2LT1A

Solution nmr structure of the 72-residue n-terminal domain of myxococcus xanthus card
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
75
structure length
75
Chain Sequence
b'AGHMPEGSASLQLAVGDRVVYPNQGVCRVSAIDVKEVAGQKLTFVTMRREEDGAVVMVPEGKVLAIGVRKVASAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CarD protein
publication title Structure-Function Dissection of Myxococcus xanthus CarD N-Terminal Domain, a Defining Member of the CarD_CdnL_TRCF Family of RNA Polymerase Interacting Proteins.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Transcription
total genus 5
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lt1A00
2LT1A 2EYQA 4KBMB 4XAXB 2LQKA 2LT4A 4L5GA
chains in the Genus database with same CATH superfamily
2NLUA 4D6WA 1M1FA 2KROA 1U1TA 4M75G 1QMCA 2QQBA 3FEOA 3ZL7C 1FX7A 4FSSA 1RAEB 2EYXA 1M2VA 1YFNA 1Y57A 2RQRA 4J8OA 1UHFA 1HYOA 5DLQE 3FDRA 4AT1B 3C94A 1X6GA 2RB6A 1GXIE 4J9IA 1VIFA 4HCKA 1K4US 1M5Q1 4KH0B 2P0PA 4F16A 4M77A 4NL2A 1OX8A 4N4IA 5GANg 5GJWB 1N9SA 1YI2T 3TREA 3P8HA 4JUVA 2K2VA 3JCMe 2HBWA 2XI9A 1Y96A 2IPOB 2KXCA 2HNIA 4PKCC 1WI7A 2CH4A 4M75A 1TS9A 3MJXA 2RI3A 4O5VA 4RG8A 2FB7A 4XU2A 2L2PA 5CKFA 2QTVA 1A0NB 2JM8A 2EKOA 1Q86U 3HHTB 4ZGJB 2HAXA 1N5ZA 4JDSA 1YJWQ 1VQNA 3SEMA 1WDXA 2KGTA 4E2FB 4Z89A 3OY9A 1M2OA 4M7AC 4MZTA 2C0IA 2QA4Q 4J9DA 2RHXA 4OB2B 4PJOD 2VVKA 3HRUA 2KSSA 1GCPA 3UF4A 5GAOr 3X24B 3CCLA 4E7LA 2CREA 2X4XA 4LDYA 2E10A 3JCMV 2KXDA 3VU3C 5HKCA 2CZ6B 1ZA2B 3TCJA 3VUBA 2VASA 3UDCA 3D7SB 2DEQA 3EG0A 5CQYA 1FMKA 1JJ2P 2DIQA 2X4WA 1VQ5Q 4JJCA 4A4GA 1T3LA 4X1VA 2AT1B 2DFUA 1HK9A 2DERA 3HRTA 4TVRA 2WSCE 1WZOA 4IUQA 5FWCA 3CCQA 5LJ3e 3UA6A 4B6MA 4F04B 3GPLA 5GAN7 1AEYA 2KI7A 3FIFA 4ESRA 4NOYA 1VQMT 4IUTA 4EIKA 2OTJA 4C5GA 2H3EB 5LJ5j 2C0OA 4CC4B 5GAOn 2R5AA 1K8AC 3HPWA 2NYSA 4C92G 4DBFA 3RMSA 1H3ZA 3CCMT 1W2BS 1D1AA 1WPYA 2QI2A 4IUPA 1VYTA 1M27C 4JRIA 4KGVB 5I2MA 5LJ5h 3QSUA 2YXYA 3URGA 3A1PA 3A8HB 1SKUB 1VQ4T 4VUBA 3JCMh 3S3OA 1Q81R 3RKXA 3A8OB 2YUOA 3I35A 3TVTA 1TU0B 4Z02A 2L89A 9ATCB 4XTXA 1N8RR 3M58A 2LNHB 4NL3A 4BE0A 1TG0A 3T9NA 3L2RA 3X28B 2QQ9A 2P4RA 1ZUKA 4OP0A 2XMFA 4HVVA 4CC3A 2QQSA 4ZGEB 3EGDB 1GBQA 5I22A 1VQNQ 4MDWA 4C92A 2E5KA 1XTDA 2PVOB 2DL4A 3CC4A 1OX9A 2CUDA 5KH6A 1K9AA 2RJFA 2Y4XA 1HJDA 1KIKA 4M7DD 2DRMA 3M0TA 3WVEB 2FRWA 4QQ6A 2KDSA 1NLPC 5GMKl 3G1JA 3CCLQ 4BDYA 3DB4A 2A7YA 4PJOF 3TQ7P 3J80E 2E6ZA 2AK5A 3M54A 2FHDA 2LQ8A 1M90C 3EG1A 2F1LA 3PIOA 1UECA 2PTKA 1WQ7A 5A2QE 4BI4A 1VQ9A 4J9HA 2EAYA 3PNWC 1YJNT 2QTXA 3OS2A 3LH5A 2E4HA 3L2ZA 4C5IA 4EDUA 3KXTA 5CK9A 1M2VB 4RTZA 4M7AE 1Q82R 1H92A 3KUFA 4C8QB 4PJLA 1XNIA 5CAIA 4XU3A 1OYXA 1UEBA 1C6VX 2OTJQ 2AZVA 1YBYA 1G5VA 2ZPIB 2BZXA 3ZFJA 5GANe 3QYHB 4DEYA 3CD6T 4J6XA 3OYEA 1WQWA 4M77B 5GAOp 4XTYA 1DJ7B 1GCQC 2EGCA 1OPLA 3M0SA 1WHMA 2LMJA 2KRMA 2PVGB 3GOXA 1V29B 1TOVA 1PM3A 1ZUUA 3J81E 1N6AA 2GF7A 1OQKA 5GJVB 2VXFA 2RO0A 1H8KA 1JXMA 2B86A 4M78D 2H3JA 3OW2A 1K1ZA 2RJDA 4D8DA 4L59A 4ZGDB 2DL7A 5KYYA 3VS6A 4BDZA 2MMPA 2OI3A 4QVDA 3OW2S 1YNZA 2NUTA 2LT1A 4C5HA 1PSFA 1AWWA 5LJ5d 2EIFA 2JM9A 2IVWA 4Z8AA 5KCHA 2CH4W 3FB9A 2CS7A 3OYLA 5A0DA 4QW2A 3JCMd 4CC7A 4L6V5 2KT1A 5J26A 3OS5A 1UDLA 2RA2A 4PFOA 3SWNC 3CC4Q 4ZN3A 3PE0A 3G7ZA 1RAIB 1K9MC 3LGFA 1VQMA 5IHKA 3WXMB 2R58A 2FRYA 2K3XA 3NTKA 1OPKA 1BKBA 1ZHIA 1D3BA 2HL3A 1VQOT 1C0MA 2DAQA 2QDLA 2QG9B 2RQUA 4LN2A 1RAHB 2DD5A 1KD1U 2CZ1B 1TSFA 2E12A 1LNXA 2AKKA 2KRNA 3ZEHA 1AWOA 2RMOA 1NPRA 5CKEA 2XD0A 3DB3A 2ROTA 3OBWA 1VQ9Q 1YJ9A 4Y91A 4OMFB 3OQ5A 2JT4A 3ME9A 4M77C 3CC7T 2PQWA 1TUGB 4JJNK 1VQ4A 3G4ST 2EJ9A 1ZX6A 1UB4A 1JQQA 1O75A 1YITT 4M75C 3JCMf 1X6BA 1YHQT 3CCUA 3EH1A 3EFSA 3A8MB 5GANh 1OULA 3EG9A 1Q7YR 1KC8C 3EGUA 1EIFA 4E6RA 1TUDA 4BY6C 1TWBA 1GL5A 3H0FA 1W1FA 4EMKC 2FG0A 4PJOG 2R57A 3M0UA 2VKNA 4LDVA 3OYHA 3GIBA 1QVGP 2LZ6B 4PJOE 2JJ9A 3UATA 3JB9D 2VB6A 4LNPA 1I5OB 4XK8E 4ATOA 2KR3A 2YLCA 2O2OA 4F7UE 4KRTA 3OS0A 2BUDA 1N27A 5ECAA 3OYNA 1KQSP 5LJ3g 4PL6A 1D0ZA 1CSKA 4KULA 1YJNA 2JS0A 1M8MA 3CC2Q 4QVZA 4C0ZA 3NMZC 1UTIA 2QGGA 4J6YA 1N9RA 3H41A 2QEXA 3MKDA 3N5BB 5GAN4 8AT1B 4R55A 1ZSZA 2KQWA 4J83A 1KHCA 4RTXA 4DBHA 4PJOA 2YHTA 1WYXA 4ORZA 2CKKA 3INZA 5LJ3f 1B34A 2E70A 2JNGA 1VQMQ 2X51A 2LCCA 3FJPA 1WA7A 3LW5E 1Q81U 4IUUA 1ZBXA 3X25B 5HK3A 2QQAA 3I55T 2V26A 1QP2A 2D6FA 1X27A 4LDWA 1AHJB 2F69A 1MV3A 1ACMB 3HTRA 3M0RA 1WLPB 3RESA 1YJ9Q 4N0AA 2GGRA 3L2UA 4CI0C 1UGQB 2DPPB 1YIJQ 3EHQA 3MPUB 1PWTA 2P0KA 3HFOA 3O5ZA 2RJCA 4FT2A 1MV0B 3QJ6A 4C92F 5KE3A 5M9OA 1WGSA 2HSEB 4XU1A 4Y28E 2FZGB 3CCUQ 2K57A 1RLPC 1VQ8T 4OMLA 1B3QA 2QYZA 2GTOA 1GFCA 1QP3A 3EGXA 4RKUE 3CCVT 3DKMA 2LNVA 3OYJA 3CCRA 3QKJA 1NBEB 4C92C 2J7IA 3M59A 4FYXB 4BUGA 4M7DG 1NJIU 2FPEA 5IHIA 2M16A 2AIRB 2QASA 4KUIA 4M77E 3EFRA 2L3RA 5C6SA 1YWPA 5KYYB 2E41A 1OV3A 1EX4A 2DD4A 4XQ3A 5GANd 3SWNA 2XKOC 1VQOA 1AD5A 4ZNXA 3CMAT 1Q82U 3NHNA 5CO7A 1IZ6A 4L5GA 4M75E 3JB9F 2EYQA 5HCKA 2IIMA 2EW3A 2RHUA 2RQVA 1QKWA 2L3QA 2VC8A 4BD3A 1KQ1A 4IUVA 3CC7A 4FT4A 3PMTA 2FL7A 1KJWA 3G71Q 1JB0E 4MZMA 1RAAB 1WHKA 4XU0A 2HL5C 2GCXA 2HQXA 2QEXQ 3CCET 5DY9A 3UT1A 3G4SA 3THKA 4KT0E 1B7TA 1OZ2A 1AOJA 3LGLA 1UJ0A 3CPWA 2XK0A 4OB0B 3H6ZA 2FVUA 3E2UA 3L42A 4M7DA 2LJ1A 1KD1R 1YHQA 2HSPA 1UG1A 2RK1A 3CPWS 2D9TA 1I0CA 5LL6S 5IHNA 3E19A 1NLOC 3WVDB 2O4XA 2RQWA 2AHJB 2DXUA 4FSXA 1QLYA 4QVCA 3CMEQ 1FXXA 2D0QB 5GANf 2K2MA 1X6OA 3M56A 2MOXA 2YSQA 5CR2A 4M78G 4EMKA 2ZPGB 3RERA 2X4YA 2QK0A 2YLBA 4OMOA 1GRIA 1PCXA 1RACB 1IREB 3I5SA 2YRDA 1Y07A 4OMPA 3RDVA 3EH2A 3M9QA 2SEMA 2ENMA 3BDUA 5GAOm 1VQKT 1PG5B 2RI5A 6AT1B 3M5AA 2MCNA 1HD3A 3OYGA 1IGQA 1CKAA 2DBMA 3FJ5A 3A8LB 3LWIA 3M4GA 3PGGA 3CCRQ 2K79A 1U1SA 4HVWA 3F70A 2MYSA 3QZ5B 2FZKB 1WXBA 3SD4A 4BE2A 2DA9A 3QG1A 4MMLA 1WHLA 1AT1B 1WXUA 1G3SA 4RTTA 1M1KR 2BZ8A 5A0LA 2VUBA 3X20B 3L2WA 4M78A 1X01A 4E7IA 1UFFA 1VQOQ 3MEAA 5GAMg 3I55A 5IAYA 3I56A 2LQWA 1J3TA 2B8AA 1W2BA 1SEMA 3REAB 5D6YA 2EYWA 5HK0A 2FO0A 1T0HA 4JLGA 1Q7YU 1ZSZB 1VQ7T 3G6EA 1KQ2A 1JJ2S 3R6OA 3FLGA 2QGFB 1ZUYA 2DYIA 2DTOA 3CBMA 4PJJA 4PJOB 2KE9A 4C92E 3CCJT 2WSEE 4FM4B 2E64A 5D7UA 2HEQA 2VYTA 3EG3A 4F7UB 2O9SA 2EJFA 2V8KA 4J5YA 2A08A 1XOVA 1VQPT 2RHIA 4AG1C 1GFDA 1LOJA 3JCMX 