA A;  1VIE A;  2DTH A;  3G4S A;  2M51 A;  5HCK A;  4EMH A;  1VQP T;  1QKW A;  4IUT A;  2DEQ A;  3UT1 A;  3RR6 A;  3EG1 A;  1IZ6 A;  5GAM e;  3R6N A;  1ZA1 B;  4C8Q B;  5C0M A;  3HL8 A;  1UJY A;  1M1F A;  4IUU A;  2RJC A;  4FT2 A;  2ROT A;  2L8D A;  2PZ1 A;  4JUV A;  4M75 C;  2KE9 A;  4R56 A;  3GNF B;  2XDD A;  4XU2 A;  2P4T A;  4OB1 B;  3DB4 A;  3SB2 A;  1RAD B;  4PJO D;  2LRQ A;  4KGZ B;  1MNE A;  3CCS Q;  2VGN A;  1I4K 1;  1JU5 C;  1NLP C;  3CC2 Q;  2CH4 A;  3ZL7 C;  2QEX A;  5J26 A;  2DD5 A;  3VS1 A;  4FL6 A;  1PG5 B;  1PNJ A;  1D09 B;  2M9U A;  2HBP A;  2K4Y A;  2PNI A;  3G4S T;  1G3Y A;  2EJF A;  2J06 A;  2XIC A;  5LJ3 h;  5GAN g;  1SHF A;  2NUP B;  3V8J A;  1QLY A;  5GAN d;  1Q81 U;  2YWW A;  2KT1 A;  1YIT Q;  2KXC A;  1WIE A;  1KQS S;  1KJW A;  1RI0 A;  5KYX B;  2CP5 A;  1GBR A;  2LJ3 A;  1QVP A;  4BI3 A;  2OAU A;  2DMO A;  2CYZ B;  2LMJ A;  2K2V A;  3JSC A;  2LC4 A;  1UDL A;  4LUE A;  3VU3 C;  1WJR A;  2MPX C;  2EGC A;  1AZE A;  1QQJ A;  3CCL A;  3SD4 A;  2P0P A;  1OPL A;  4JRK A;  2DKG A;  3CC4 Q;  2DL8 A;  4FSX A;  4HCC A;  1UGV A;  4J6Y A;  1AWW A;  2HL3 A;  2EKO A;  1JJ2 A;  4M78 F;  3LGL A;  2MAM A;  2RI3 A;  4OF1 A;  2BUD A;  2VAS A;  5GAN 5;  1RAI B;  2LTO A;  3CCV T;  2EGE A;  2QEX T;  1QVF S;  4B6M A;  2DET A;  2E3H A;  2YXY A;  1JJ2 P;  2DVE A;  2DK3 A;  2DM1 A;  4M4Z A;  3X20 B;  4XU0 A;  2IG0 A;  1S72 Q;  5IXB A;  4F17 A;  3M9Q A;  4RTU A;  1OOT A;  2XDP A;  3QWX X;  1OYX A;  2KY9 A;  4J6W A;  4HCB A;  2KGT A;  9ATC B;  4A4K A;  4Z89 A;  3CCE A;  2BKD N;  2V1R A;  3OMG A;  3LWH A;  4EMK A;  5CK9 A;  2F5K A;  4F14 A;  1RL2 A;  1G2B A;  3M0P A;  1PKT A;  4M78 D;  4CC4 B;  2VB6 A;  1UHF A;  1VQK A;  3PGG A;  2O4X A;  4RTW A;  4DBQ A;  1M8M A;  2ZZD A;  3NMZ C;  1YJW Q;  1PSE A;  2I0N A;  1LJO A;  1M2O A;  3UDC A;  4E7S A;  2L3P A;  3O5Z A;  4J7F A;  2XD0 A;  2LX9 A;  4HKE A;  1RAB B;  3VS7 A;  3EAE A;  2C06 A;  3VJP A;  1K4U S;  1HK9 A;  4XTZ A;  3UWN A;  1OV3 A;  4M7A G;  2CP0 A;  1X43 A;  4M7D F;  1ACM B;  1YBY A;  3JRZ A;  3OS0 A;  3M58 A;  1M1K U;  3EFR A;  3TQ7 P;  2RM4 A;  3LWI A;  3CCM A;  1NJI R;  1K8A R;  1ZHI A;  1UJ0 A;  1KD1 R;  4AFQ C;  1C1A A;  2CGH A;  4B9W A;  1FX7 A;  2DE0 X;  1D0Z A;  2JS2 A;  1NYF A;  1K76 A;  3CCE T;  2DL3 A;  3CD6 Q;  5LJ5 j;  1KD1 U;  3LYI A;  1G3W A;  2E65 A;  3EG3 A;  1WI7 A;  5LJ5 g;  3X25 B;  1VQK T;  4M77 A;  3S3M A;  2QA4 Q;  3DB3 A;  2ROL A;  3J7A F;  4M7A B;  3CCU Q;  4LDY A;  2VXE