2LT1A

Solution nmr structure of the 72-residue n-terminal domain of myxococcus xanthus card
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
75
structure length
75
Chain Sequence
AGHMPEGSASLQLAVGDRVVYPNQGVCRVSAIDVKEVAGQKLTFVTMRREEDGAVVMVPEGKVLAIGVRKVASAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CarD protein
publication title Structure-Function Dissection of Myxococcus xanthus CarD N-Terminal Domain, a Defining Member of the CarD_CdnL_TRCF Family of RNA Polymerase Interacting Proteins.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Transcription
total genus 5
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2012-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lt1A00
2EYQA 2LT4A 2LT1A 4L5GA 4XAXB 2LQKA 4KBMB
chains in the Genus database with same CATH superfamily
4C8QA 3QJYA 1PNJA 3U23A 1X6GA 3OS1A 2X35A 1WIEA 2HZYA 2LX7A 3OS0A 4PKCC 4PJOD 1SEMA 1K1ZA 1Q81U 2P0KA 3VV0A 2PZ1A 2JVVA 4ELZC 3CXCS 3VU3C 4QQDA 4A4KA 1X01A 4RG8A 1VQOQ 1V29B 1YJ9Q 1K9MC 1LOJA 2JXBA 1FX7A 3X20B 2KROA 4PJOA 4MDXA 1D1CA 3GNGA 3UWNA 1M8MA 1SRMA 3M58A 1AOJA 3CCMA 3G4SA 3EGXB 2OTJA 1OQKA 1D3BB 3JV3A 4UC4A 5KYNA 1YIJA 1OYXA 5KYXB 3OYKA 2M0YA 3EH2A 4X1VA 1WJRA 1QCNA 2QA4Q 1JB0E 2A28A 4XTWA 4C5HA 2MPXC 4BI4A 2GFUA 1WZOA 3M0QA 5GMKl 1E6GA 1VYTA 1M9SA 2CT3A 4L5GA 3NHNA 4A4HA 1M8VA 1SSFA 1VQ9A 2NYSA 1K9AA 5LJ3g 4IIMA 2PUOB 2ZZDA 2EW3A 5GANf 3TSWA 3ME9A 2MIOA 3OBYA 2VGNA 3HFNA 1OZ3A 3CCQA 3EAEA 4J7FA 2QGFB 2EGCA 1UEBA 1MMGA 1NZ9A 3BFMA 3VKIA 1M90C 4C92G 2JMAA 2EAYA 2BKDN 3JB9G 4BY6B 4AMCA 5LJ3h 1GRIA 2HCKA 4ZN3A 3FB9A 5GAMg 1WI7A 4NL3A 1LVKA 2F1LA 2CP7A 1VQMT 2P0QA 3O8VA 1Q82R 2OAUA 1SKUB 4QQ6A 4RMOA 4XAXB 1YHQT 3UA7A 2QASA 5IHIA 1W6XA 4JJNK 4XQ3A 1M90U 2EQKA 3HFOA 1YI2T 1W70A 2VYTA 1PWTA 2KQWA 4M77B 4N4GA 1SG5A 2DX1A 2DMOA 1VQ6Q 