2RF0A 4JS4A 2MAMA 3MEUA 3VJPA 2DK3A 1QVFA 2RNAA 1VQLA 2XHCA 1Q95G 4DOWA 1Y0MA 4J9GA 3A98A 3OSVA 1UGSB 4YTLA 2LX9A 3SFMA 3JB9G 1QVFS 2OTLT 1RI0A 3BE3A 1XJWB 2LTOA 4E7JA 4CRIA 4C8QD 5GAOq 2HBPA 2JTFA 1BI3A 1OU8A 4JPBW 2CGHA 1N8RC 1PD0A 5IT9E 2X4JA 4BI3A 1B07A 1HXDA 2XICA 4OMMA 2DYBA 3GP8A 2LDMA 1SSFA 2EPDA 2KAFA 4HKEA 4JZ4A 5LJ3j 1NYGA 1M90R 3VRZA 2E5QA 2EYZA 2DE0X 2O88A 2V8JA 3RNJA 1I81A 1EZZB 1NJIR 5DM7R 2CT3A 2JVVA 2AKLA 4DQ2A 2K9GA 4J9CA 1ZSZC 4P5NA 5C0MA 2XIDA 1OU9A 3SWNB 2YRVA 4PLIA 3CQTA 2I2LA 2BKDN 5LJ3h 4PJOC 1QWFA 1MHNA 2DVJA 2RQTA 4FYVB 1YI2A 3CCQQ 3H8ZA 3LX7A 2M02A 1JEGA 3L2QA 2COYA 3V8JA 3GNGA 2V8IA 2KRSA 1WX6A 2DF6A 3RIRA 5D6WA 1SSHA 3M4YA 1K0SA 3I56Q 1BK2A 5KYXA 1R8OB 5GMKe 4R0KA 2YRCA 2EVRA 2DVEA 2MK5A 2J6KA 4N0AC 3G6EQ 1S1NA 5J39A 4PFPA 1G3WA 2CP6A 1C1AA 4OMQA 1TUCA 2JXBA 1W6XA 1X69A 4E7KA 2DZCA 3OW2P 3OMGA 1Y96B 5I21A 1BU1A 2DXBA 2M51A 1K73U 4DA4A 1P92A 4KGXB 3L1AA 2E3HA 4M75B 5KYNA 5CQXA 2WSFE 2O4XB 3JB9H 3LWHA 2CSQA 1IO6A 4BACA 1NEGA 2Z0WA 1ZA1B 2GBQA 1YJWT 2C0TA 4BY6B 3JV3A 3ASKA 4HCZA 2A0FB 1VQLQ 4EMKB 5GAN3 1ABQA 1BI1A 1R0CB 1ABOA 2DXTA 2QA4T 4ME7A 1M4ZA 2LC4A 2QXFA 2L3PA 4O6JA 3CBOA 4Z88A 2NUZA 3KFVA 1X2QA 2BIVA 4E47A 3LYIA 1PRMC 2K3YA 4ELZC 2X3WD 2ZPBB 3M0QA 4DBQA 1Q86C 1QWEA 3M0PA 4J7IA 2CZ7B 3TSWA 2O9VA 3UWNA 3CXCA 3OMCA 4C8QF 1Y7XA 2XDPA 3VUZA 4OGCA 3JSCA 5GAOl 3M57A 1VQ5T 2DIGA 4E7ZA 4M7DF 2P84A 1WFWA 3CXCS 1OOTA 2DL8A 3MP1A 2DJQA 3V8LA 3HFNA 3CCMA 1QQJA 5FW9A 4NS5A 1YP5A 5GAMe 2CDTA 3CCJA 3VS4A 1ARKA 2RHZA 2CP3A 1UGVA 3GLXA 5GANj 4M7DC 4FU6A 1YI2Q 1VYVA 3S6WA 3QDFA 1VQPA 5AT1B 5FLXE 3C12A 5GMKh 2VXEA 2GTJA 1I8FA 1D0XA 2X3XD 3A8GB 2EFIA 2LRQA 4PJMA 2KVQG 2ATCB 2MWPA 2FPDA 1SG5A 2DX1A 2CP7A 2E6NA 2J6FA 2LQNA 3KBGA 5LJ3d 1I4K1 4X34A 1I07A 4J6WA 4IKFA 2JMCA 3MP8A 3V7CA 4ZTFA 4DBRA 2EYYA 3RKWA 3MEVA 3DLMA 4V2SA 1W4SA 3LLRA 1Q7YC 2MWOA 2FPFA 3JRZA 2QAZA 2DLPA 2W10A 4JZ3A 4KUDK 1G3TA 3QWYA 2HKNA 1F1BB 4C0FA 5CCAA 2M0OA 1M1KU 4GY5A 4WCIA 2SRCA 1MUZA 4HXJA 4A4EA 2JZ2A 2OJ2A 4M78F 1VQNT 3RR6A 4KH1B 3GF5A 4PK4A 5EC7A 2Y90A 5IN1A 4C92B 3RBBB 4KGZB 2KK4A 1K8AU 4CC2A 1WJRA 4C5EA 2DTHA 1BIAA 5KYUA 3CCLT 1G8XA 3OYKA 5CKBA 3C4SA 2JMAA 4M78C 2YDLA 5D6XA 4C0DB 1U8RA 4A63B 3BY7A 1WXTA 5FRNA 3JCMb 2DXCA 1JBMA 1E7OA 2F2WA 1QKXA 4N4HA 4A4KA 2XDDA 3V8KA 2DL5A 1VUBA 4B9WA 4OGEA 4A54A 3NPFA 1LCKA 3CD6A 2V1QA 1QCNA 3P8BB 2MPXC 4M7AD 1R77A 5GAMh 3CCMQ 2JTEA 4FYYB 2DO3A 3JCMc 2LQKA 3QUIA 1Z9ZA 2PVDB 2YWWA 1TH7A 4RTWA 2JS2A 2E65A 5KYWA 5GAN8 1WJQA 1VQ4Q 1WJSA 3JB9J 2QQRA 1BYMA 1UGRB 1PNJA 1O9SA 2D8JA 2NUPA 2LT4A 1WIEA 3QPHA 1PHTA 1WHGA 4R56A 2ZPEB 2COZA 2BZYA 2KYBA 2HMAA 1D1BA 4XTZA 1RUWA 5L8RE 3VS7A 3VYHB 5FU6B 3EGDA 2AZSA 4C8QG 3S3MA 2DBKA 4LUEA 4DOVA 1M90U 4AFSC 4LDUA 3HRSA 3JCMP 4M4ZA 4D8KA 1K73R 1ZLMA 2QDYB 1UHCA 4QQDA 4OF1A 3QZ9B 4M7DE 3CCST 4XTVA 4C0DC 1SRMA 2NUTB 3PIPA 4RTVA 3FC3A 3OYBA 4QKUA 1BCOA 2CP0A 1CKBA 2CUBA 4ZTJA 2PU9B 1IGUA 3CC4T 3AHUA 1OEBA 2H8HA 4HCBA 1YJNQ 2DL3A 4AMCA 1BI0A 1IXDA 4XAXB 1TTHB 3E9FA 3CPWP 5CKDA 2K5LA 1SHFA 4C8QA 1Y71A 4RTYA 1D3BB 2YUPA 1BCMA 5FU7B 1YITA 1S72T 4J9FA 4LXCA 4EMGA 4LDXA 3BDLA 2G6FX 1VQ9T 2HZYA 2NWMA 1U06A 1IB8A 2JTMA 1AWJA 2D0NA 2ZAEA 5LJ5e 3CD6Q 2COWA 2M0YA 2ECZA 5CVIA 5FU6C 3A5ZB 1MMGA 3PFSA 1KD1C 2RN8A 4M7AF 4GLMA 4JRPA 4J9BA 3VS0A 1K76A 2KT8A 4X9CA 3VV0A 3PVQA 1BI2A 4X9DA 2EWNA 4M78E 1VOMA 3EG9B 2XG8D 1I1JA 2CP5A 1WHJA 1K9MU 5GAMd 5FRMA 5GAN2 4XTUA 3PVLA 2BTTA 2VGMA 2F5TX 2LCLA 2JOYA 1JO8A 4GBQA 3V7SA 4WTOB 1VQ6T 1T3SA 5IXFA 2D8HA 4A53A 1X43A 1JU5C 1M9SA 1UE9A 1SPKA 1G3YA 1EFNA 2KYMA 4AFQC 3OS1A 3JCMQ 2V1RA 3EHRA 2HQEA 4OB1B 1V76A 4B9XA 2EBPA 5I2SA 3I5RA 2DMOA 2EQMA 1W2BP 5FU7C 3OBYA 3CC2T 1M30A 5I11A 4FW1A 3REBB 1PKSA 4AFZC 2GFUA 3E9GA 1K8AR 1G83A 1JJ2A 4FIBA 3VS5A 1NYFA 1ZBJA 2EQIA 5GAN5 8ATCB 5KYUB 1R0BG 1KC8U 1M1KC 4PFZA 2P0QA 4RCBA 3CC7Q 2CYZB 3QBYA 5GAMf 1B34B 3CBPA 2F2VA 3OYYA 1RAFB 3G4SQ 2OAWA 4MMKA 1I5LA 3HP9A 1E6HA 3VKIA 4HVUA 2A28A 3QXEB 4EPCA 4JRKA 1SRLA 1YITQ 2GFAA 2I0NA 4C0GA 2EKHA 1YHQQ 1QCFA 3QYGB 4IIMA 1QVFP 1VQ8A 1HSQA 4BB7A 1QW1A 3PTAA 1YJ9T 1BB9A 4J9EA 5FWBA 3CCVA 3QIIA 1YIJT 1RAGB 2M1HA 4RUGA 5KYWB 4RG2A 1Q81C 5AYFA 2EGAA 2M9UA 1RL2A 3EG2A 2NUPB 2JUFA 2ED1A 3HSBA 3NGPA 3E1SA 4A4HA 3CCUT 4HCCA 5L23A 1TXQA 5CIUA 3CCSA 2ED0A 4QT7A 1FMWA 5GMKi 3CMAA 5HY6A 4RMOA 3OA6A 3BFMA 1M3AA 2X9HA 2KNBB 4IURA 5DLOA 1KSWA 2F5KA 2CSIA 3EGXB 4FYWB 3HL8A 2BE9B 1NG2A 1VYUA 3MEWA 2LJ0A 4F14A 1AVZC 1LPLA 2LP5A 4PLLA 1K0XA 2GQVA 4M77D 1NEBA 3PMIA 2G3RA 4BI8B 1NE8A 4GLKA 1FMVA 2R5MA 1MMDA 2K3BA 4AFUC 2ESWA 1H3HA 3SHWA 1U5SA 1AWXA 3L2VA 4EMHA 3CCEA 2HKQB 4J7FA 3U23A 2DM1A 4M75D 3JCMJ 1W70A 2PUKB 2VV5A 1S72A 1SHGA 5IH2A 1X75C 3O8VA 3MHXA 2EQJA 3EFOA 1D0YA 4F7UF 1MGQA 1LJOA 3TEEA 3JCMW 1PSEA 1NJIC 4FL6A 4M7AG 4K11A 3QHSA 4BE1A 3LH0A 1MMNA 4IIOA 3I55Q 2PUOB 1BBZA 1IHWA 2DRKA 3G71T 2DKGA 2CZ0B 1M3BA 2KEAA 2QEXT 3MCAB 3OYDA 4OB3B 3JAME 2OX7A 1ZQ1A 1Q82C 4JRQA 2XDBA 2LCSA 2RK2A 2IG0A 4JS5A 3NTIA 1VIEA 1RI9A 3OB9A 4LD6A 4LE9A 1YCYA 4M7DB 3VS3A 5CKHA 3V7RA 2DJZA 4HA8A 3MO8A 3OYMA 3CMET 1D09B 2RJEA 3ZBDA 3CPFA 3BW1A 1VQKA 4AG2C 1VQ8Q 1IRXA 3S3NA 3META 1V1CA 1OI1A 4KBMB 2HCKA 2K5IA 4RCCA 2DNUA 3R6NA 4Y92A 3CCVQ 2MF2A 1NZ9A 3PT9A 1X2KA 4M7AA 3QDRB 3QJYA 1VQ6A 2Y4YA 1RLQC 4QQGA 3GNFB 1SF9A 2W0ZA 3J7AF 2KY9A 1YN8A 1MNDA 2ZGWA 1Q86R 3CXCP 1LVKA 1K9MR 2DTIA 1PRLC 3UA7A 3CCSQ 3M55A 4LUDA 3CMAQ 2EJGA 3CC2A 2HDAA 2X35A 4PNOA 3RUXA 3H0HA 2CT4A 2OAUA 7AT1B 3CCRT 2ZPFB 1QCOA 1VQ7A 2L8DA 4WF2A 2RM4A 3UPUA 1PKTA 1WNLA 3H9NA 1KFZA 2K5FA 4M77F 3VS1A 2O31A 4C8QC 5KCOA 3CCEQ 5GMKj 2ZPHB 1MMAA 4M78B 3RMQA 2EQKA 2PZ1A 1UGPB 1BIBA 2YUNA 5LJ5g 2PNIA 1S72Q 4OMNA 2DILA 2ZZDA 4LD9K 3OYFA 3NFCA 4M75F 1XQHA 3JCMg 4DEXA 2RD1A 5GAN6 1MNEA 1KC8R 2RH2A 2WACA 3C95A 1YIJA 4C92D 2J05A 3FRNA 5EG2A 2YT6A 1KK7A 1WHHA 2LVMA 5LJ5f 1FYNA 2OTLA 4JLIA 3EAEA 1G2BA 4FCYA 2J06A 1M1GA 2JN0A 2KMTA 4E7SA 2DZ9A 2VGNA 2EGEA 2RHYA 4A4FA 1AZEA 1VA7A 1NPPA 1VQKQ 4ANJA 1U3OA 2JW4A 2A3LA 4II1A 2L5QA 2MIOA 2ZCFB 2D1XA 3IQLA 4E7HA 3ER0A 3HKSA 2FYKA 3M53A 4F7UG 4HT9A 2C06A 1VQ6Q 1QVGA 4Q5WA 2RPNA 3GBQA 3X26B 4MZPA 1YWOA 5A0GA 3MP6A 1ZSGA 1KG1A 4JJBA 3RKYA 3CEYA 3H0IA 1RADB 4HT8A 1QVGS 3NTHA 3OSSC 2FZCB 3AT1B 3OYIA 5FROA 2GNCA 5GAMj 1KQSA 1QVPA 1RABB 3G71A 4PJNA 1KHIA 3VYGA 2L3SA 1GBRA 3VRYA 2HQHA 2J6OA 4ZN1A 2YUQA 1UUEA 2K6DA 1KQSS 1PD1A 3DLLA 2DEUA 1VQ7Q 5J3BA 2LJ3A 3CCQT 1M3CA 1UJYA 4ELYC 4F17A 3CCJQ 3EFOB 1D1CA 4F7UA 2GQIA 1YCSB 1PC0A 2F2XA 1JXOA 2L0AA 2DETA 3I56T 4MDXA 5IXBA 2OTJT 3CMEA 3TU4K 5KYXB 4FW2A 1N8RU 1VQPQ 4N4GA 2HD0A 1YJWA 3G6ET 1FWZA 3P8DA 3Q1JA 3I9QA 2E1HA 3C0CA 4OVAA 1GCQA 2A36A 2QA4A 1T0JA 3TSZA 3SDZA 1M8VA 2A37A 2ABLA 2MI6A 3SB2A 2OTLQ 2VWFA 2XU8A 1JRIA 3ULRB 2ROLA 5KE2A 5GMKm 1OZ3A 1E6GA 2BE7D 2KBTA 1H641 4C8QE 2FEIA 3VS2A 1NM7A 4UC4A 3JB9I 4XTWA 2K4YA 2O01E 2RI2A 4JJDA 2CP2A 1VQLT 4M77G 3QWXX 2K7AA 1AZGB 2E3IA 1Z9QA 2P4TA 3OYCA 1VQ5A 4RTUA 4M7AB 3QO3A 1IHVA 3OYAA 2LX7A 1K73C 2EQUA