A;  1YI2 Q;  3RKX A;  1K1Z A;  2HSE B;  1KC8 U;  3KUF A;  3JCM b;  3AHU A;  4KT0 E;  4M7D D;  4J9E A;  4XK8 E;  1TUG B;  3JCM P;  1M90 R;  1H3Z A;  2QG9 B;  1I81 A;  4BE0 A;  1YCS B;  4PJM A;  1VQ8 A;  3BFM A;  2COZ A;  1W2B S;  1QW1 A;  4OGC A;  3PE0 A;  2R5M A;  2O9S A;  2PUO B;  2PVG B;  2KNB B;  2ZCF B;  3CCM T;  5GJV B;  2O9V A;  2QDL A;  1BYM A;  3L2W A;  2DYI A;  5L8R E;  1YWP A;  3EGX B;  4EMK B;  3NGP A;  3QDR B;  3L2V A;  3N5B B;  2CKK A;  1M2V A;  2WAC A;  4PJJ A;  2E4H A;  2O4X B;  4N0A A;  1Q86 C;  2MK5 A;  1XNI A;  4ZGE B;  3UAT A;  3OYA A;  2RD1 A;  2DIG A;  4PJN A;  3JCM V;  1W1F A;  2GFU A;  3PIO A;  4JLG A;  1S1N A;  1VQ4 Q;  3L2R A;  2KK4 A;  4E2F B;  3JCM f;  3CC7 Q;  4XAX B;  1OZ2 A;  2EJG A;  3LH5 A;  1OUL A;  4N4G A;  4M77 G;  1RLQ C;  1MMG A;  4DBH A;  1U1T A;  2PTK A;  2E41 A;  2ED0 A;  2NWM A;  1M3B A;  1NEG A;  1WHM A;  5I11 A;  4TVR A;  5GAN e;  2RQR A;  2DRM A;  4ME7 A;  3CCS A;  5HY6 A;  4A4F A;  1EX4 A;  2DBM A;  5GAM j;  3J80 E;  2AKK A;  2JN0 A;  2EAY A;  3LLR A;  1BI2 A;  5CQY A;  1WHJ A;  3M0Q A;  3G71 A;  1SRL A;  1ZQ1 A;  2KYM A;  3LW5 E;  3A5Z B;  3FDR A;  1W70 A;  3MEW A;  3RDV A;  2VKN A;  4M77 B;  5KYW B;  3Q1J A;  2DLP A;  1XTD A;  2KRO A;  2NUZ A;  3TRE A;  4BY6 B;  1Z9Z A;  5GAN 6;  1U06 A;  3OYG A;  4X9C A;  1H92 A;  2EQK A;  2HQH A;  3QXE B;  2CT4 A;  1Q7Y R;  5CVI A;  4QQD A;  3VKI A;  4RTX A;  4PJO G;  2KRN A;  3QBY A;  1TUD A;  1PWT A;  4KGX B;  2FO0 A;  3WVE B;  3CC4 A;  1TG0 A;  3GLX A;  3MET A;  2P0K A;  2QQ9 A;  3H9N A;  3CCS T;  4Z02 A;  3QHS A;  1P92 A;  3QZ5 B;  2RHX A;  2CP3 A;  3GOX A;  3CC2 T;  1KSW A;  5GAN 4;  1WXB A;  2V8I A;  2JTE A;  5LJ5 h;  2VYT A;  2X51 A;  5LJ3 f;  1M2V B;  1S72 A;  4MZM A;  4PJO B;  2MWP A;  5IHN A;  3JB9 I;  1YIT T;  2RA2 A;  2CZ6 B;  4M7A C;  1EFN A;  4M7D E;  1SSH A;  2FZK B;  3VYH B;  2A0F B;  2F69 A;  1AT1 B;  4K11 A;  2EWN A;  1X6B A;  4GLK A;  1TU0 B;  4A4G A;  3KFV A;  2JJ9 A;  1VQM Q;  1LCK A;  5IAY A;  1QWE A;  1PD0 A;  3CMA Q;  2HEQ A;  2LT4 A;  5FWB A;  3RUX A;  4KUI A;  2YRD A;  4KH1 B;  2RHZ A;  4ELZ C;  1WX6 A;  1YJW A;  2QQB A;  4EMK C;  5J39 A;  1QCO A;  4JS5 A;  2FRY A;  4IUV A;  3EGD A;  4QQG A;  4B9X A;  1ZSG A;  1AZG B;  3OW2 S;  2RQU A;  3RES A;  4J9I A;  3CPF A;  1SRM A;  1S72 T;  2A3L A;  4C92 E;  3OS1 A;  3HHT B;  3VUB A;  2YRC A;  2LZ6 B;  2KRS A;  2GTO A;  2EW3 A;  4M78 G;  2G3R A;  4KGV B;  5EC7 A;  3VS5 A;  2DJQ A;  2NLU A;  2X3W D;  