2RA2A 2PVDB 3A1PA 3PTAA 4J9DA 4PJOB 1N9RA 2EFIA 1ZQ1A 1AD5A 1YP5A 4J9BA 4RCBA 1OOTA 3H0FA 1VQPT 1QVGS 1GCQA 1PCXA 3PVLA 4M75E 2CZ6B 3QHSA 4J8OA 1E7OA 2AK5A 2E65A 1N5ZA 1IGUA 4ZGEB 3QZ9B 1XJWB 1YN8A 1YNZA 5KCHA 2EBPA 3CCJQ 4N0AC 4JS5A 2D1XA 3VS6A 1C1AA 1JO8A 5A2QE 1AEYA 1HSQA 3R6OA 4A63B 2FYKA 2NUZA 3OS5A 4ZN1A 5KH6A 1JQQA 1ZUUA 3M0UA 1NJIC 4R55A 3RR6A 2YLCA 3PMTA 1UGPB 2PTKA 2A3LA 2J6OA 2JM9A 4OVAA 4MZMA 1X27A 2D0NA 1IGQA 2XU8A 5A0GA 4AFQC 3HPWA 1WJQA 1KIKA 4M78E 2FO0A 2HSPA 3EGDB 3EFSA 3HRUA 3ASKA 1PRLC 5J39A 3X26B 2JT4A 4LUEA 1M3BA 2C0TA 4KH1B 2YUQA 3QDRB 1VQ8T 3S3MA 2RHYA 1IRXA 2RK2A 3E1SA 1Q81R 2RJEA 4DBHA 1NJIU 4M7AE 1WA7A 4PLLA 1W2BA 2K6DA 4JRPA 1B34B 1WLPB 3G71T 5GMKe 2JN0A 2B8AA 5GAN4 1KQ2A 1WYXA 2QYZA 4JRIA 1PD0A 3EGUA 5D6XA 4AG2C 2BE7D 2RN8A 5GANj 4QQGA 2EWNA 2ED0A 1Z9ZA 1VQ7A 3FDRA 4MZTA 5D7UA 2M02A 3I55A 1I1JA 3NTIA 2HKQB 5GMKi 1TH7A 1VYVA 2DJQA 3SWNA 4Z02A 3RMSA 2V8IA 1GBQA 1JXOA 2AIRB 4RUGA 2QG9B 4BUGA 4JUVA 3CC4Q 1JU5C 3LWHA 2FL7A 2OAWA 4RTXA 2ZPBB 1D09B 1TUGB 2CH4A 1I5LA 3MP1A 1NYGA 3WVEB 1M3CA 2MWPA 2F5TX 8AT1B 4BY6C 2EPDA 3RIRA 1N6AA 2D9TA 4J9EA 2A7YA 2DZCA 3DLMA 2EQJA 4EDUA 3CCET 4K11A 5LL6S 1IHWA 5IN1A 5LJ3e 2CKKA 1VIEA 3TREA 2JOYA 1KHIA 4Z88A 3ZFJA 1I81A 5A0DA 5IHKA 1H3ZA 3MEVA 1K0SA 4OB1B 3P8DA 4HVVA 4M75G 3CMAQ 3QZ5B 3LWIA 2ESWA 2K3XA 3HRSA 1ZLMA 4C0FA 4GLKA 2QDLA 4RTUA 2QEXA 1PHTA 3CC7Q 2LTOA 4M77C 1RAHB 3CMET 3JCMQ 3FC3A 3QBYA 3SEMA 4RTTA 2YRVA 3KUFA 1T3LA 5IXBA 1M90R 4FIBA 2KE9A 3REAB 4D6WA 5GANh 3TVTA 1YCYA 4EMKA 4LD9K 2H8HA 3CCRQ 1XTDA 2EJ9A 4M77F 1M4ZA 1PG5B 1BKBA 2FG0A 5GAOr 1E6HA 4PJOF 2SRCA 4A4FA 1KFZA 2X51A 1AVZC 4PJLA 3EHQA 4HA8A 4D8KA 4BE2A 1VQ4Q 2LRQA 1M1GA 4BI3A 2DXUA 4PL6A 2DEUA 1U1TA 5AT1B 4E7IA 4M78G 4O6JA 2E12A 1QMCA 2RNAA 5FLXE 1K8AC 2KYBA 4C92D 3OYGA 1SRLA 4DOWA 2LNVA 2LQKA 