chains in the Genus database with same CATH topology
2R57A 2NLUA 1KC8U 1M1KC 5J39A 4D6WA 2P0QA 1M1FA 1G3WA 4LDVA 3OYHA 1U1TA 4M75G 4RCBA 3GIBA 2QQBA 3FEOA 4PJOE 1FX7A 2CYZB 3QBYA 4E7KA 2DZCA 3JB9D 5GAMf 3OMGA 1B34B 1Y96B 5I21A 3CBPA 2DXBA 1K73U 4XK8E 3OYYA 4DA4A 1P92A 4MMKA 1I5LA 3HP9A 4J8OA 2YLCA 3L1AA 3VKIA 4ATOA 4M75B 5CQXA 2WSFE 2O4XB 3QXEB 4F7UE 4EPCA 3JB9H 4JRKA 5DLQE 3LWHA 3OS0A 3FDRA 2BUDA 2GFAA 4BACA 4C0GA 3C94A 1N27A 3OYNA 3QYGB 1YJWT 1VQ8A 2RB6A 4BY6B 4BB7A 5LJ3g 4PL6A 3ASKA 1QW1A 4HCZA 1GXIE 3PTAA 4KULA 4EMKB 5GAN3 1YJ9T 1YJNA 1BI1A 2QA4T 2DXTA 1VIFA 4QVZA 4ME7A 4C0ZA 3CCVA 3QIIA 1YIJT 1M4ZA 2LC4A 2QXFA 1M5Q1 4J6YA 1N9RA 2P0PA 4O6JA 3CBOA 2QEXA 4M77A 4NL2A 2M1HA 3N5BB 5GAN4 4R55A 4N4IA 4RG2A 1Q81C 5AYFA 5GANg 2KQWA 2BIVA 4J83A 1KHCA 1N9SA 1YI2T 2M9UA 3P8HA 3TREA 3LYIA 4E47A 1RL2A 2K3YA 4JUVA 2YHTA 2K2VA 4ELZC 3JCMe 4PJOA 2CKKA 2XI9A 3INZA 2JUFA 5LJ3f 1B34A 1Y96A 3HSBA 2E70A 2JNGA 2ZPBB 3E1SA 1Q86C 2LCCA 3FJPA 2HNIA 4A4HA 3CCUT 4HCCA 4PKCC 3LW5E 4J7IA 2CZ7B 5CIUA 4M75A 3CCSA 1Q81U 4IUUA 3UWNA 3CXCA 1ZBXA 3X25B 3OMCA 4C8QF 2RI3A 1Y7XA 5GMKi 3CMAA 5HY6A 5HK3A 4RMOA 3OA6A 2QQAA 2XDPA 3BFMA 4O5VA 4RG8A 3VUZA 2FB7A 3I55T 4XU2A 4IURA 4OGCA 3JSCA 5CKFA 5DLOA 5GAOl 3M57A 1VQ5T 2DIGA 2F5KA 2EKOA 1QP2A 2D6FA 4M7DF 4LDWA 1AHJB 3HL8A 1Q86U 3CXCS 2F69A 3MEWA 3HHTB 4ZGJB 2HAXA 4JDSA 1VQNA 4PLLA 3MP1A 3V8LA 2GQVA 3HFNA 4M77D 3CCMA 3PMIA 2G3RA 4BI8B 3OY9A 3RESA 4M7AC 1NE8A 4MZTA 4N0AA 3L2UA 4CI0C 4GLKA 1UGQB 4NS5A 2RHXA 2R5MA 4OB2B 2DPPB 5GAMe 3CCJA 4PJOD 2RHZA 3L2VA 4EMHA 3CCEA 2P0KA 3GLXA 4J7FA 3HRUA 2KSSA 5GANj 3HFOA 2RJCA 5GAOr 3X24B 4M7DC 3CCLA 4FU6A 4FT2A 4E7LA 3QJ6A 4M75D 4C92F 3JCMJ 2PUKB 2X4XA 5KE3A 2VV5A 4LDYA 2E10A 3S6WA 3JCMV 5M9OA 1WGSA 3VU3C 5HKCA 1S72A 1VQPA 2CZ6B 1X75C 4XU1A 3O8VA 4Y28E 5FLXE 3MHXA 3C12A 2K57A 3TCJA 2EQJA 5GMKh 2VXEA 3VUBA 4F7UF 1VQ8T 1MGQA 1LJOA 1I8FA 3A8GB 3TEEA 3UDCA 3JCMW 1PSEA 1NJIC 4FL6A 4M7AG 2EFIA 2LRQA 3QHSA 2KVQG 2DEQA 2MWPA 3LH0A 4BE1A 1QP3A 5CQYA 2PUOB 2DIQA 2X4WA 4RKUE 2E6NA 3G71T 3CCVT 3DKMA 2LNVA 3OYJA 2DKGA 2CZ0B 3KBGA 4A4GA 5LJ3d 2QEXT 3QKJA 3CCRA 1I4K1 3MCAB 4X34A 4C92C 3OYDA 4OB3B 3M59A 4J6WA 3JAME 3MP8A 4BUGA 4IKFA 4M7DG 3V7CA 1HK9A 1NJIU 1ZQ1A 1Q82C 3HRTA 4TVRA 2M16A 2WSCE 4JRQA 4IUQA 4ZTFA 4KUIA 4M77E 2XDBA 3CCQA 3EFRA 5LJ3e 2L3RA 2RK2A 2IG0A 4JS5A 3NTIA 3RKWA 3MEVA 1VIEA 5C6SA 3GPLA 5GAN7 3DLMA 3OB9A 2E41A 4LD6A 4V2SA 1W4SA 2DD4A 3FIFA 4XQ3A 3LLRA 4NOYA 5GANd 1YCYA 3SWNA 1Q7YC 4M7DB 2MWOA 2XKOC 3JRZA 1VQMT 1VQOA 4IUTA 5CKHA 3CMAT 4KUDK 4C5GA 2OTJA 1Q82U 5CO7A 1G3TA 1IZ6A 5LJ5j 3V7RA 4C0FA 2DJZA 5CCAA 5GAOn 2R5AA 4L5GA 2M0OA 1M1KU 1K8AC 4M75E 3JB9F 2EYQA 3HPWA 4HA8A 3MO8A 3OYMA 3CMET 4GY5A 4C92G 2RHUA 3RMSA 2RJEA 3ZBDA 3CPFA 4A4EA 2JZ2A 3BW1A 4M78F 1VQKA 1VQNT 2VC8A 1H3ZA 3GF5A 3CCMT 3S3NA 1W2BS 4BD3A 1WPYA 2QI2A 2Y90A 3META 1KQ1A 4IUVA 4IUPA 1OI1A 4JRIA 4KBMB 2K5IA 3CC7A 4FT4A 5I2MA 3PMTA 4RCCA 5IN1A 4C92B 5LJ5h 1K8AU 2KK4A 3QSUA 2FL7A 3URGA 2MF2A 1JB0E 1NZ9A 3PT9A 4MZMA 3A8HB 4M7AA 3QDRB 3QJYA 4XU0A 2GCXA 2HQXA 2Y4YA 1WJRA 4C5EA 1VQ6A 2DTHA 1VQ4T 4VUBA 5DY9A 3JCMh 3UT1A 3G4SA 1BIAA 3S3OA 3CCET 4KT0E 4QQGA 3GNFB 1OZ2A 3RKXA 3LGLA 3A8OB 3CPWA 3CCLT 2XK0A 4OB0B 3OYKA 5CKBA 3J7AF 2KY9A 3H6ZA 3C4SA 2FVUA 4M78C 3L42A 5D6XA 4M7DA 4C0DB 1U8RA 1YHQA 2ZGWA 4Z02A 2L89A 3BY7A 2RK1A 5FRNA 2DTIA 4XTXA 2D9TA 3CPWS 3JCMb 2DXCA 1JBMA 3M55A 5LL6S 3M58A 2EJGA 3E19A 4NL3A 4N4HA 4A4KA 4BE0A 3CC2A 3WVDB 3T9NA 2X35A 2O4XA 4PNOA 2XDDA 3L2RA 2AHJB 2QQ9A 3V8KA 2DXUA 3X28B 1VUBA 3RUXA 4FSXA 4B9WA 4OGEA 4OP0A 4QVCA 2OAUA 4A54A 3CCRT 1FXXA 2D0QB 2QQSA 2ZPFB 5GANf 4ZGEB 3CD6A 3P8BB 1X6OA 3M56A 4M7AD 5GAMh 4MDWA 1VQ7A 2L8DA 4C92A 2DO3A 4M78G 3JCMc 2PVOB 1XTDA 4EMKA 5CR2A 4WF2A 2LQKA 3CC4A 2RM4A 3UPUA 3QUIA 2ZPGB 5KH6A 3RERA 2PVDB 1WNLA 2X4YA 2RJFA 2Y4XA 1TH7A 2YLBA 2K5FA 4M77F 1IREB 4C8QC 4M7DD 2E65A 5GAN8 5KCOA 1WJQA 5GMKj 2ZPHB 3WVEB 4M78B 4QQ6A 1WJSA 2KDSA 3RMQA 1Y07A 2EQKA 5GMKl 3JB9J 2QQRA 4BDYA 1UGPB 1BYMA 3DB4A 1BIBA 1UGRB 2A7YA 1O9SA 4PJOF 3J80E 5LJ5g 3M9QA 2LT4A 3QPHA 2E6ZA 4R56A 2ZZDA 3BDUA 3M54A 2FHDA 2LQ8A 5GAOm 1VQKT 2ZPEB 2RI5A 4LD9K 3OYFA 3NFCA 4M75F 1M90C 1XQHA 3M5AA 3JCMg 3PIOA 3OYGA 4XTZA 5L8RE 2RD1A 1WQ7A 5A2QE 5GAN6 4BI4A 1VQ9A 3A8LB 2RH2A 2WACA 2EAYA 3C95A 1YIJA 3PNWC 4C92D 3LWIA 1YJNT 3M4GA 3FRNA 3VYHB 5FU6B 2QTXA 5EG2A 3PGGA 3S3MA 4C8QG 1U1SA 3OS2A 3F70A 4DOVA 4C5IA 3L2ZA 3QZ5B 3SD4A 4EDUA 3KXTA 1M90U 5CK9A 2LVMA 5LJ5f 4BE2A 4LDUA 3HRSA 3QG1A 4MMLA 2OTLA 4M7AE 4JLIA 3JCMP 2QDYB 3KUFA 3EAEA 1G3SA 4C8QB 5A0LA 4QQDA 2VUBA 3X20B 1XNIA 3L2WA 4M78A 1M1GA 4OF1A 5CAIA 4XU3A 1X01A 2JN0A 4E7IA 1OYXA 3QZ9B 1UEBA 2KMTA 3MEAA 4M7DE 2DZ9A 2VGNA 5GAMg 3CCST 3I55A 4XTVA 4C0DC 5IAYA 3PIPA 3I56A 1YBYA 1G5VA 2RHYA 2ZPIB 4A4FA 2B8AA 3ZFJA 1W2BA 5GANe 3QYHB 1NPPA 3FC3A 3OYBA 3CD6T 4J6XA 5D6YA 3OYEA 1WQWA 4M77B 5HK0A 5GAOp 4XTYA 4JLGA 1Q7YU 1DJ7B 1VQ7T 3G6EA 2A3LA 4ZTJA 4II1A 1KQ2A 2PU9B 2L5QA 3CC4T 2PVGB 2ZCFB 3R6OA 3GOXA 3FLGA 4E7HA 1JJ2S 1V29B 3AHUA 3ER0A 3HKSA 2FYKA 2DTOA 3CBMA 3M53A 4F7UG 4HCBA 4PJOB 4HT9A 4C92E 3J81E 2C06A 1BI0A 1N6AA 2GF7A 1QVGA 3CCJT 4Q5WA 2WSEE 4XAXB 4FM4B 3E9FA 2VXFA 2E64A 2RO0A 3X26B 2VYTA 4MZPA 4M78D 2H3JA 5A0GA 3MP6A 5CKDA 3OW2A 2K5LA 2RJDA 1Y71A 4C8QA 4F7UB 1KG1A 1D3BB 3RKYA 3CEYA 2EJFA 2V8KA 4L59A 4ZGDB 4HT8A 1QVGS 3NTHA 3OSSC 5FU7B 4J5YA 4BDZA 1YITA 