1N6A A;  1MHN A;  2EBP A;  3OA6 A;  3CD6 A;  2FPE A;  1YJ9 Q;  1AOJ A;  4X34 A;  1GBQ A;  2COY A;  2D8H A;  1RAA B;  4HVU A;  1G83 A;  1CKA A;  1CSK A;  5I2M A;  2XG8 D;  1H64 1;  1GFD A;  5GAM h;  2KSS A;  2NYS A;  3TCJ A;  4CI0 C;  4PNO A;  2QA4 A;  2E64 A;  2LCS A;  3CCU A;  3M57 A;  1M3C A;  1UGP B;  2DBK A;  1YJW T;  4F04 B;  4OGE A;  4BUG A;  3RKY A;  2K3B A;  2HCK A;  2RHY A;  2RMO A;  2AT1 B;  1VUB A;  3KXT A;  3MPU B;  3QZ9 B;  2AZV A;  2EYZ A;  2NUP A;  4OB2 B;  4M77 C;  4BI4 A;  2WSF E;  1KQ1 A;  2EQJ A;  4BY6 C;  5GAO p;  2HAX A;  4HCZ A;  4BE2 A;  4E7J A;  2F2V A;  1RAF B;  3J81 E;  3WXM B;  2DTO A;  2RQV A;  3JCM W;  4EMG A;  2V8K A;  4BD3 A;  4GBQ A;  4OMQ A;  2CZ7 B;  1MND A;  2ABL A;  4NL2 A;  2GNC A;  3CD6 T;  2H8H A;  3OB9 A;  4F7U E;  4O5V A;  1U8R A;  4RTZ A;  3INZ A;  2A36 A;  3OYK A;  3CCR Q;  5FRM A;  1QWF A;  3A8O B;  2JVV A;  4M7D G;  1K9M C;  2QA4 T;  3FB9 A;  1NEB A;  3CCU T;  4ORZ A;  3E2U A;  2J6K A;  5GAO r;  1VQ4 A;  2PQW A;  1YI2 T;  1KG1 A;  2DF6 A;  3M0U A;  3CC7 A;  2M1H A;  2LNH B;  3EGD B;  2FEI A;  5CAI A;  4ELY C;  1PHT A;  1HSQ A;  1KQ2 A;  2JOY A;  2OI3 A;  4CC3 A;  2RJE A;  1K73 C;  2J6F A;  4N0A C;  4PJO C;  1J3T A;  4R0K A;  4QKU A;  2DX1 A;  3U23 A;  4C5I A;  3JCM J;  2FRW A;  4JRQ A;  1OU9 A;  4BAC A;  2L2P A;  1GCQ C;  2XU8 A;  4KUD K;  2DTI A;  4DQ2 A;  3VS2 A;  2MF2 A;  2EJ9 A;  3R6O A;  5AYF A;  3SEM A;  2CSI A;  5I21 A;  2DXB A;  1GCP A;  1NG2 A;  1JXO A;  1OX9 A;  4WF2 A;  2Y90 A;  2RHU A;  1Y71 A;  4OB3 B;  3A8H B;  1SKU B;  1PRL C;  2R5A A;  3OSS C;  1WHK A;  1JBM A;  1ARK A;  4N4H A;  3VS6 A;  3I35 A;  1WDX A;  4AFZ C;  2F5T X;  2MYS A;  2YRV A;  3CCV A;  1T0J A;  3HPW A;  4LDV A;  4RCC A;  1Q81 R;  2DL5 A;  3VS3 A;  2ZPG B;  5CCA A;  1VQ4 T;  2C0I A;  3UF4 A;  1Q82 C;  1VQ7 Q;  1MUZ A;  5GAN j;  2RK1 A;  2RPN A;  2CZ0 B;  3CC7 T;  1I1J A;  4LDU A;  6AT1 B;  2OTL Q;  1M8V A;  4L59 A;  1KFZ A;  4E7I A;  1TH7 A;  2W10 A;  2GQI A;  3ZEH A;  2BIV A;  3CME Q;  4E6R A;  2WSC E;  2KVQ G;  3QYG B;  1JO8 A;  2YUN A;  1RAE B;  4QQ6 A;  4E47 A;  1UGR B;  1T0H A;  2D1X A;  2KXD A;  5A0L A;  2M0O A;  1NBE B;  4DEX A;  5GAN 8;  1N8R C;  1RI9 A;  2K3Y A;  5GMK e;  3VYG A;  2VXF A;  2LNV A;  4LDW A;  4XU1 A;  2AHJ B;  4DEY A;  1K0S A;  3RMQ A;  4M7A A;  4OML A;  2D9T A;  1B07 A;  3CBO A;  2AKL A;  4RG8 A;  1U5S A;  1IGQ A;  2QGF B;  2K79 A;  4M78 C;  1D3B A;  3H6Z A;  1LOJ A;  1ZUU A;  4F7U G;  2C0O A;  2DRK