3BY7A 1J3TA 5KYUA 4M7AG 1QWEA 4YTLA 2XHCA 2IIMA 1IZ6A 1C0MA 1RACB 4R0KA 1A0NB 4C0ZA 1QVPA 5LJ3f 1S72A 2JW4A 4C92A 4KBMB 3VS5A 2EKHA 4E47A 2DA9A 2HQHA 3C4SA 3RNJA 2F2XA 5CQXA 1Q7YC 1K8AU 1G3YA 2RQVA 5LJ5g 3R6NA 2JM8A 1W2BP 3H0HA 1YJNQ 2ECZA 1VQ5Q 1UG1A 4XU1A 4J9GA 3E2UA 5I22A 2NUTA 2CZ1B 4OF1A 4JJCA 5GAMf 2E5KA 3MEWA 2L89A 1VYUA 4JZ4A 2AT1B 4OB0B 3CCLA 3A98A 5FWBA 4QVDA 1NE8A 1YITA 3CEYA 3DB4A 5GAN2 1UJ0A 1NJIR 2JTEA 1JJ2S 2KK4A 2FHDA 2ZPHB 4FSXA 2CH4W 2YLBA 5GAN5 1Q7YU 4X9DA 2V26A 2OTLA 1SHFA 2SEMA 3L1AA 4DEYA 3JCMV 3OYFA 2LC4A 1YWPA 1BBZA 3CCUA 3H6ZA 2GGRA 2BTTA 2DETA 1ZHIA 1BI0A 3TQ7P 3TU4K 4F14A 1YJWQ 3C95A 3M59A 4PFPA 1EFNA 4RTVA 2HKNA 2X4JA 1QVFA 2W10A 3HTRA 2X3WD 2LQWA 1RAIB 3PIPA 1B07A 5KYWA 1Y0MA 1KG1A 3T9NA 4J9IA 4CC3A 1UHCA 4ME7A 1YBYA 1WJSA 2FPEA 2DLPA 2YSQA 2CDTA 3GOXA 5KYUB 3JRZA 4QT7A 1MMNA 1Y96B 3OYBA 5KYYB 1KQSS 2MYSA 1VQKQ 3CPWP 4JS4A 1WXUA 4OMOA 2DTIA 2M0OA 3RESA 4MZPA 1NBEB 3OB9A 4FYYB 1RI0A 3G6EA 3VYGA 5C6SA 4ZTFA 1VQLQ 1UDLA 1HXDA 1HK9A 1Q86C 4LDWA 5CKBA 3L2ZA 2ZCFB 2MAMA 2HBPA 2O9SA 5DY9A 2WSCE 2QTXA 3C0CA 5LJ3d 1N8RU 4KT0E 2NUTB 3CC2Q 2VWFA 3LH5A 3DB3A 2HEQA 1LPLA 2GQVA 5I11A 1M1KC 1P92A 5L23A 2JS2A 5GANe 5GAN3 3GP8A 5KE3A 2D0QB 2O31A 1VQOT 2H3JA 4FM4B 2DXBA 2E70A 2L3RA 1YJ9T 5CIUA 1Q86U 2QI2A 3RBBB 1MNEA 1X2QA 3P8HA 1OEBA 2VC8A 5ECAA 4CC7A 2RI3A 3THKA 4ELYC 2DD4A 5CKEA 5LJ3j 2V1QA 3QO3A 4TVRA 3X28B 3X24B 2FPDA 4DOVA 3MP6A 2E6ZA 3CCVQ 2O4XA 1M2OA 5GAOl 2QA4T 3QKJA 4Y28E 1BCOA 2KY9A 4WCIA 1I4K1 3I56Q 5KYWB 4EMGA 1BU1A 2DVJA 3CCSQ 3OMGA 2K9GA 4M75D 5GAMj 4R56A 1SF9A 4E2FB 3TSZA 2VUBA 2EKOA 2DBMA 4F7UB 4E7LA 1VQNQ 4CC4B 2LVMA 2RI5A 4J7IA 2C0OA 1UGQB 3JAME 1UECA 4M75A 1HJDA 4LDUA 2DEQA 2CP5A 4HXJA 3I5SA 2ENMA 3L42A 1K8AR 2DD5A 2RO0A 1X75C 3PT9A 2HL3A 1K9MU 3M57A 1VQMA 1KD1C 1TTHB 4OMMA 2FEIA 4EMHA 