2MMPA 1S72T 1XOVA 4QVDA 1VQPT 2RHIA 3OW2S 1LOJA 3JCMX 4C5HA 2LT1A 5FROA 3OYIA 2MAMA 4JS4A 1PSFA 5GAMj 4EMGA 3MEUA 5LJ5d 2EIFA 3VJPA 1KQSA 4LDXA 2DK3A 2IVWA 3BDLA 5KCHA 1VQ9T 1QVPA 2XHCA 1VQLA 3FB9A 1QVFA 3G71A 4DOWA 2CS7A 1KHIA 4YTLA 3OSVA 1UGSB 2JTMA 3VYGA 3OYLA 2LX9A 5A0DA 3SFMA 4QW2A 4ZN1A 3JCMd 5LJ5e 4L6V5 5J26A 1KQSS 3JB9G 3OS5A 1QVFS 3DLLA 2OTLT 5CVIA 5J3BA 2RA2A 5FU6C 3A5ZB 1RI0A 3SWNC 4ZN3A 2LTOA 3PFSA 4E7JA 1KD1C 3CCQT 4CRIA 4C8QD 5GAOq 2HBPA 2JTFA 3G7ZA 1BI3A 4M7AF 1K9MC 4JRPA 2CGHA 3LGFA 1VQMA 4ELYC 1N8RC 3WXMB 2R58A 2K3XA 3NTKA 4X9CA 1BKBA 1ZHIA 4F7UA 3VV0A 1D3BA 5IT9E 1BI2A 2X4JA 2EWNA 4X9DA 4BI3A 1VQOT 2DAQA 1HXDA 4M78E 3I56T 4MDXA 2OTJT 2DD5A 2XICA 2XG8D 1KD1U 3GP8A 3CMEA 2CZ1B 3TU4K 2E12A 2LDMA 1SSFA 1LNXA 1K9MU 3ZEHA 2KAFA 4HKEA 5GAMd 5FRMA 5GAN2 5LJ3j 1N8RU 1NPRA 4N4GA 2HD0A 2E5QA 5CKEA 1YJWA 3G6ET 1FWZA 2XD0A 4XTUA 3P8DA 2V8JA 3DB3A 1I81A 2VGMA 3OBWA 3Q1JA 2F5TX 2E1HA 2LCLA 4OVAA 5DM7R 1YJ9A 2JOYA 4OMFB 4Y91A 3OQ5A 2QA4A 3ME9A 3CC7T 4M77C 2JVVA 2PQWA 4DQ2A 3SDZA 4P5NA 5C0MA 4JJNK 1VQ4A 3V7SA 2XIDA 3SWNB 2YRVA 1VQ6T 4PLIA 1M8VA 5LJ3h 2I2LA 2BKDN 2MI6A 3SB2A 3G4ST 4PJOC 2EJ9A 4A53A 2XU8A 1MHNA 1UB4A 1JRIA 1M9SA 1YI2A 5KE2A 1G3YA 3H8ZA 1OZ3A 5GMKm 3OS1A 3LX7A 1O75A 4C8QE 1H641 1YITT 4M75C 3JCMQ 3JCMf 4UC4A 1YHQT 3L2QA 3JB9I 4XTWA 3CCUA 3V8JA 3EFSA 2HQEA 3GNGA 2K4YA 2O01E 4OB1B 2V8IA 3A8MB 5GANh 2RI2A 3RIRA 5D6WA 4B9XA 3M4YA 5I2SA 1KC8C 1VQLT 2EQMA 5FU7C 3OBYA 1EIFA 4M77G 3CC2T 1R8OB 4BY6C 5GMKe 2P4TA 3OYCA 1VQ5A 2GFUA 3E9GA 4EMKC 4M7AB 1JJ2A 3QO3A 4FIBA 2DVEA 4PJOG 3OYAA 4N0AC 1K73C 2EQUA 5GAN5
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT1 A;  2EYQ A;  4KBM B;  4XAX B;  2LQK A;  2LT4 A;  4L5G A; 
#chains in the Genus database with same CATH topology
 2NLU A;  4D6W A;  1M1F A;  2KRO A;  1U1T A;  4M75 G;  1QMC A;  2QQB A;  3FEO A;  3ZL7 C;  1FX7 A;  4FSS A;  1RAE B;  2EYX A;  1M2V A;  1YFN A;  1Y57 A;  2RQR A;  4J8O A;  1UHF A;  1HYO A;  5DLQ E;  3FDR A;  4AT1 B;  3C94 A;  1X6G A;  2RB6 A;  1GXI E;  4J9I A;  1VIF A;  4HCK A;  1K4U S;  1M5Q 1;  4KH0 B;  2P0P A;  4F16 A;  4M77 A;  4NL2 A;  1OX8 A;  4N4I A;  5GAN g;  5GJW B;  1N9S A;  1YI2 T;  3TRE A;  3P8H A;  4JUV A;  2K2V A;  3JCM e;  2HBW A;  2XI9 A;  1Y96 A;  2IPO B;  2KXC A;  2HNI A;  4PKC C;  1WI7 A;  2CH4 A;  4M75 A;  1TS9 A;  3MJX A;  2RI3 A;  4O5V A;  4RG8 A;  2FB7 A;  4XU2 A;  2L2P A;  5CKF A;  2QTV A;  1A0N B;  2JM8 A;  2EKO A;  1Q86 U;  3HHT B;  4ZGJ B;  2HAX A;  1N5Z A;  4JDS A;  1YJW Q;  1VQN A;  3SEM A;  1WDX A;  2KGT A;  4E2F B;  4Z89 A;  3OY9 A;  1M2O A;  4M7A C;  4MZT A;  2C0I A;  2QA4 Q;  4J9D A;  2RHX A;  4OB2 B;  4PJO D;  2VVK A;  3HRU A;  2KSS A;  1GCP A;  3UF4 A;  5GAO r;  3X24 B;  3CCL A;  4E7L A;  2CRE A;  2X4X A;  4LDY A;  2E10 A;  3JCM V;  2KXD A;  3VU3 C;  5HKC A;  2CZ6 B;  1ZA2 B;  3TCJ A;  3VUB A;  2VAS A;  3UDC A;  3D7S B;  2DEQ A;  3EG0 A;  5CQY A;  1FMK A;  1JJ2 P;  2DIQ A;  2X4W A;  1VQ5 Q;  4JJC A;  4A4G A;  1T3L A;  4X1V A;  2AT1 B;  2DFU A;  1HK9 A;  2DER A;  3HRT A;  4TVR A;  2WSC E;  1WZO A;  4IUQ A;  5FWC A;  3CCQ A;  5LJ3 e;  3UA6 A;  4B6M A;  4F04 B;  3GPL A;  5GAN 7;  1AEY A;  2KI7 A;  3FIF A;  4ESR A;  4NOY A;  1VQM T;  4IUT A;  4EIK A;  2OTJ A;  4C5G A;  2H3E B;  5LJ5 j;  2C0O A;  4CC4 B;  5GAO n;  2R5A A;  1K8A C;  3HPW A;  2NYS A;  4C92 G;  4DBF A;  3RMS A;  1H3Z A;  3CCM T;  1W2B S;  1D1A A;  1WPY A;  2QI2 A;  4IUP A;  1VYT A;  1M27 C;  4JRI A;  4KGV B;  5I2M A;  5LJ5 h;  3QSU A;  2YXY A;  3URG A;  3A1P A;  3A8H B;  1SKU B;  1VQ4 T;  4VUB A;  3JCM h;  3S3O A;  1Q81 R;  3RKX A;  3A8O B;  2YUO A;  3I35 A;  3TVT A;  1TU0 B;  4Z02 A;  2L89 A;  9ATC B;  4XTX A;  1N8R R;  3M58 A;  2LNH B;  4NL3 A;  4BE0 A;  1TG0 A;  3T9N A;  3L2R A;  3X28 B;  2QQ9 A;  2P4R A;  1ZUK A;  4OP0 A;  2XMF A;  4HVV A;  4CC3 A;  2QQS A;  4ZGE B;  3EGD B;  1GBQ A;  5I22 A;  1VQN Q;  4MDW A;  4C92 A;  2E5K A;  1XTD A;  2PVO B;  2DL4 A;  3CC4 A;  1OX9 A;  2CUD A;  5KH6 A;  1K9A A;  2RJF A;  2Y4X A;  1HJD A;  1KIK A;  4M7D D;  2DRM A;  3M0T A;  3WVE B;  2FRW A;  4QQ6 A;  2KDS A;  1NLP C;  5GMK l;  3G1J A;  3CCL Q;  4BDY A;  3DB4 A;  2A7Y A;  4PJO F;  3TQ7 P;  3J80 E;  2E6Z A;  2AK5 A;  3M54 A;  2FHD A;  2LQ8 A;  1M90 C;  3EG1 A;  2F1L A;  3PIO A;  1UEC A;  2PTK A;  1WQ7 A;  5A2Q E;  4BI4 A;  1VQ9 A;  4J9H A;  2EAY A;  3PNW C;  1YJN T;  2QTX A;  3OS2 A;  3LH5 A;  2E4H A;  3L2Z A;  4C5I A;  4EDU A;  3KXT A;  5CK9 A;  1M2V B;  4RTZ A;  4M7A E;  1Q82 R;  1H92 A;  3KUF A;  4C8Q B;  4PJL A;  1XNI A;  5CAI A;  4XU3 A;  1OYX A;  1UEB A;  1C6V X;  2OTJ Q;  2AZV A;  1YBY A;  1G5V A;  2ZPI B;  2BZX A;  3ZFJ A;  5GAN e;  3QYH B;  4DEY A;  3CD6 T;  4J6X A;  3OYE A;  1WQW A;  4M77 B;  5GAO p;  4XTY A;  1DJ7 B;  1GCQ C;  2EGC A;  1OPL A;  3M0S A;  1WHM A;  2LMJ A;  2KRM A;  2PVG B;  3GOX A;  1V29 B;  1TOV A;  1PM3 A;  1ZUU A;  3J81 E;  1N6A A;  2GF7 A;  1OQK A;  5GJV B;  2VXF A;  2RO0 A;  1H8K A;  1JXM A;  2B86 A;  4M78 D;  2H3J A;  3OW2 A;  1K1Z A;  2RJD A;  4D8D A;  4L59 A;  4ZGD B;  2DL7 A;  5KYY A;  3VS6 A;  4BDZ A;  2MMP A;  2OI3 A;  4QVD A;  3OW2 S;  1YNZ A;  2NUT A;  2LT1 A;  4C5H A;  1PSF A;  1AWW A;  5LJ5 d;  2EIF A;  2JM9 A;  2IVW A;  4Z8A A;  5KCH A;  2CH4 W;  3FB9 A;  2CS7 A;  3OYL A;  5A0D A;  4QW2 A;  3JCM d;  4CC7 A;  4L6V 5;  2KT1 A;  5J26 A;  3OS5 A;  1UDL A;  2RA2 A;  4PFO A;  3SWN C;  3CC4 Q;  4ZN3 A;  3PE0 A;  3G7Z A;  1RAI B;  1K9M C;  3LGF A;  1VQM A;  5IHK A;  3WXM B;  2R58 A;  2FRY A;  2K3X A;  3NTK A;  1OPK A;  1BKB A;  1ZHI A;  1D3B A;  2HL3 A;  1VQO T;  1C0M A;  2DAQ A;  2QDL A;  2QG9 B;  2RQU A;  4LN2 A;  1RAH B;  2DD5 A;  1KD1 U;  2CZ1 B;  1TSF A;  2E12 A;  1LNX A;  2AKK A;  2KRN A;  3ZEH A;  1AWO A;  2RMO A;  1NPR A;  5CKE A;  2XD0 A;  3DB3 A;  2ROT A;  3OBW A;  1VQ9 Q;  1YJ9 A;  4Y91 A;  4OMF B;  3OQ5 A;  2JT4 A;  3ME9 A;  4M77 C;  3CC7 T;  2PQW A;  1TUG B;  4JJN K;  1VQ4 A;  3G4S T;  2EJ9 A;  1ZX6 A;  1UB4 A;  1JQQ A;  1O75 A;  1YIT T;  4M75 C;  3JCM f;  1X6B A;  1YHQ T;  3CCU A;  3EH1 A;  3EFS A;  3A8M B;  5GAN h;  1OUL A;  3EG9 A;  1Q7Y