A;  3H8Z A;  2OJ2 A;  2HD0 A;  3CMA A;  2JM8 A;  2FYK A;  2R57 A;  5CO7 A;  2ZPB B;  2DXT A;  3OYN A;  5L23 A;  2EQM A;  4ZTF A;  1CKB A;  5FRO A;  5D7U A;  1TTH B;  2H3J A;  4RTT A;  4E7K A;  4FCY A;  3EGX A;  1VQL Q;  1R0B G;  1X69 A;  5LJ5 f;  2JT4 A;  1VQO Q;  2DL7 A;  3A98 A;  4CC7 A;  3F70 A;  2LDM A;  3TVT A;  5GAN 7;  2XID A;  1U1S A;  2RQT A;  4FSS A;  3C95 A;  2ENM A;  2J05 A;  1I07 A;  1SSF A;  2EPD A;  1VQ6 T;  2E70 A;  2K7A A;  4RCB A;  1PD1 A;  1M30 A;  3NPF A;  2QTV A;  5AT1 B;  3EG9 B;  1M1K R;  2EYY A;  2ATC B;  1YN8 A;  2BTT A;  4C0D B;  5IHK A;  4OVA A;  1ZLM A;  4JJC A;  1YJ9 A;  4Y92 A;  4J83 A;  1RAG B;  1VQM T;  2BE7 D;  1Q86 U;  4JLI A;  1FMW A;  5FLX E;  1IB8 A;  5J3B A;  3CMA T;  3V8K A;  3L2Z A;  1NLO C;  2RI5 A;  1SF9 A;  3A8G B;  2DD4 A;  2KRM A;  4LXC A;  4RMO A;  4KBM B;  4M7D C;  3BY7 A;  2L0A A;  3CXC S;  1UB4 A;  3G7Z A;  4HT9 A;  3BW1 A;  3UA7 A;  1WJQ A;  3I9Q A;  3G6E Q;  3A8L B;  3CEY A;  3MP6 A;  1ZSZ A;  4EIK A;  1KC8 R;  2R58 A;  3S6W A;  5KE3 A;  3OYI A;  1WFW A;  5KYW A;  4PLL A;  4L6V 5;  3FJP A;  3L1A A;  2QYZ A;  1M9S A;  2JUF A;  1BI0 A;  5GAN h;  3JAM E;  3BE3 A;  3C94 A;  1NE8 A;  4C8Q D;  1E6G A;  3PMI A;  3QJY A;  1PRM C;  1D3B B;  1M27 C;  1NM7 A;  4C92 F;  1YJ9 T;  3ULR B;  4ZN1 A;  4IUP A;  2MMP A;  3CCR A;  4M75 E;  1E7O A;  5HKC A;  3CQT A;  3QSU A;  1R8O B;  3I55 T;  5GAM f;  5I2S A;  3CBP A;  1PCX A;  1IRE B;  3OY9 A;  3PVL A;  1KQS A;  2HKN A;  3QII A;  4BDY A;  1X2K A;  5GMK m;  3CBM A;  1GXI E;  4J8O A;  4PJO A;  1WPY A;  4LUD A;  1TUC A;  1KQS P;  1IGU A;  3EFO A;  2K5I A;  3RMS A;  1WHG A;  3HRU A;  5DY9 A;  1AWX A;  1WQ7 A;  2D0Q B;  4IUR A;  4JJB A;  3AT1 B;  1GCQ A;  1YCY A;  4C92 D;  5GJW B;  2P4R A;  1BCM A;  1O75 A;  1N5Z A;  4LDX A;  3CPW S;  2M0Y A;  2XK0 A;  1QVF A;  3SWN A;  1BK2 A;  3CCR T;  1UFF A;  4KUL A;  2QTX A;  4FT4 A;  2YLC A;  5IH2 A;  2OTJ Q;  4HVW A;  3REB B;  1VQ9 Q;  3CC2 A;  2JTM A;  2QQS A;  1QVF P;  2A7Y A;  1NJI C;  3DLM A;  1K8A C;  1ZUY A; 
#chains in the Genus database with same CATH homology
 2A3L A;  4XU2 A;  4C92 E;  1VQ7 A;  2CZ1 B;  2K57 A;  3HHT B;  3VUB A;  4C8Q F;  3SFM A;  4F7U F;  2P4T A;  2ZGW A;  3OS1 A;  1KD1 C;  4OB1 B;  3I55 A;  2LQK A;  3E9F A;  3NFC A;  2ZPH B;  5FRN A;  2OTL A;  3L2U A;  3DB4 A;  3SB2 A;  4PJO D;  1YJN T;  2LRQ A;  4M78 G;  2G3R A;  3S3N A;  5D6X A;  2NLU A;  2XKO C;  1N6A A;  1MHN A;  1YIT A;  2VGN A;  4OP0 A;  4C8Q C;  1I4K 1;  3BDU A;  4MZT A;  3OA6 A;  2KMT A;  2GFA A;  2RJF A;  3CME A;  3CD6 A;  4X34 A;  2QEX A;  5J26 A;  2DD5 A;  4FL6 A;  1Y96 A;  2M9U A;  2HBP A;  2K4Y A;  3A8M B;  3G4S T;  5I2M A;  1G3Y A;  2EJF A;  2DXC A;  2EYQ A;  2XG8 D;  4C0D C;  2XIC A;  1H64 1;  5LJ3 h;  3MHX A;  5GAM h;  2KSS A;  2QA4 A;  3TCJ A;  4CI0 C;  4PNO A;  5GAN g;  3V8J A;  5DLQ E;  2E64 A;  4RMO A;  3CCU A;  3M57 A;  5A0G A;  1S72 T;  1N9S A;  5GAN d;  1UGP B;  1Q81 U;  2ZPI B;  1YJW T;  2X4W A;  1PSF A;  2QXF A;  1WGS A;  3V7R A;  4PJO E;  4JRI A;  4OGE A;  1BIB A;  4JJN K;  1M90 C;  4BUG A;  3RKY A;  4XU3 A;  5HK0 A;  1KQS S;  1NJI U;  1RI0 A;  1K8A U;  2RJD A;  2DO3 A;  2RHY A;  1VUB A;  3JCM e;  2VV5 A;  3KXT A;  2QI2 A;  3OYF A;  4BI3 A;  1QVP A;  3QZ9 B;  4IUQ A;  3FC3 A;  4OB2 B;  3MP1 A;  1B34 A;  2EQU A;  1BIA A;  5LJ5 d;  2OAU A;  2CYZ B;  2K2V A;  4M77 C;  3JSC A;  4BI4 A;  2LC4 A;  3V8L A;  5GAN 2;  3QJ6 A;  2WSF E;  2EIF A;  1WJR A;  3JCM g;  2PVD B;  3VU3 C;  1YHQ A;  3PNW C;  1KQ1 A;  2EQJ A;  4PLI A;  4BY6 C;  5GAO p;  3JCM d;  3TU4 K;  1VQ7 T;  2HAX A;  4HCZ A;  4BI8 B;  3CCL A;  4BE2 A;  3SD4 A;  4E7J A;  2P0P A;  4JRK A;  2DKG A;  3OS5 A;  1DJ7 B;  4M78 A;  2OTL T;  4FSX A;  2E6N A;  3J81 E;  4HCC A;  3WXM B;  4J6Y A;  4C92 C;  3JCM X;  2DTO A;  2E5Q A;  4XTX A;  4EMG A;  2V8K A;  4PL6 A;  4BE1 A;  3JCM W;  4BD3 A;  3E1S A;  1VIF A;  2EKO A;  1JJ2 A;  4M78 F;  5KCO A;  4P5N A;  5IT9 E;  4QVZ A;  5FU7 B;  2CZ7 B;  3LGL A;  3MEU A;  2MAM A;  4MZP A;  4QW2 A;  5CIU A;  4NL2 A;  4A53 A;  2RI3 A;  4OF1 A;  3CME T;  3CD6 T;  2BUD A;  3WVD B;  3OB9 A;  4C8Q E;  4F7U E;  2PVO B;  2VGM A;  5GAN 5;  2LTO A;  4O5V A;  3T9N A;  3CCV T;  1U8R A;  2QEX T;  3INZ A;  1QVF S;  3JB9 G;  3M55 A;  5GMK j;  3NTI A;  3OYK A;  4NS5 A;  1M90 U;  5GAN 3;  5FRM A;  3A8O B;  2DVE A;  2DK3 A;  1QVG S;  1VQ5 A;  3JCM c;  3X20 B;  2JVV A;  1VQL A;  4XU0 A;  4M7D G;  2IG0 A;  2QA4 T;  1K9M C;  3FB9 A;  1VQO A;  3OYD A;  3NTH A;  3CCU T;  2RK2 A;  3GIB A;  5GAO r;  1YI2 T;  3OBW A;  2PQW A;  4NL3 A;  1VQ4 A;  1KG1 A;  2MWO A;  4FM4 B;  1V29 B;  2FB7 A;  2Y4Y A;  3DLM A;  1K8A C;  3M9Q A;  3CC7 A;  2M1H A;  1WNL A;  3SWN B;  4ZGJ B;  5GMK i;  2XDP A;  5CAI A;  5GMK l;  4ELY C;  1KQ2 A;  3PMT A;  2JOY A;  1OYX A;  2KY9 A;  4J6W A;  4HCB A;  2RJE A;  1YIJ T;  1K73 C;  4N0A C;  4II1 A;  1VQN A;  2I2L A;  4PJO C;  4A4K A;  5DM7 R;  1M1K C;  3CCE A;  2BKD N;  3OMG A;  5IN1 A;  4CRI A;  4EMK