1UFFA 2QQ9A 4IURA 5L8RE 3OS2A 3CD6Q 3QWXX 1YHQA 2KGTA 3L2RA 1RI9A 2R5MA 3AHUA 1YI2A 2OJ2A 2KBTA 4M78D 4F16A 4BDYA 1Q7YR 2GBQA 2IPOB 1VQ6T 2CYZB 2L8DA 3OYCA 1QVFP 6AT1B 2DKGA 1B7TA 1I5OB 3JSCA 4DBRA 2X3XD 2RK1A 2YHTA 1VQPA 3BW1A 3ZBDA 4JJDA 4M7AD 4C8QB 1RAAB 4MDWA 1U3OA 2QQSA 1WHKA 2EGAA 4M78A 1LNXA 3OYEA 4OB2B 2FVUA 4ORZA 4FYXB 3QYGB 1Y57A 1FXXA 2O4XB 2COWA 2KI7A 5HCKA 4LE9A 5GAMh 1X69A 3QXEB 1KK7A 4M7AA 2BZYA 1QKXA 5GAOn 3M55A 3CCJT 3EFRA 1S1NA 4IIOA 2K57A 2ATCB 2E3HA 3CCMQ 1FMWA 4QW2A 3G4SQ 2OTJQ 1ZSZA 4XTZA 5KE2A 4M77E 4NS5A 2ZPFB 1YIJQ 2XKOC 3PIOA 1O9SA 4XU2A 4PJOE 2K4YA 1BIAA 4PLIA 3SB2A 2NLUA 2J06A 4HCCA 3VS3A 2BIVA 2JMCA 2EYQA 4JDSA 2EQMA 3I9QA 2EJFA 2VVKA 2CS7A 2LNHB 1VQ9Q 4KH0B 1ZUYA 2YWWA 1H3HA 2DBKA 4M7DD 4FT2A 5LJ5f 1BB9A 3EG3A 4AG1C 1LJOA 3CPWS 1N8RR 3VUBA 1F1BB 1VQ8A 2DXCA 1SSHA 3CXCA 4OGCA 3CCQQ 2XI9A 2K2VA 1OPLA 1RLQC 3O5ZA 3G71A 3LLRA 3MPUB 4M7DA 5M9OA 2DXTA 1Q86R 3JCMg 4B9WA 5GANd 3A5ZB 2C0IA 4FYWB 4V2SA 5CCAA 3M0SA 1KSWA 1NLOC 2HQXA 2DILA 2K5FA 2KRMA 5C0MA 2I2LA 4J6YA 3JCMc 2X9HA 4NOYA 3OYDA 4HT9A 3VS1A 1FMVA 4J83A 3M9QA 4CRIA 1YWOA 1B3QA 1PSEA 1W4SA 1CKAA 3JCMh 3VYHB 2FRYA 2J6KA 2ZPGB 3CC4T 2MF2A 2LP5A 3GBQA 1M3AA 5FRMA 2X4YA 5CVIA 3UPUA 2EYZA 3GPLA 2GQIA 1WXTA 5FWCA 2COZA 3PNWC 3PGGA 4N4HA 4F7UF 2RB6A 5GAOp 1K0XA 1ZSZB 2YRCA 1Y71A 2W0ZA 3CCEA 4C0GA 3EG1A 5HY6A 3KBGA 3M4GA 4HVUA 1YCSB 5EG2A 2DIQA 2MMPA 1AWJA 4E7JA 4PJMA 2KR3A 4M4ZA 2EQIA 4XU3A 3CMAT 1VA7A 2BE9B 1K9MR 3M56A 3P8BB 1IREB 3TEEA 1UUEA 2G6FX 1FMKA 3HKSA 2RJFA 4EIKA 4HKEA 3CC7T 4P5NA 3HHTB 3CMEA 5FU7B 3LH0A 2I0NA 5CR2A 1QP2A 3NGPA 2FZKB 2PU9B 1AZGB 3UF4A 1XNIA 4N4IA 5DM7R 1RL2A 1WFWA 3H9NA 3QSUA 4HVWA 4LDVA 2HAXA 4C8QC 4M7DB 4M77G 3CCRT 1HYOA 3ULRB 5IT9E 4FW1A 2HDAA 1O75A 2ABLA 1WX6A 4PJOG 3VJPA 1MHNA 2KSSA 2A37A 2L0AA 2EQUA 4C8QF 1VQ4T 