R;  1KC8 C;  3EGU A;  1EIF A;  4E6R A;  1TUD A;  4BY6 C;  1TWB A;  1GL5 A;  3H0F A;  1W1F A;  4EMK C;  2FG0 A;  4PJO G;  2R57 A;  3M0U A;  2VKN A;  4LDV A;  3OYH A;  3GIB A;  1QVG P;  2LZ6 B;  4PJO E;  2JJ9 A;  3UAT A;  3JB9 D;  2VB6 A;  4LNP A;  1I5O B;  4XK8 E;  4ATO A;  2KR3 A;  2YLC A;  2O2O A;  4F7U E;  4KRT A;  3OS0 A;  2BUD A;  1N27 A;  5ECA A;  3OYN A;  1KQS P;  5LJ3 g;  4PL6 A;  1D0Z A;  1CSK A;  4KUL A;  1YJN A;  2JS0 A;  1M8M A;  3CC2 Q;  4QVZ A;  4C0Z A;  3NMZ C;  1UTI A;  2QGG A;  4J6Y A;  1N9R A;  3H41 A;  2QEX A;  3MKD A;  3N5B B;  5GAN 4;  8AT1 B;  4R55 A;  1ZSZ A;  2KQW A;  4J83 A;  1KHC A;  4RTX A;  4DBH A;  4PJO A;  2YHT A;  1WYX A;  4ORZ A;  2CKK A;  3INZ A;  5LJ3 f;  1B34 A;  2E70 A;  2JNG A;  1VQM Q;  2X51 A;  2LCC A;  3FJP A;  1WA7 A;  3LW5 E;  1Q81 U;  4IUU A;  1ZBX A;  3X25 B;  5HK3 A;  2QQA A;  3I55 T;  2V26 A;  1QP2 A;  2D6F A;  1X27 A;  4LDW A;  1AHJ B;  2F69 A;  1MV3 A;  1ACM B;  3HTR A;  3M0R A;  1WLP B;  3RES A;  1YJ9 Q;  4N0A A;  2GGR A;  3L2U A;  4CI0 C;  1UGQ B;  2DPP B;  1YIJ Q;  3EHQ A;  3MPU B;  1PWT A;  2P0K A;  3HFO A;  3O5Z A;  2RJC A;  4FT2 A;  1MV0 B;  3QJ6 A;  4C92 F;  5KE3 A;  5M9O A;  1WGS A;  2HSE B;  4XU1 A;  4Y28 E;  2FZG B;  3CCU Q;  2K57 A;  1RLP C;  1VQ8 T;  4OML A;  1B3Q A;  2QYZ A;  2GTO A;  1GFC A;  1QP3 A;  3EGX A;  4RKU E;  3CCV T;  3DKM A;  2LNV A;  3OYJ A;  3CCR A;  3QKJ A;  1NBE B;  4C92 C;  2J7I A;  3M59 A;  4FYX B;  4BUG A;  4M7D G;  1NJI U;  2FPE A;  5IHI A;  2M16 A;  2AIR B;  2QAS A;  4KUI A;  4M77 E;  3EFR A;  2L3R A;  5C6S A;  1YWP A;  5KYY B;  2E41 A;  1OV3 A;  1EX4 A;  2DD4 A;  4XQ3 A;  5GAN d;  3SWN A;  2XKO C;  1VQO A;  1AD5 A;  4ZNX A;  3CMA T;  1Q82 U;  3NHN A;  5CO7 A;  1IZ6 A;  4L5G A;  4M75 E;  3JB9 F;  2EYQ A;  5HCK A;  2IIM A;  2EW3 A;  2RHU A;  2RQV A;  1QKW A;  2L3Q A;  2VC8 A;  4BD3 A;  1KQ1 A;  4IUV A;  3CC7 A;  4FT4 A;  3PMT A;  2FL7 A;  1KJW A;  3G71 Q;  1JB0 E;  4MZM A;  1RAA B;  1WHK A;  4XU0 A;  2HL5 C;  2GCX A;  2HQX A;  2QEX Q;  3CCE T;  5DY9 A;  3UT1 A;  3G4S A;  3THK A;  4KT0 E;  1B7T A;  1OZ2 A;  1AOJ A;  3LGL A;  1UJ0 A;  3CPW A;  2XK0 A;  4OB0 B;  3H6Z A;  2FVU A;  3E2U A;  3L42 A;  4M7D A;  2LJ1 A;  1KD1 R;  1YHQ A;  2HSP A;  1UG1 A;  2RK1 A;  3CPW S;  2D9T A;  1I0C A;  5LL6 S;  5IHN A;  3E19 A;  1NLO C;  3WVD B;  2O4X A;  2RQW A;  2AHJ B;  2DXU A;  4FSX A;  1QLY A;  4QVC A;  3CME Q;  1FXX A;  2D0Q B;  5GAN f;  2K2M A;  1X6O A;  3M56 A;  2MOX A;  2YSQ A;  5CR2 A;  4M78 G;  4EMK A;  2ZPG B;  3RER A;  2X4Y A;  2QK0 A;  2YLB A;  4OMO A;  1GRI A;  1PCX A;  1RAC B;  1IRE B;  3I5S A;  2YRD A;  1Y07 A;  4OMP A;  3RDV A;  3EH2 A;  3M9Q A;  2SEM A;  2ENM A;  3BDU A;  5GAO m;  1VQK T;  1PG5 B;  2RI5 A;  6AT1 B;  3M5A A;  2MCN A;  1HD3 A;  3OYG A;  1IGQ A;  1CKA A;  2DBM A;  3FJ5 A;  3A8L B;  3LWI A;  3M4G A;  3PGG A;  3CCR Q;  2K79 A;  1U1S A;  4HVW A;  3F70 A;  2MYS A;  3QZ5 B;  2FZK B;  1WXB A;  3SD4 A;  4BE2 A;  2DA9 A;  3QG1 A;  4MML A;  1WHL A;  1AT1 B;  1WXU A;  1G3S A;  4RTT A;  1M1K R;  2BZ8 A;  5A0L A;  2VUB A;  3X20 B;  3L2W A;  4M78 A;  1X01 A;  4E7I A;  1UFF A;  1VQO Q;  3MEA A;  5GAM g;  3I55 A;  5IAY A;  3I56 A;  2LQW A;  1J3T A;  2B8A A;  1W2B A;  1SEM A;  3REA B;  5D6Y A;  2EYW A;  5HK0 A;  2FO0 A;  1T0H A;  4JLG A;  1Q7Y U;  1ZSZ B;  1VQ7 T;  3G6E A;  1KQ2 A;  1JJ2 S;  3R6O A;  3FLG A;  2QGF B;  1ZUY A;  2DYI A;  2DTO A;  3CBM A;  4PJJ A;  4PJO B;  2KE9 A;  4C92 E;  3CCJ T;  2WSE E;  4FM4 B;  2E64 A;  5D7U A;  2HEQ A;  2VYT A;  3EG3 A;  4F7U B;  2O9S A;  2EJF A;  2V8K A;  4J5Y A;  2A08 A;  1XOV A;  1VQP T;  2RHI A;  4AG1 C;  1GFD A;  1LOJ A;  3JCM X;  2RF0 A;  4JS4 A;  2MAM A;  3MEU A;  3VJP A;  2DK3 A;  1QVF A;  2RNA A;  1VQL A;  2XHC A;  1Q95 G;  4DOW A;  1Y0M A;  4J9G A;  3A98 A;  3OSV A;  1UGS B;  4YTL A;  2LX9 A;  3SFM A;  3JB9 G;  1QVF S;  2OTL T;  1RI0 A;  3BE3 A;  1XJW B;  2LTO A;  4E7J A;  4CRI A;  4C8Q D;  5GAO q;  2HBP A;  2JTF A;  1BI3 A;  1OU8 A;  4JPB W;  2CGH A;  1N8R C;  1PD0 A;  5IT9 E;  2X4J A;  4BI3 A;  1B07 A;  1HXD A;  2XIC A;  4OMM A;  2DYB A;  3GP8 A;  2LDM A;  1SSF A;  2EPD A;  2KAF A;  4HKE A;  4JZ4 A;  5LJ3 j;  1NYG A;  1M90 R;  3VRZ A;  2E5Q A;  2EYZ A;  2DE0 X;  2O88 A;  2V8J A;  3RNJ A;  1I81 A;  1EZZ B;  1NJI R;  5DM7 R;  2CT3 A;  2JVV A;  2AKL A;  4DQ2 A;  2K9G A;  4J9C A;  1ZSZ C;  4P5N A;  5C0M A;  2XID A;  1OU9 A;  3SWN B;  2YRV A;  4PLI A;  3CQT A;  2I2L A;  2BKD N;  5LJ3 h;  4PJO C;  1QWF A;  1MHN A;  2DVJ A;  2RQT A;  4FYV B;  1YI2 A;  3CCQ Q;  3H8Z A;  3LX7 A;  2M02 A;  1JEG A;  3L2Q A;  2COY A;  3V8J A;  3GNG A;  2V8I A;  2KRS A;  1WX6 A;  2DF6 A;  3RIR A;  5D6W A;  1SSH A;  3M4Y A;  1K0S A;  3I56 Q;  1BK2 A;  5KYX A;  1R8O B;  5GMK e;  4R0K A;  2YRC A;  2EVR A;  2DVE A;  2MK5 A;  2J6K A;  4N0A C;  3G6E Q;  1S1N A;  5J39 A;  4PFP A;  1G3W A;  2CP6 A;  1C1A A;  4OMQ A;  1TUC A;  2JXB A;  1W6X A;  1X69 A;  4E7K A;  2DZC A;  3OW2 P;  3OMG A;  1Y96 B;  5I21 A;  1BU1 A;  2DXB A;  2M51 A;  1K73 U;  4DA4 A;  1P92 A;  4KGX B;  3L1A A;  2E3H A;  4M75 B;  5KYN A;  5CQX A;  2WSF E;  2O4X B;  3JB9 H;  3LWH A;  2CSQ A;  1IO6 A;  4BAC A;  1NEG A;  2Z0W A;  1ZA1 B;  2GBQ A;  1YJW T;  2C0T A;  4BY6 B;  3JV3 A;  3ASK A;  4HCZ A;  2A0F B;  1VQL Q;  4EMK B;  5GAN 3;  1ABQ A;  1BI1 A;  1R0C B;  1ABO A;  2DXT A;  2QA4 T;  4ME7 A;  1M4Z A;  2LC4 A;  2QXF A;  2L3P A;  4O6J A;  3CBO A;  4Z88 A;  2NUZ A;  3KFV A;  1X2Q A;  2BIV A;  4E47 A;  3LYI A;  1PRM C;  2K3Y A;  4ELZ C;  2X3W D;  2ZPB B;  3M0Q A;  4DBQ A;  1Q86 C;  1QWE A;  3M0P A;  4J7I A;  2CZ7 B;  3TSW A;  2O9V A;  3UWN A;  3CXC A;  3OMC A;  4C8Q F;  1Y7X A;  2XDP A;  3VUZ A;  4OGC A;  3JSC A;  5GAO l;  3M57 A;  1VQ5 T;  2DIG A;  4E7Z A;  4M7D F;  2P84 A;  1WFW A;  3CXC S;  1OOT A;  2DL8 A;  3MP1 A;  2DJQ A;  3V8L A;  3HFN A;  3CCM A;  1QQJ A;  5FW9 A;  4NS5 A;  1YP5 A;  5GAM e;  2CDT A;  3CCJ A;  3VS4 A;  1ARK A;  2RHZ A;  2CP3 A;  1UGV A;  3GLX A;  5GAN j;  4M7D C;  4FU6 A;  1YI2 Q;  1VYV A;  3S6W A;  3QDF A;  1VQP A;  5AT1 B;  5FLX E;  3C12 A;  5GMK h;  2VXE A;  2GTJ A;  1I8F A;  1D0X A;  2X3X D;  3A8G B;  2EFI A;  2LRQ A;  4PJM A;  2KVQ G;  2ATC B;  2MWP A;  2FPD A;  1SG5 A;  2DX1 A;  2CP7 A;  2E6N A;  2J6F A;  2LQN A;  3KBG A;  5LJ3 d;  1I4K 1;  4X34 A;  1I07 A;  4J6W A;  4IKF A;  2JMC A;  3MP8 A;  3V7C A;  4ZTF A;  4DBR A;  2EYY A;  3RKW A;  3MEV A;  3DLM A;  4V2S A;  1W4S A;  3LLR A;  1Q7Y C;  2MWO A;  2FPF A;  3JRZ A;  2QAZ A;  2DLP A;  2W10 A;  4JZ3 A;  4KUD K;  1G3T A;  3QWY A;  2HKN A;  1F1B B;  4C0F A;  5CCA A;  2M0O A;  1M1K U;  4GY5 A;  4WCI A;  2SRC A;  1MUZ A;  4HXJ A;  4A4E A;  2JZ2 A;  2OJ2 A;  4M78 F;  1VQN T;  3RR6 A;  4KH1 B;  3GF5 A;  4PK4 A;  5EC7 A;  2Y90 A;  5IN1 A;  4C92 B;  3RBB B;  4KGZ B;  2KK4 A;  1K8A U;  4CC2 A;  1WJR A;  4C5E A;  2DTH A;  1BIA A;  5KYU A;  3CCL T;  1G8X A;  3OYK A;  5CKB A;  3C4S A;  2JMA A;  4M78 C;  2YDL A;  5D6X A;  4C0D B;  1U8R A;  4A63 B;  3BY7 A;  1WXT A;  5FRN A;  3JCM b;  2DXC A;  1JBM A;  1E7O A;  2F2W A;  1QKX A;  4N4H A;  4A4K A;  2XDD A;  3V8K A;  2DL5 A;  1VUB A;  4B9W A;  4OGE A;  4A54 A;  3NPF A;  1LCK A;  3CD6 A;  2V1Q A;  1QCN A;  3P8B B;  2MPX C;  4M7A D;  1R77 A;  5GAM h;  3CCM Q;  2JTE A;  4FYY B;  2DO3 A;  3JCM c;  2LQK A;  3QUI A;  1Z9Z A;  2PVD B;  2YWW A;  1TH7 A;  4RTW A;  2JS2 A;  2E65 A;  5KYW A;  5GAN 8;  1WJQ A;  1VQ4 Q;  1WJS A;  3JB9 J;  2QQR A;  1BYM A;  1UGR B;  1PNJ A;  1O9S A;  2D8J A;  2NUP A;  2LT4 A;  1WIE A;  3QPH A;  1PHT A;  1WHG A;  4R56 A;  2ZPE B;  2COZ A;  2BZY A;  2KYB A;  2HMA A;  1D1B A;  4XTZ A;  1RUW A;  5L8R E;  3VS7 A;  3VYH B;  5FU6 B;  3EGD A;  2AZS A;  4C8Q G;  3S3M A;  2DBK A;  4LUE A;  4DOV A;  1M90 U;  4AFS C;  4LDU A;  3HRS A;  3JCM P;  4M4Z A;  4D8K A;  1K73 R;  1ZLM A;  2QDY B;  1UHC A;  4QQD A;  4OF1 A;  3QZ9 B;  4M7D E;  3CCS T;  4XTV A;  4C0D C;  1SRM A;  2NUT B;  3PIP A;  4RTV A;  3FC3 A;  3OYB A;  4QKU A;  1BCO A;  2CP0 A;  1CKB A;  2CUB A;  4ZTJ A;  2PU9 B;  1IGU A;  3CC4 T;  3AHU A;  1OEB A;  2H8H A;  4HCB A;  1YJN Q;  2DL3 A;  4AMC A;  1BI0 A;  1IXD A;  4XAX B;  1TTH B;  3E9F A;  3CPW P;  5CKD A;  2K5L A;  1SHF A;  4C8Q A;  1Y71 A;  4RTY A;  1D3B B;  2YUP A;  1BCM A;  5FU7 B;  1YIT A;  1S72 T;  4J9F A;  4LXC A;  4EMG A;  4LDX A;  3BDL A;  2G6F X;  1VQ9 T;  2HZY A;  2NWM A;  1U06 A;  1IB8 A;  2JTM A;  1AWJ A;  2D0N A;  2ZAE A;  5LJ5 e;  3CD6 Q;  2COW A;  2M0Y A;  2ECZ A;  5CVI A;  5FU6 C;  3A5Z B;  1MMG A;  3PFS A;  1KD1 C;  2RN8 A;  4M7A F;  4GLM A;  4JRP A;  4J9B A;  3VS0 A;  1K76 A;  2KT8 A;  4X9C A;  3VV0 A;  3PVQ A;  1BI2 A;  4X9D A;  2EWN A;  4M78 E;  1VOM A;  3EG9 B;  2XG8 D;  1I1J A;  2CP5 A;  1WHJ A;  1K9M U;  5GAM d;  5FRM A;  5GAN 2;  4XTU A;  3PVL A;  2BTT A;  2VGM A;  2F5T X;  2LCL A;  2JOY A;  1JO8 A;  4GBQ A;  3V7S A;  4WTO B;  1VQ6 T;  1T3S A;  5IXF A;  2D8H A;  4A53 A;  1X43 A;  1JU5 C;  1M9S A;  1UE9 A;  1SPK A;  1G3Y A;  1EFN A;  2KYM A;  4AFQ C;  3OS1 A;  3JCM Q;  2V1R A;  3EHR A;  2HQE A;  4OB1 B;  1V76 A;  4B9X A;  2EBP A;  5I2S A;  3I5R A;  2DMO A;  2EQM A;  1W2B P;  5FU7 C;  3OBY A;  3CC2 T;  1M30 A;  5I11 A;  4FW1 A;  3REB B;  1PKS A;  4AFZ C;  2GFU A;  3E9G A;  1K8A R;  1G83 A;  1JJ2 A;  4FIB A;  3VS5 A;  1NYF A;  1ZBJ A;  2EQI A;  5GAN 5;  8ATC B;  5KYU B;  1R0B G;  1KC8 U;  1M1K C;  4PFZ A;  2P0Q A;  4RCB A;  3CC7 Q;  2CYZ B;  3QBY A;  5GAM f;  1B34 B;  3CBP A;  2F2V A;  3OYY A;  1RAF B;  3G4S Q;  2OAW A;  4MMK A;  1I5L A;  3HP9 A;  1E6H A;  3VKI A;  4HVU A;  2A28 A;  3QXE B;  4EPC A;  4JRK A;  1SRL A;  1YIT Q;  2GFA A;  2I0N A;  4C0G A;  2EKH A;  1YHQ Q;  1QCF A;  3QYG B;  4IIM A;  1QVF P;  1VQ8 A;  1HSQ A;  4BB7 A;  1QW1 A;  3PTA A;  1YJ9 T;  1BB9 A;  4J9E A;  5FWB A;  3CCV A;  3QII A;  1YIJ T;  1RAG B;  2M1H A;  4RUG A;  5KYW B;  4RG2 A;  1Q81 C;  5AYF A;  2EGA A;  2M9U A;  1RL2 A;  3EG2 A;  2NUP B;  2JUF A;  2ED1 A;  3HSB A;  3NGP A;  3E1S A;  4A4H A;  3CCU T;  4HCC A;  5L23 A;  1TXQ A;  5CIU A;  3CCS A;  2ED0 A;  4QT7 A;  1FMW A;  5GMK i;  3CMA A;  5HY6 A;  4RMO A;  3OA6 A;  3BFM A;  1M3A A;  2X9H A;  2KNB B;  4IUR A;  5DLO A;  1KSW A;  2F5K A;  2CSI A;  3EGX B;  4FYW B;  3HL8 A;  2BE9 B;  1NG2 A;  1VYU A;  3MEW A;  2LJ0 A;  4F14 A;  1AVZ C;  1LPL A;  2LP5 A;  4PLL A;  1K0X A;  2GQV A;  4M77 D;  1NEB A;  3PMI A;  2G3R A;  4BI8 B;  1NE8 A;  4GLK A;  1FMV A;  2R5M A;  1MMD A;  2K3B A;  4AFU C;  2ESW A;  1H3H A;  3SHW A;  1U5S A;  1AWX A;  3L2V A;  4EMH A;  3CCE A;  2HKQ B;  4J7F A;  3U23 A;  2DM1 A;  4M75 D;  3JCM J;  1W70 A;  2PUK B;  2VV5 A;  1S72 A;  1SHG A;  5IH2 A;  1X75 C;  3O8V A;  3MHX A;  2EQJ A;  3EFO A;  1D0Y A;  4F7U F;  1MGQ A;  1LJO A;  3TEE A;  3JCM W;  1PSE A;  1NJI C;  4FL6 A;  4M7A G;  4K11 A;  3QHS A;  4BE1 A;  3LH0 A;  1MMN A;  4IIO A;  3I55 Q;  2PUO B;  1BBZ A;  1IHW A;  2DRK A;  3G71 T;  2DKG A;  2CZ0 B;  1M3B A;  2KEA A;  2QEX T;  3MCA B;  3OYD A;  4OB3 B;  3JAM E;  2OX7 A;  1ZQ1 A;  1Q82 C;  4JRQ A;  2XDB A;  2LCS A;  2RK2 A;  2IG0 A;  4JS5 A;  3NTI A;  1VIE A;  1RI9 A;  3OB9 A;  4LD6 A;  4LE9 A;  1YCY A;  4M7D B;  3VS3 A;  5CKH A;  3V7R A;  2DJZ A;  4HA8 A;  3MO8 A;  3OYM A;  3CME T;  1D09 B;  2RJE A;  3ZBD A;  3CPF A;  3BW1 A;  1VQK A;  4AG2 C;  1VQ8 Q;  1IRX A;  3S3N A;  3MET A;  1V1C A;  1OI1 A;  4KBM B;  2HCK A;  2K5I A;  4RCC A;  2DNU A;  3R6N A;  4Y92 A;  3CCV Q;  2MF2 A;  1NZ9 A;  3PT9 A;  1X2K A;  4M7A A;  3QDR B;  3QJY A;  1VQ6 A;  2Y4Y A;  1RLQ C;  4QQG A;  3GNF B;  1SF9 A;  2W0Z A;  3J7A F;  2KY9 A;  1YN8 A;  1MND A;  2ZGW A;  1Q86 R;  3CXC P;  1LVK A;  1K9M R;  2DTI A;  1PRL C;  3UA7 A;  3CCS Q;  3M55 A;  4LUD A;  3CMA Q;  2EJG A;  3CC2 A;  2HDA A;  2X35 A;  4PNO A;  3RUX A;  3H0H A;  2CT4 A;  2OAU A;  7AT1 B;  3CCR T;  2ZPF B;  1QCO A;  1VQ7 A;  2L8D A;  4WF2 A;  2RM4 A;  3UPU A;  1PKT A;  1WNL A;  3H9N A;  1KFZ A;  2K5F A;  4M77 F;  3VS1 A;  2O31 A;  4C8Q C;  5KCO A;  3CCE Q;  5GMK j;  2ZPH B;  1MMA A;  4M78 B;  3RMQ A;  2EQK A;  2PZ1 A;  1UGP B;  1BIB A;  2YUN A;  5LJ5 g;  2PNI A;  1S72 Q;  4OMN A;  2DIL A;  2ZZD A;  4LD9 K;  3OYF A;  3NFC A;  4M75 F;  1XQH A;  3JCM g;  4DEX A;  2RD1 A;  5GAN 6;  1MNE A;  1KC8 R;  2RH2 