A;  3LWH A;  5CK9 A;  2F5K A;  4C5I A;  1WQW A;  1NPP A;  1RL2 A;  2QQR A;  3JCM J;  1YHQ T;  4JRQ A;  4BAC A;  4M78 D;  4XTV A;  3OSV A;  1QVG A;  2XU8 A;  5FU6 B;  1VQK A;  4KUD K;  2DTI A;  3PGG A;  4DQ2 A;  2MF2 A;  2O4X A;  2EJ9 A;  3R6O A;  5AYF A;  4M75 A;  5GAO n;  1JRI A;  3ZFJ A;  4BB7 A;  4MDW A;  1NZ9 A;  2ZZD A;  3OS2 A;  3VUZ A;  5I21 A;  4VUB A;  5CKE A;  2LVM A;  2DXB A;  1PSE A;  4L5G A;  1LJO A;  4WF2 A;  2Y90 A;  2RHU A;  1Y71 A;  4OB3 B;  3UDC A;  3S3O A;  1VQ8 T;  4J7F A;  1Y96 B;  2XD0 A;  4C0F A;  2LX9 A;  3A8H B;  4HKE A;  1FXX A;  2R5A A;  3EAE A;  3M4Y A;  3QPH A;  4JRP A;  3OSS C;  1JBM A;  1W4S A;  3M5A A;  2C06 A;  3JB9 F;  4N4H A;  4M7D A;  3VJP A;  1G3S A;  2L89 A;  2RB6 A;  2KQW A;  1HK9 A;  3FRN A;  4XTZ A;  1VQ5 T;  2F5T X;  3I56 A;  1VQL T;  3UWN A;  2YRV A;  1Q7Y C;  4M78 E;  3BDL A;  2X35 A;  2XI9 A;  5GAM g;  3CCV A;  4JDS A;  1KC8 C;  4M7A G;  3HPW A;  4LDV A;  4RCC A;  4EPC A;  3G6E A;  1VQO T;  1K73 U;  5LJ3 d;  4M7D F;  3HFO A;  2ZPG B;  5GAM d;  4IKF A;  5CCA A;  1VQ4 T;  1YBY A;  3JRZ A;  3OS0 A;  1Q82 C;  3M58 A;  1M1K U;  3EFR A;  3OYH A;  5GAN j;  1G3T A;  2RK1 A;  2RM4 A;  2DAQ A;  1JB0 E;  2CZ0 B;  3LWI A;  3CCM A;  3CC7 T;  4LDU A;  5FU6 C;  1ZHI A;  4V2S A;  3CPW A;  3P8B B;  4J6X A;  1M8V A;  4L59 A;  3E19 A;  1B34 B;  4RKU E;  1YI2 A;  2GCX A;  1QP2 A;  2CGH A;  4B9W A;  2HQX A;  2X4Y A;  1EIF A;  2IVW A;  1UEB A;  1FX7 A;  2K5F A;  2XHC A;  4C5G A;  2E1H A;  4E7I A;  1TH7 A;  1JJ2 S;  3CCE T;  3ZEH A;  2BIV A;  3DLL A;  2LT1 A;  2E10 A;  4J5Y A;  2WSC E;  5LJ5 j;  2KVQ G;  3QYG B;  3CCJ A;  1KD1 U;  3LYI A;  1G3W A;  4QQ6 A;  4E47 A;  1YIJ A;  2E65 A;  2DJZ A;  2L3R A;  5LJ5 g;  4M78 B;  3X25 B;  4DOV A;  3M56 A;  4XTY A;  3JB9 H;  5CKH A;  1UGR B;  1VQK T;  4LD6 A;  3UPU A;  2HNI A;  4M77 A;  1XQH A;  2DIQ A;  2LCC A;  2RO0 A;  5CKD A;  3P8D A;  1AHJ B;  3S3M A;  3RIR A;  3DB3 A;  3OYC A;  3J7A F;  4QVD A;  4M7A B;  5A0L A;  1X75 C;  2M0O A;  4GY5 A;  4LDY A;  2VXE A;  3JB9 D;  3OYE A;  1G5V A;  5GAN 8;  3RKX A;  2O01 E;  1N8R C;  1Q7Y U;  2K3Y A;  5GMK e;  3KBG A;  3KUF A;  3JCM b;  1KC8 U;  3AHU A;  3VYG A;  2VXF A;  2LNV A;  4KT0 E;  2XDB A;  4M7D D;  1WJS A;  4LDW A;  4XK8 E;  1NJI C;  4C92 A;  4XU1 A;  1Q82 U;  4HT8 A;  2AHJ B;  2CS7 A;  4M75 G;  2RH2 A;  3CXC A;  3JCM P;  1M5Q 1;  1H3Z A;  5A0D A;  3ZBD A;  3RMQ A;  1N9R A;  4Q5W A;  4M7A A;  1I81 A;  4BE0 A;  2HQE A;  2D9T A;  2RI2 