2L5QA 1K4US 2LCSA 3D7SB 5IH2A 1U06A 5GAMe 2V8JA 4PJOC 2F5KA 4OMFB 1QVFS 2LT4A 2LT1A 5DLQE 1WQ7A 1KHCA 1U1SA 2R5AA 2RHIA 1RUWA 2A08A 5LJ5j 3QWYA 2GNCA 3BE3A 3MJXA 1VQ7Q 4QKUA 3HRTA 3A8GB 2NUPA 1N9SA 2HSEB 3I55Q 4OGEA 2QXFA 1MMDA 3QPHA 3CXCP 2RJDA 2X4WA 2LQNA 3SWNB 1TUDA 1IXDA 4M75F 2DRMA 3JB9D 1ZA1B 1YJNT 1VQ5T 4XTXA 4Z89A 2E4HA 2QQRA 3OYJA 5HK0A 2CP0A 1NLPC 3V8LA 4DBFA 1AWXA 4KUDK 1TU0B 4PFZA 2L3QA 2WSFE 4LDXA 3I35A 4LN2A 4XTYA 1QLYA 4OMPA 2RM4A 3NFCA 4KGXB 4KULA 3L2UA 2XK0A 3M0PA 1QWFA 4DQ2A 5CAIA 1WHJA 2LX9A 4J5YA 3OYMA 3WXMB 2EIFA 2QGGA 1RADB 4LDYA 1D0XA 4DBQA 1G83A 2QEXQ 1YJWT 2DK3A 3VS4A 1R8OB 1T0HA 2DL7A 1UB4A 3RERA 3L2QA 2DL8A 1K73C 3VS7A 3JCMe 4RTYA 3JCMb 3CBOA 2LJ1A 1D1AA 5LJ5h 4C5IA 2DZ9A 3OSVA 2KXDA 2MK5A 3EG0A 1T0JA 2KT8A 3GIBA 4C0DB 1ZSZC 4EMKB 1WDXA 1M2VA 3BDUA 1GCQC 5GMKm 2VASA 4N0AA 1UHFA 1D1BA 1GFCA 1VQKT 5DLOA 2CUDA 5GAN7 2HMAA 3L2VA 2CP6A 5EC7A 1G2BA 4C5EA 3I5RA 2EVRA 1M27C 4ATOA 2RD1A 1VQLT 4IUVA 1BI3A 2E10A 4GBQA 4IUQA 4ZTJA 1OU8A 5FU7C 4J6XA 3EFOA 3LX7A 4WTOB 4J9CA 2K2MA 4RTZA 1H8KA 2K7AA 2DM1A 4BACA 1UGRB 3CC2T 1R77A 2O01E 4FYVB 3M0RA 1S72Q 4OMNA 3FRNA 5GAOq 2JUFA 5CKHA 4C92B 2DYBA 2F2WA 1VUBA 1VQOA 4KGZB 2B86A 1X2KA 1KC8C 1YJ9A 4E7SA 1TS9A 1HD3A 4M7DF 1G5VA 3FEOA 4AFUC 3EGXA 5HK3A 1KQ1A 1X6BA 1D3BA 1BI1A 3S3NA 3S3OA 2O88A 5KYXA 4MMKA 2R57A 2XDDA 2OI3A 3JCMf 1PM3A 2A36A 4HCKA 1UTIA 4NL2A 3CCLQ 1Z9QA 4PK4A 3CCVT 2QA4A 1YITQ 1MV3A 3RKXA 4II1A 4A4GA 3I56T 1Y07A 2E6NA 3NPFA 3S6WA 4QVZA 1C6VX 3CCST 2E5QA 2OTLQ 1GXIE 2LCLA 3CCUQ 2O9VA 5GAMd 2HQEA 3WVDB 4Q5WA 2COYA 1Q81C 3SWNC 1X6OA 1VQNT 2YUNA 3CQTA 1ZSGA 4AFSC 3OYNA 1YFNA 5AYFA 2BZXA 2YDLA 1M1KU 2CSIA 4FW2A 2GF7A 3NTKA 1OX9A 3META 3SFMA 5FW9A 1GBRA 5I2SA 2QDYB 3DLLA 4M77D 1PRMC 2CP2A 3URGA 3EFOB 1V76A 1D0YA 4IUUA 3J81E 2M16A 2J05A 1JJ2A 2QQAA 2CSQA 3CD6T 