A;  2WAC A;  3C95 A;  1YIJ A;  4C92 D;  2J05 A;  3FRN A;  5EG2 A;  2YT6 A;  1KK7 A;  1WHH A;  2LVM A;  5LJ5 f;  1FYN A;  2OTL A;  4JLI A;  3EAE A;  1G2B A;  4FCY A;  2J06 A;  1M1G A;  2JN0 A;  2KMT A;  4E7S A;  2DZ9 A;  2VGN A;  2EGE A;  2RHY A;  4A4F A;  1AZE A;  1VA7 A;  1NPP A;  1VQK Q;  4ANJ A;  1U3O A;  2JW4 A;  2A3L A;  4II1 A;  2L5Q A;  2MIO A;  2ZCF B;  2D1X A;  3IQL A;  4E7H A;  3ER0 A;  3HKS A;  2FYK A;  3M53 A;  4F7U G;  4HT9 A;  2C06 A;  1VQ6 Q;  1QVG A;  4Q5W A;  2RPN A;  3GBQ A;  3X26 B;  4MZP A;  1YWO A;  5A0G A;  3MP6 A;  1ZSG A;  1KG1 A;  4JJB A;  3RKY A;  3CEY A;  3H0I A;  1RAD B;  4HT8 A;  1QVG S;  3NTH A;  3OSS C;  2FZC B;  3AT1 B;  3OYI A;  5FRO A;  2GNC A;  5GAM j;  1KQS A;  1QVP A;  1RAB B;  3G71 A;  4PJN A;  1KHI A;  3VYG A;  2L3S A;  1GBR A;  3VRY A;  2HQH A;  2J6O A;  4ZN1 A;  2YUQ A;  1UUE A;  2K6D A;  1KQS S;  1PD1 A;  3DLL A;  2DEU A;  1VQ7 Q;  5J3B A;  2LJ3 A;  3CCQ T;  1M3C A;  1UJY A;  4ELY C;  4F17 A;  3CCJ Q;  3EFO B;  1D1C A;  4F7U A;  2GQI A;  1YCS B;  1PC0 A;  2F2X A;  1JXO A;  2L0A A;  2DET A;  3I56 T;  4MDX A;  5IXB A;  2OTJ T;  3CME A;  3TU4 K;  5KYX B;  4FW2 A;  1N8R U;  1VQP Q;  4N4G A;  2HD0 A;  1YJW A;  3G6E T;  1FWZ A;  3P8D A;  3Q1J A;  3I9Q A;  2E1H A;  3C0C A;  4OVA A;  1GCQ A;  2A36 A;  2QA4 A;  1T0J A;  3TSZ A;  3SDZ A;  1M8V A;  2A37 A;  2ABL A;  2MI6 A;  3SB2 A;  2OTL Q;  2VWF A;  2XU8 A;  1JRI A;  3ULR B;  2ROL A;  5KE2 A;  5GMK m;  1OZ3 A;  1E6G A;  2BE7 D;  2KBT A;  1H64 1;  4C8Q E;  2FEI A;  3VS2 A;  1NM7 A;  4UC4 A;  3JB9 I;  4XTW A;  2K4Y A;  2O01 E;  2RI2 A;  4JJD A;  2CP2 A;  1VQL T;  4M77 G;  3QWX X;  2K7A A;  1AZG B;  2E3I A;  1Z9Q A;  2P4T A;  3OYC A;  1VQ5 A;  4RTU A;  4M7A B;  3QO3 A;  1IHV A;  3OYA A;  2LX7 A;  1K73 C;  2EQU A; 
#chains in the Genus database with same CATH homology
 2R57 A;  2NLU A;  1KC8 U;  1M1K C;  5J39 A;  4D6W A;  2P0Q A;  1M1F A;  1G3W A;  4LDV A;  3OYH A;  1U1T A;  4M75 G;  4RCB A;  3GIB A;  2QQB A;  3FEO A;  4PJO E;  1FX7 A;  2CYZ B;  3QBY A;  4E7K A;  2DZC A;  3JB9 D;  5GAM f;  3OMG A;  1B34 B;  1Y96 B;  5I21 A;  3CBP A;  2DXB A;  1K73 U;  4XK8 E;  3OYY A;  4DA4 A;  1P92 A;  4MMK A;  1I5L A;  3HP9 A;  4J8O A;  2YLC A;  3L1A A;  3VKI A;  4ATO A;  4M75 B;  5CQX A;  2WSF E;  2O4X B;  3QXE B;  4F7U E;  4EPC A;  3JB9 H;  4JRK A;  5DLQ E;  3LWH A;  3OS0 A;  3FDR A;  2BUD A;  2GFA A;  4BAC A;  4C0G A;  3C94 A;  1N27 A;  3OYN A;  3QYG B;  1YJW T;  1VQ8 A;  2RB6 A;  4BY6 B;  4BB7 A;  5LJ3 g;  4PL6 A;  3ASK A;  1QW1 A;  4HCZ A;  1GXI E;  3PTA A;  4KUL A;  4EMK B;  5GAN 3;  1YJ9 T;  1YJN A;  1BI1 A;  2QA4 T;  2DXT A;  1VIF A;  4QVZ A;  4ME7 A;  4C0Z A;  3CCV A;  3QII A;  1YIJ T;  1M4Z A;  2LC4 A;  2QXF A;  1M5Q 1;  4J6Y A;  1N9R A;  2P0P A;  4O6J A;  3CBO A;  2QEX A;  4M77 A;  4NL2 A;  2M1H A;  3N5B B;  5GAN 4;  4R55 A;  4N4I A;  4RG2 A;  1Q81 C;  5AYF A;  5GAN g;  2KQW A;  2BIV A;  4J83 A;  1KHC A;  1N9S A;  1YI2 T;  2M9U A;  3P8H A;  3TRE A;  3LYI A;  4E47 A;  1RL2 A;  2K3Y A;  4JUV A;  2YHT A;  2K2V A;  4ELZ C;  3JCM e;  4PJO A;  2CKK A;  2XI9 A;  3INZ A;  2JUF A;  5LJ3 f;  1B34 A;  1Y96 A;  3HSB A;  2E70 A;  2JNG A;  2ZPB B;  3E1S A;  1Q86 C;  2LCC A;  3FJP A;  2HNI A;  4A4H A;  3CCU T;  4HCC A;  4PKC C;  3LW5 E;  4J7I A;  2CZ7 B;  5CIU A;  4M75 A;  3CCS A;  1Q81 U;  4IUU A;  3UWN A;  3CXC A;  1ZBX A;  3X25 B;  3OMC A;  4C8Q F;  2RI3 A;  1Y7X A;  5GMK i;  3CMA A;  5HY6 A;  5HK3 A;  4RMO A;  3OA6 A;  2QQA A;  2XDP A;  3BFM A;  4O5V A;  4RG8 A;  3VUZ A;  2FB7 A;  3I55 T;  4XU2 A;  4IUR A;  4OGC A;  3JSC A;  5CKF A;  5DLO A;  5GAO l;  3M57 A;  1VQ5 T;  2DIG A;  2F5K A;  2EKO A;  1QP2 A;  2D6F A;  4M7D F;  4LDW A;  1AHJ B;  3HL8 A;  1Q86 U;  3CXC S;  2F69 A;  3MEW A;  3HHT B;  4ZGJ B;  2HAX A;  4JDS A;  1VQN A;  4PLL A;  3MP1 A;  3V8L A;  2GQV A;  3HFN A;  4M77 D;  3CCM A;  3PMI A;  2G3R A;  4BI8 B;  3OY9 A;  3RES A;  4M7A C;  1NE8 A;  4MZT A;  4N0A A;  3L2U A;  4CI0 C;  4GLK A;  1UGQ B;  4NS5 A;  2RHX A;  2R5M A;  4OB2 B;  2DPP B;  5GAM e;  3CCJ A;  4PJO D;  2RHZ A;  3L2V A;  4EMH A;  3CCE A;  2P0K A;  3GLX A;  4J7F A;  3HRU A;  2KSS A;  5GAN j;  3HFO A;  2RJC A;  5GAO r;  3X24 B;  4M7D C;  3CCL A;  4FU6 A;  4FT2 A;  4E7L A;  3QJ6 A;  4M75 D;  4C92 F;  3JCM J;  2PUK B;  2X4X A;  5KE3 A;  2VV5 A;  4LDY A;  2E10 A;  3S6W A;  3JCM V;  5M9O A;  1WGS A;  3VU3 C;  5HKC A;  1S72 A;  1VQP A;  2CZ6 B;  1X75 C;  4XU1 A;  3O8V A;  4Y28 E;  5FLX E;  3MHX A;  3C12 A;  2K57 A;  3TCJ A;  2EQJ A;  5GMK h;  2VXE A;  3VUB A;  4F7U F;  1VQ8 T;  1MGQ A;  1LJO A;  1I8F A;  3A8G B;  3TEE A;  3UDC A;  3JCM W;  1PSE A;  1NJI C;  4FL6 A;  4M7A G;  2EFI A;  2LRQ A;  3QHS A;  2KVQ G;  2DEQ A;  2MWP A;  3LH0 A;  4BE1 A;  1QP3 A;  5CQY A;  2PUO B;  2DIQ A;  2X4W A;  4RKU E;  2E6N A;  3G71 T;  3CCV T;  3DKM A;  2LNV A;  3OYJ A;  2DKG A;  2CZ0 B;  3KBG A;  4A4G A;  5LJ3 d;  2QEX T;  3QKJ A;  3CCR A;  1I4K 1;  3MCA B;  4X34 A;  4C92 C;  3OYD A;  4OB3 B;  3M59 A;  4J6W A;  3JAM E;  3MP8 A;  4BUG A;  4IKF A;  4M7D G;  3V7C A;  1HK9 A;  1NJI U;  1ZQ1 A;  1Q82 C;  3HRT A;  4TVR A;  2M16 A;  2WSC E;  4JRQ A;  4IUQ A;  4ZTF A;  4KUI A;  4M77 E;  2XDB A;  3CCQ A;  3EFR A;  5LJ3 e;  2L3R A;  2RK2 A;  2IG0 A;  4JS5 A;  3NTI A;  3RKW A;  3MEV A;  1VIE A;  5C6S A;  3GPL A;  5GAN 7;  3DLM A;  3OB9 A;  2E41 A;  4LD6 A;  4V2S A;  1W4S A;  2DD4 A;  3FIF A;  4XQ3 A;  3LLR A;  4NOY A;  5GAN d;  1YCY A;  3SWN A;  1Q7Y C;  4M7D B;  2MWO A;  2XKO C;  3JRZ A;  1VQM T;  1VQO A;  4IUT A;  5CKH A;  3CMA T;  4KUD K;  4C5G A;  2OTJ A;  1Q82 U;  5CO7 A;  1G3T A;  1IZ6 A;  5LJ5 j;  3V7R A;  4C0F A;  2DJZ A;  5CCA A;  5GAO n;  2R5A A;  4L5G A;  2M0O A;  1M1K U;  1K8A C;  4M75 E;  3JB9 F;  2EYQ A;  3HPW A;  4HA8 A;  3MO8 A;  3OYM A;  3CME T;  4GY5 A;  4C92 G;  2RHU A;  3RMS A;  2RJE A;  3ZBD A;  3CPF A;  4A4E A;  2JZ2 A;  3BW1 A;  4M78 F;  1VQK A;  1VQN T;  2VC8 A;  1H3Z A;  3GF5 A;  3CCM T;  3S3N A;  1W2B S;  4BD3 A;  1WPY A;  2QI2 A;  2Y90 A;  3MET A;  1KQ1 A;  4IUV A;  4IUP A;  1OI1 A;  4JRI A;  4KBM B;  2K5I A;  3CC7 A;  