A;  3M4G A;  3I56 T;  1VQ8 A;  3RER A;  1Y07 A;  3BFM A;  3M59 A;  5EG2 A;  3CBO A;  2JZ2 A;  1W2B S;  4RG8 A;  1QW1 A;  3G6E T;  4M7A F;  4OGC A;  1O9S A;  2R5M A;  3HKS A;  2PUO B;  2PVG B;  2VC8 A;  4M78 C;  2DPP B;  2ZCF B;  1OI1 A;  3G71 T;  3CCM T;  1D3B A;  1BYM A;  2K5L A;  1KHC A;  3QG1 A;  3GP8 A;  3H6Z A;  2V8J A;  4C8Q G;  1LOJ A;  4F7U G;  4Y91 A;  5KCH A;  3L2W A;  3H8Z A;  1KHI A;  5L8R E;  3ER0 A;  2HD0 A;  3X24 B;  4DOW A;  4EMK B;  3CMA A;  2FYK A;  2R57 A;  3QDR B;  3L2V A;  3PFS A;  5CO7 A;  2M16 A;  5GAN f;  2ZPB B;  2DXT A;  5LL6 S;  3OYN A;  1OZ3 A;  2DXU A;  3N5B B;  4MML A;  1UGS B;  2CKK A;  1ZBX A;  2EQM A;  2WAC A;  3CCJ T;  4ZTF A;  5FRO A;  2O4X B;  4N0A A;  1Q86 C;  5A2Q E;  4M75 B;  4Y28 E;  1XNI A;  4ZGE B;  4RG2 A;  2H3J A;  3OYA A;  2RD1 A;  2WSE E;  1W2B A;  5FU7 C;  4E7K A;  4MMK A;  2DIG A;  3JCM V;  5LJ5 f;  2GFU A;  3PIO A;  4JLG A;  2OTJ A;  2RHI A;  5GMK h;  3F70 A;  2LDM A;  3V7S A;  4C5H A;  1VQ9 A;  3L2R A;  2KK4 A;  5GAN 7;  3CC4 T;  2XID A;  1U1S A;  1I8F A;  1M4Z A;  3OMC A;  1N27 A;  3DKM A;  1M1G A;  4UC4 A;  3JCM f;  3M53 A;  1XOV A;  4XAX B;  1OZ2 A;  3C95 A;  4M7A D;  2EJG A;  4M7D B;  4N4G A;  1SSF A;  4M77 G;  5HK3 A;  3OYM A;  4C0Z A;  3O8V A;  5CKF A;  1VQ6 T;  3MP8 A;  1U1T A;  4M75 F;  4BDZ A;  5KH6 A;  2E70 A;  2E41 A;  3QO3 A;  3URG A;  3VV0 A;  3P8H A;  1K9M U;  4RCB A;  3GPL A;  3LGF A;  3PTA A;  2PU9 B;  3SWN C;  3QKJ A;  4TVR A;  5GAN e;  4JS4 A;  3MO8 A;  5C6S A;  4ME7 A;  2FVU A;  3CCS A;  5HY6 A;  4A4F A;  4C0D B;  4C92 G;  4OVA A;  5LJ3 j;  5DLO A;  5GAM j;  1YJ9 A;  4C8Q A;  4F7U A;  3L2Q A;  2D6F A;  2ZPE B;  3OYY A;  1X01 A;  4J83 A;  4NOY A;  5LJ3 g;  4FIB A;  4LD9 K;  3J80 E;  4R55 A;  1VQM T;  2JN0 A;  3OYL A;  1Q86 U;  2EAY A;  4JLI A;  5FLX E;  5J3B A;  3LLR A;  3ME9 A;  3CMA T;  2QQA A;  4PKC C;  4D6W A;  2E6Z A;  1BI2 A;  3V8K A;  5LJ5 e;  3L2Z A;  3LX7 A;  5CQY A;  2E12 A;  4M7A E;  2JTF A;  2RI5 A;  3G71 A;  2P0Q A;  3CCQ A;  3MCA B;  3A8G B;  2DD4 A;  1ZQ1 A;  2EFI A;  3LW5 E;  1VQN T;  3GNG A;  4FU6 A;  3OYB A;  2JNG A;  3A5Z B;  3FDR A;  3HFN A;  3HRS A;  4KBM B;  3LH0 A;  3MEW A;  3X28 B;  1LNX A;  3E9G A;  4M7D C;  4M77 B;  3BY7 A;  3CXC S;  1UB4 A;  3Q1J A;  3G7Z A;  3NTK A;  1XTD A;  4HT9 A;  3TRE A;  3MEA A;  3BW1 A;  3C4S A;  4BY6 B;  4ATO A;  5GAN 6;  4O6J A;  1WJQ A;  3OYG A;  5GAO m;  1BI3 A;  4X9C A;  4YTL A;  2EQK A;  3QXE B;  3OW2 A;  2OTJ T;  3A8L B;  