2E64A 3VS2A 1TOVA 2ZAEA 3CPFA 4QVCA 1I8FA 2LMJA 5A0LA 1M30A 4M77A 2LJ0A 4LXCA 3G6EQ 1RAFB 4F04B 5GMKh 4FSSA 4F7UE 1VQ6A 1IO6A 3C12A 3H8ZA 3LYIA 5GAN6 2KEAA 4HCZA 1CSKA 1IB8A 1RABB 1FWZA 5D6WA 1QP3A 3OW2A 2EGEA 3UA6A 2PUKB 4IUTA 3OYIA 4VUBA 4AT1B 1R0BG 1AWOA 1OI1A 4CC2A 2EYXA 4C0DC 4L6V5 4EMKC 1I07A 3CBMA 1IHVA 3RUXA 5CKDA 5LJ5e 2PVGB 2DO3A 2ZPIB 1ZBJA 3QJ6A 3CCJA 1W2BS 2XDBA 2DRKA 3MKDA 2BZ8A 2KYMA 2JTMA 1OU9A 5GJWB 2E3IA 1KQSA 3JCMd 2DJZA 2P84A 2E41A 3REBB 3SHWA 2VB6A 3CCMT 3G4ST 2K5IA 1KD1U 2OTJT 5IXFA 2DPPB 3OA6A 2RHXA 4RCCA 1YIJT 4F17A 1RAEB 2GFAA 2KNBB 5FROA 3JB9I 3HSBA 1K73R 2RQUA 4C8QE 4BDZA 4OMQA 1SPKA 3EGDA 2AZVA 1LCKA 4IKFA 1VQ9T 4C92C 3V8KA 1JBMA 2NWMA 2DL3A 1ZUKA 2LCCA 4FU6A 2PNIA 2VGMA 3M5AA 3CCQT 3EG2A 3SD4A 1B34A 5CKFA 1Y7XA 3FIFA 4C92F 2RF0A 3JB9F 5J3BA 1PKSA 3L2WA 3OY9A 3RDVA 2D6FA 3OYYA 4M75B 4X9CA 1EIFA 2QAZA 1U8RA 4HT8A 2DERA 1AT1B 2KRSA 4JPBW 1U5SA 1QQJA 1VQMQ 3JB9J 2EJGA 2WACA 2GTOA 3V7SA 3QIIA 2YXYA 4CI0C 2RHUA 5CQYA 4LUDA 5IHNA 3E19A 4LD6A 1YHQQ 1BYMA 1ZBXA 3HP9A 2CUBA 4JRQA 4BE0A 1W1FA 3E9GA 1OULA 1YI2Q 2FB7A 3V7RA 2FZCB 1KC8R 3CC4A 3EH1A 4A53A 1PC0A 4ESRA 2MOXA 1WHLA 3LGLA 1OPKA 5FU6B 2KXCA 4MMLA 4E7HA 1VQPQ 3FJPA 3GLXA 4F7UG 5J26A 3J7AF 1OX8A 4BB7A 3A8LB 2DNUA 2XDPA 3M54A 4M78B 3TCJA 2EYYA 1M1KR 1JJ2P 2GTJA 4A54A 4B6MA 9ATCB 2RH2A 1RLPC 1ZX6A 2XMFA 5KCOA 2JTFA 3INZA 2G3RA 2A0FB 4E7KA 2V1RA 3CMAA 1OZ2A 4M7AB 3G1JA 2WSEE 1JEGA 1UGSB 1VOMA 2Z0WA 1TXQA 2RHZA 3CC7A 2F2VA 4JLIA 2CP3A 2RI2A 2C06A 2P4TA 3H41A 1NG2A 2KVQG 2KDSA 1GL5A 3OW2P 2V8KA 1WHMA 4EPCA 1AHJB 4XTVA 2RQTA 2AHJB 2KT1A 3EG9A 3CCRA 4AFZC 3JB9H 3NMZC 2H3EB 4FL6A 3UATA 4XK8E 2RJCA 2HBWA 5I2MA 3MEUA 1MUZA 3OYHA 1WPYA 2FRWA 4BE1A 1T3SA 3NTHA 1VQ4A 3X25B 4C8QG 2GCXA 4PJJA 1UJYA 1VQ8Q 1KQSP 4J9HA 7AT1B 3QUIA 1PKTA 2DFUA 1PD1A 2JJ9A 3VRYA 