4FT4 A;  5I2M A;  3PMT A;  4RCC A;  5IN1 A;  4C92 B;  5LJ5 h;  1K8A U;  2KK4 A;  3QSU A;  2FL7 A;  3URG A;  2MF2 A;  1JB0 E;  1NZ9 A;  3PT9 A;  4MZM A;  3A8H B;  4M7A A;  3QDR B;  3QJY A;  4XU0 A;  2GCX A;  2HQX A;  2Y4Y A;  1WJR A;  4C5E A;  1VQ6 A;  2DTH A;  1VQ4 T;  4VUB A;  5DY9 A;  3JCM h;  3UT1 A;  3G4S A;  1BIA A;  3S3O A;  3CCE T;  4KT0 E;  4QQG A;  3GNF B;  1OZ2 A;  3RKX A;  3LGL A;  3A8O B;  3CPW A;  3CCL T;  2XK0 A;  4OB0 B;  3OYK A;  5CKB A;  3J7A F;  2KY9 A;  3H6Z A;  3C4S A;  2FVU A;  4M78 C;  3L42 A;  5D6X A;  4M7D A;  4C0D B;  1U8R A;  1YHQ A;  2ZGW A;  4Z02 A;  2L89 A;  3BY7 A;  2RK1 A;  5FRN A;  2DTI A;  4XTX A;  2D9T A;  3CPW S;  3JCM b;  2DXC A;  1JBM A;  3M55 A;  5LL6 S;  3M58 A;  2EJG A;  3E19 A;  4NL3 A;  4N4H A;  4A4K A;  4BE0 A;  3CC2 A;  3WVD B;  3T9N A;  2X35 A;  2O4X A;  4PNO A;  2XDD A;  3L2R A;  2AHJ B;  2QQ9 A;  3V8K A;  2DXU A;  3X28 B;  1VUB A;  3RUX A;  4FSX A;  4B9W A;  4OGE A;  4OP0 A;  4QVC A;  2OAU A;  4A54 A;  3CCR T;  1FXX A;  2D0Q B;  2QQS A;  2ZPF B;  5GAN f;  4ZGE B;  3CD6 A;  3P8B B;  1X6O A;  3M56 A;  4M7A D;  5GAM h;  4MDW A;  1VQ7 A;  2L8D A;  4C92 A;  2DO3 A;  4M78 G;  3JCM c;  2PVO B;  1XTD A;  4EMK A;  5CR2 A;  4WF2 A;  2LQK A;  3CC4 A;  2RM4 A;  3UPU A;  3QUI A;  2ZPG B;  5KH6 A;  3RER A;  2PVD B;  1WNL A;  2X4Y A;  2RJF A;  2Y4X A;  1TH7 A;  2YLB A;  2K5F A;  4M77 F;  1IRE B;  4C8Q C;  4M7D D;  2E65 A;  5GAN 8;  5KCO A;  1WJQ A;  5GMK j;  2ZPH B;  3WVE B;  4M78 B;  4QQ6 A;  1WJS A;  2KDS A;  3RMQ A;  1Y07 A;  2EQK A;  5GMK l;  3JB9 J;  2QQR A;  4BDY A;  1UGP B;  1BYM A;  3DB4 A;  1BIB A;  1UGR B;  2A7Y A;  1O9S A;  4PJO F;  3J80 E;  5LJ5 g;  3M9Q A;  2LT4 A;  3QPH A;  2E6Z A;  4R56 A;  2ZZD A;  3BDU A;  3M54 A;  2FHD A;  2LQ8 A;  5GAO m;  1VQK T;  2ZPE B;  2RI5 A;  4LD9 K;  3OYF A;  3NFC A;  4M75 F;  1M90 C;  1XQH A;  3M5A A;  3JCM g;  3PIO A;  3OYG A;  4XTZ A;  5L8R E;  2RD1 A;  1WQ7 A;  5A2Q E;  5GAN 6;  4BI4 A;  1VQ9 A;  3A8L B;  2RH2 A;  2WAC A;  2EAY A;  3C95 A;  1YIJ A;  3PNW C;  4C92 D;  3LWI A;  1YJN T;  3M4G A;  3FRN A;  3VYH B;  5FU6 B;  2QTX A;  5EG2 A;  3PGG A;  3S3M A;  4C8Q G;  1U1S A;  3OS2 A;  3F70 A;  4DOV A;  4C5I A;  3L2Z A;  3QZ5 B;  3SD4 A;  4EDU A;  3KXT A;  1M90 U;  5CK9 A;  2LVM A;  5LJ5 f;  4BE2 A;  4LDU A;  3HRS A;  3QG1 A;  4MML A;  2OTL A;  4M7A E;  4JLI A;  3JCM P;  2QDY B;  3KUF A;  3EAE A;  1G3S A;  4C8Q B;  5A0L A;  4QQD A;  2VUB A;  3X20 B;  1XNI A;  3L2W A;  4M78 A;  1M1G A;  4OF1 A;  5CAI A;  4XU3 A;  1X01 A;  2JN0 A;  4E7I A;  1OYX A;  3QZ9 B;  1UEB A;  2KMT A;  3MEA A;  4M7D E;  2DZ9 A;  2VGN A;  5GAM g;  3CCS T;  3I55 A;  4XTV A;  4C0D C;  5IAY A;  3PIP A;  3I56 A;  1YBY A;  1G5V A;  2RHY A;  2ZPI B;  4A4F A;  2B8A A;  3ZFJ A;  1W2B A;  5GAN e;  3QYH B;  1NPP A;  3FC3 A;  3OYB A;  3CD6 T;  4J6X A;  5D6Y A;  3OYE A;  1WQW A;  4M77 B;  5HK0 A;  5GAO p;  4XTY A;  4JLG A;  1Q7Y U;  1DJ7 B;  1VQ7 T;  3G6E A;  2A3L A;  4ZTJ A;  4II1 A;  1KQ2 A;  2PU9 B;  2L5Q A;  3CC4 T;  2PVG B;  2ZCF B;  3R6O A;  3GOX A;  3FLG A;  4E7H A;  1JJ2 S;  1V29 B;  3AHU A;  3ER0 A;  3HKS A;  2FYK A;  2DTO A;  3CBM A;  3M53 A;  4F7U G;  4HCB A;  4PJO B;  4HT9 A;  4C92 E;  3J81 E;  2C06 A;  1BI0 A;  1N6A A;  2GF7 A;  1QVG A;  3CCJ T;  4Q5W A;  2WSE E;  4XAX B;  4FM4 B;  3E9F A;  2VXF A;  2E64 A;  2RO0 A;  3X26 B;  2VYT A;  4MZP A;  4M78 D;  2H3J A;  5A0G A;  3MP6 A;  5CKD A;  3OW2 A;  2K5L A;  2RJD A;  1Y71 A;  4C8Q A;  4F7U B;  1KG1 A;  1D3B B;  3RKY A;  3CEY A;  2EJF A;  2V8K A;  4L59 A;  4ZGD B;  4HT8 A;  1QVG S;  3NTH A;  3OSS C;  5FU7 B;  4J5Y A;  4BDZ A;  1YIT A;  2MMP A;  1S72 T;  1XOV A;  4QVD A;  1VQP T;  2RHI A;  3OW2 S;  1LOJ A;  3JCM X;  4C5H A;  2LT1 A;  5FRO A;  3OYI A;  2MAM A;  4JS4 A;  1PSF A;  5GAM j;  4EMG A;  3MEU A;  5LJ5 d;  2EIF A;  3VJP A;  1KQS A;  4LDX A;  2DK3 A;  2IVW A;  3BDL A;  5KCH A;  1VQ9 T;  1QVP A;  2XHC A;  1VQL A;  3FB9 A;  1QVF A;  3G71 A;  4DOW A;  2CS7 A;  1KHI A;  4YTL A;  3OSV A;  1UGS B;  2JTM A;  3VYG A;  3OYL A;  2LX9 A;  5A0D A;  3SFM A;  4QW2 A;  4ZN1 A;  3JCM d;  5LJ5 e;  4L6V 5;  5J26 A;  1KQS S;  3JB9 G;  3OS5 A;  1QVF S;  3DLL A;  2OTL T;  5CVI A;  5J3B A;  2RA2 A;  5FU6 C;  3A5Z B;  1RI0 A;  3SWN C;  4ZN3 A;  2LTO A;  3PFS A;  4E7J A;  1KD1 C;  3CCQ T;  4CRI A;  4C8Q D;  5GAO q;  2HBP A;  2JTF A;  3G7Z A;  1BI3 A;  4M7A F;  1K9M C;  4JRP A;  2CGH A;  3LGF A;  1VQM A;  4ELY C;  1N8R C;  3WXM B;  2R58 A;  2K3X A;  3NTK A;  4X9C A;  1BKB A;  1ZHI A;  4F7U A;  3VV0 A;  1D3B A;  5IT9 E;  1BI2 A;  2X4J A;  2EWN A;  4X9D A;  4BI3 A;  1VQO T;  2DAQ A;  1HXD A;  4M78 E;  3I56 T;  4MDX A;  2OTJ T;  2DD5 A;  2XIC A;  2XG8 D;  1KD1 U;  3GP8 A;  3CME A;  2CZ1 B;  3TU4 K;  2E12 A;  2LDM A;  1SSF A;  1LNX A;  1K9M U;  3ZEH A;  2KAF A;  4HKE A;  5GAM d;  5FRM A;  5GAN 2;  5LJ3 j;  1N8R U;  1NPR A;  4N4G A;  2HD0 A;  2E5Q A;  5CKE A;  1YJW A;  3G6E T;  1FWZ A;  2XD0 A;  4XTU A;  3P8D A;  2V8J A;  3DB3 A;  1I81 A;  2VGM A;  3OBW A;  3Q1J A;  2F5T X;  2E1H A;  2LCL A;  4OVA A;  5DM7 R;  1YJ9 A;  2JOY A;  4OMF B;  4Y91 A;  3OQ5 A;  2QA4 A;  3ME9 A;  3CC7 T;  4M77 C;  2JVV A;  2PQW A;  4DQ2 A;  3SDZ A;  4P5N A;  5C0M A;  4JJN K;  1VQ4 A;  3V7S A;  2XID A;  3SWN B;  2YRV A;  1VQ6 T;  4PLI A;  1M8V A;  5LJ3 h;  2I2L A;  2BKD N;  2MI6 A;  3SB2 A;  3G4S T;  4PJO C;  2EJ9 A;  4A53 A;  2XU8 A;  1MHN A;  1UB4 A;  1JRI A;  1M9S A;  1YI2 A;  5KE2 A;  1G3Y A;  3H8Z A;  1OZ3 A;  5GMK m;  3OS1 A;  3LX7 A;  1O75 A;  4C8Q E;  1H64 1;  1YIT T;  4M75 C;  3JCM Q;  3JCM f;  4UC4 A;  1YHQ T;  3L2Q A;  3JB9 I;  4XTW A;  3CCU A;  3V8J A;  3EFS A;  2HQE A;  3GNG A;  2K4Y A;  2O01 E;  4OB1 B;  2V8I A;  3A8M B;  5GAN h;  2RI2 A;  3RIR A;  5D6W A;  4B9X A;  3M4Y A;  5I2S A;  1KC8 C;  1VQL T;  2EQM A;  5FU7 C;  3OBY A;  1EIF A;  4M77 G;  3CC2 T;  1R8O B;  4BY6 C;  5GMK e;  2P4T A;  3OYC A;  1VQ5 A;  2GFU A;  3E9G A;  4EMK C;  4M7A B;  1JJ2 A;  3QO3 A;  4FIB A;  2DVE A;  4PJO G;  3OYA A;  4N0A C;  1K73 C;  2EQU A;  5GAN 5; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...