2X4J A;  3CEY A;  3MP6 A;  5CR2 A;  2YLB A;  3C12 A;  4M75 D;  4XTU A;  3X26 B;  1VQ9 T;  5CVI A;  3FLG A;  4QQD A;  2YHT A;  3VKI A;  2R58 A;  4C92 B;  4XQ3 A;  3SDZ A;  4PJO G;  3S6W A;  5KE3 A;  3OYI A;  3QBY A;  2LCL A;  2FHD A;  1BKB A;  4PLL A;  5D6W A;  1NPR A;  4L6V 5;  3FJP A;  2DZ9 A;  3FEO A;  4M77 F;  3WVE B;  1Y7X A;  2LQ8 A;  3ASK A;  3L1A A;  3CC4 A;  1M9S A;  2JUF A;  1BI0 A;  3GLX A;  3MET A;  5GAN h;  1VQP A;  4ZGD B;  4C5E A;  2P0K A;  3JAM E;  3C94 A;  4HA8 A;  1NE8 A;  1UGQ B;  3HSB A;  2QQ9 A;  5GAO l;  3PIP A;  3HRT A;  4C8Q D;  2K3X A;  4N4I A;  4C0G A;  3PMI A;  3QJY A;  3CCS T;  3M54 A;  4Z02 A;  3QHS A;  1D3B B;  1VQ6 A;  1P92 A;  4A4H A;  4C92 F;  3QZ5 B;  2RHX A;  1YJ9 T;  4OMF B;  3GOX A;  3CC2 T;  5KE2 A;  3EFS A;  4ZN1 A;  4IUP A;  2MMP A;  5GAN 4;  5GAO q;  3CCR A;  4M75 E;  1BI1 A;  2V8I A;  4MDX A;  5HKC A;  5M9O A;  5LJ5 h;  3JCM Q;  2VYT A;  1X6O A;  3V7C A;  3QSU A;  1R8O B;  3TEE A;  3I55 T;  5LJ3 f;  3JB9 J;  4XTW A;  5GAM f;  5I2S A;  3PT9 A;  3CCQ T;  3JCM h;  3CBP A;  3HP9 A;  4OB0 B;  1S72 A;  1MGQ A;  2MI6 A;  4MZM A;  4PJO B;  1VQM A;  2MWP A;  4EDU A;  3JB9 I;  5CQX A;  1IRE B;  3OY9 A;  1YIT T;  4QVC A;  2RA2 A;  2CZ6 B;  4M7A C;  1KQS A;  4M7D E;  4E7L A;  2VUB A;  4X9D A;  3QII A;  4BDY A;  1YJN A;  5GMK m;  3CBM A;  3RKW A;  1QP3 A;  3VYH B;  2F69 A;  4J7I A;  4E7H A;  2EWN A;  3FIF A;  4J8O A;  1GXI E;  4M77 D;  3MEV A;  2GF7 A;  4ZN3 A;  3QYH B;  1N8R U;  4PJO A;  1WPY A;  2PUK B;  2L5Q A;  4GLK A;  4A4G A;  2K5I A;  3RMS A;  4PJO F;  4DA4 A;  1HXD A;  2KDS A;  3HRU A;  5DY9 A;  1WQ7 A;  4IUR A;  2D0Q B;  1VIE A;  2DTH A;  5IAY A;  3G4S A;  1YCY A;  4C92 D;  2LT4 A;  3RUX A;  4KUI A;  4EMH A;  1VQP T;  4IUT A;  2DEQ A;  3UT1 A;  2RHZ A;  2ZPF B;  4ELZ C;  1O75 A;  5LJ3 e;  4ZTJ A;  1IZ6 A;  5GAM e;  2Y4X A;  1YJW A;  2QQB A;  3L42 A;  2FL7 A;  4C8Q B;  4F7U B;  3HL8 A;  5C0M A;  2GQV A;  5D6Y A;  2QDY B;  4LDX A;  3CPW S;  2DZC A;  4EMK C;  5J39 A;  2XK0 A;  3OQ5 A;  5CKB A;  1QVF A;  4JS5 A;  1M1F A;  4M77 E;  3OYJ A;  3SWN A;  3CCR T;  4IUU A;  2RJC A;  4IUV A;  2X4X A;  4QQG A;  4KUL A;  2QTX A;  1FWZ A;  4FT2 A;  4FT4 A;  4B9X A;  2B8A A;  1I5L A;  2YLC A;  1Q81 C;  3CCL T;  2KAF A;  3OW2 S;  2L8D A;  3GF5 A;  4A54 A;  3QUI A;  3CC2 A;  3RES A;  2JTM A;  4JUV A;  4M75 C;  2QQS A;  4R56 A;  2A7Y A;  3GNF B;  3OBY A;  4A4E A;  3CPF A;  2XDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...