2CREA 2PQWA 4JJBA 2AKKA 2FPFA 3G71Q 1WNLA 4FT4A 2L3SA 1WXBA 4PFOA 3OMCA 4X34A 1WQWA 4LNPA 5LJ5d 4JLGA 1QVGA 3BDLA 3A8MB 2DVEA 1VQ7T 1KD1R 4ANJA 3F70A 1WGSA 2DIGA 2K3BA 4PNOA 2QQBA 4M7DE 4OB3B 3I55T 4FCYA 2MWOA 3V7CA 3MEAA 3M0TA 2QTVA 3IQLA 3GNFB 3UT1A 1H641 1M5Q1 5GANg 3VRZA 1YJNA 1VQ5A 3CPWA 2LDMA 2CZ7B 1MMAA 2L3PA 1KJWA 3GF5A 4RKUE 2K3YA 4GLMA 2MI6A 3M53A 3FLGA 2IG0A 2M51A 1MNDA 1V1CA 4M75C 1RAGB 1SHGA 3CCEQ 2J7IA 3PE0A 3J80E 4O5VA 2DYIA 1ZA2B 4KGVB 1JXMA 2VKNA 2JS0A 4ZGJB 3A8HB 3PVQA 2YT6A 4B9XA 3EG9B 2ROTA 1H92A 1D0ZA 1QCFA 5HKCA 3G7ZA 1NEBA 2DTOA 2AZSA 1R0CB 2XG8D 1TUCA 1FYNA 2HD0A 2K5LA 2QK0A 5CK9A 5GJVB 4HCBA 1YJWA 2FZGB 1ARKA 1ABOA 1TG0A 1Q95G 2QEXT 2O2OA 2DAQA 4JZ3A 3EHRA 3CMEQ 1QW1A 1ACMB 1UGVA 2AKLA 2IVWA 2VV5A 3ZL7C 1ABQA 1EZZB 3RMQA 1JRIA 4Z8AA 1M1FA 4XTUA 1OV3A 2J6FA 2ZGWA 5FU6C 2XICA 4BD3A 1G3SA 3PMIA 1G8XA 4BI8B 5GAOm 2X4XA 1BK2A 1EX4A 3N5BB 4ZGDB 1Y96A 2VXEA 3ZEHA 4M78C 5KYYA 3JCMW 2KAFA 2LQ8A 3ER0A 2Y90A 4J6WA 1VQKA 5CO7A 3OQ5A 2RQWA 2K79A 1XQHA 2JZ2A 5IAYA 4M7AC 2XD0A 2L2PA 4M78F 4KUIA 2KRNA 1TWBA 3A8OB 3OYAA 3RKWA 4DA4A 3C94A 3QYHB 3JCMP 1VQLA 3LGFA 1N27A 2Y4YA 3KFVA 5GAN8 4JRKA 3QDFA 2EYWA 2ED1A 3VS0A 2D8JA 4M7AF 1Q82C 2BUDA 2YRDA 3CC2A 2Y4XA 3CBPA 2ZPEB 1NEGA 2XIDA 1G3WA 3Q1JA 2JNGA 1WHHA 2CZ0B 1S72T 2NUPB 3MHXA 2CT4A 1NPRA 5I21A 2E1HA 1GFDA 3H0IA 4KRTA 3RKYA 2HL5C 3MCAB 2RMOA 3KXTA 2YUPA 2D8HA 1K73U 4M7DG 1AWWA 1I0CA 2P0PA 4A4EA 1MV0B 1QCOA 4C5GA 1Q82U 4RG2A 2LZ6B 3QG1A 3SDZA 1XOVA 2F69A 2LJ3A 3OW2S 3UDCA 8ATCB 1QVGP 2CGHA 4Y92A 4M7DC 3CCVA 3JCMX 1BCMA 3CCLT 1YITT 1BIBA 3M4YA 1PSFA 2YUOA 3I56A 4XU0A 4IUPA 4GY5A 1NPPA 3CCSA 2ROLA 1NYFA 2OTLT 1N8RC 2OX7A 3DKMA 2R58A 1AZEA 4F7UA 3CCUT 4C92E 2PVOB 2DE0X 1VQNA 5GMKj 4D8DA 4L59A 4PJNA 4DEXA 5D6YA 1NM7A 3HL8A 2KMTA 1GCPA 1UE9A 4E6RA 2DL5A 2VXFA 3PFSA 1TSFA 2RQRA 3LW5E 1VIFA 2MCNA 3FJ5A 2RPNA 1KC8U 3V8JA 3OYLA 1WHGA 4ZNXA 1CKBA 2M1HA 2M9UA 4WF2A 3MO8A 3OSSC 1M2VB 3AT1B 3MP8A 4RTWA 4OP0A 3CD6A 1X43A 1QKWA 4C8QD 2DF6A 3OBWA 3VUZA 2DTHA 1K76A 1MGQA 2P4RA 1BI2A 4OMLA 4Y91A 3G6ET 3E9FA 1G3TA 2DL4A 1DJ7B 5FRNA 3JCMJ 4E7ZA 4J9FA 2HNIA
chains in the Genus database with same CATH topology
4C8QA 3QJYA 1XNIA 4N4IA 5DM7R 2D6FA 3OYYA 1RL2A 4OB0B 4M75B 4X9CA 3QSUA 1EIFA 3OS1A 2X35A 1U8RA 3CCLA 4HT8A 4LDVA 2HAXA 4QVDA 1NE8A 4C8QC 3CEYA 3DB4A 5GAN2 1YITA 3OS0A 4M7DB 4PKCC 4PJOD 4M77G 3CCRT 1JJ2S 3JB9J 2KK4A 5IT9E 2FHDA 2EJGA 2ZPHB 2WACA 4FSXA 3V7SA 1O75A 2P0KA 3QIIA 3VV0A 1Q81U 2YLBA 4PJOG 2JVVA 4ELZC 4CI0C 2RHUA 5GAN5 4X9DA 3VJPA 5CQYA 1MHNA 3CXCS 3VU3C 2KSSA 2OTLA 4QQDA 3L1AA 1X01A 4RG8A 4A4KA 3E19A 4LD6A 1BYMA 2EQUA 1ZBXA 3HP9A 4JRQA 3JCMV 4C8QF 3OYFA 1V29B 2LC4A 3CCUA 4BE0A 3E9GA 2L5QA 3H6ZA 1VQ4T 1LOJA 1K9MC 1FX7A 3X20B 1ZHIA 1BI0A 2FB7A 3V7RA 3TU4K 4MDXA 4PJOA 3GNGA 3UWNA 3CC4A 3M58A 4A53A 3C95A 3CCMA 3M59A 3G4SA 5GAMe 2V8JA 4PJOC 2OTJA 1D3BB 2F5KA 4OMFB 4UC4A 1QVFS 2LT4A 2LT1A 5DLQE 2X4JA 1YIJA 1OYXA 3LGLA 3OYKA 1QVFA 1WQ7A 5FU6B 1KHCA 4MMLA 4E7HA 1U1SA 2R5AA 2RHIA 3PIPA 3FJPA 1WJRA 3GLXA 4F7UG 5J26A 5LJ5j 1KG1A 3T9NA 3J7AF 1JB0E 4ME7A 4XTWA 1YBYA 1WJSA 4BB7A 3A8LB 4C5HA 4BI4A 2XDPA 2GFUA 3HRTA 3A8GB 3M54A 4M78B 5GMKl 3GOXA 1N9SA 3TCJA 1M9SA 3JRZA 4L5GA 4A4HA 1M8VA 4A54A 1SSFA 1Y96B 1VQ9A 2RH2A 4OGEA 3OYBA 2QXFA 2JTFA 5KCOA 3INZA 2G3RA 5LJ3g 2PUOB 2ZZDA 3QPHA 1KQSS 4E7KA 3CMAA 5GANf 1OZ2A 3ME9A 4JS4A 2RJDA 2X4WA 3OBYA 2DTIA 2VGNA 2M0OA 3HFNA 4M7AB 3RESA 3SWNB 1OZ3A 4MZPA 4M75F 3CCQA 2WSEE 3EAEA 4J7FA 3OB9A 1UGSB 1RI0A 1UEBA 3VYGA 5C6SA 3G6EA 2RHZA 3CC7A 1NZ9A 3JB9D 4ZTFA 1YJNT 1VQ5T 3BFMA 3VKIA 1M90C 4XTXA 1HXDA 1HK9A 4JLIA 1Q86C 2RI2A 2QQRA 4LDWA 4C92G 3OYJA 2EAYA 2BKDN 2P4TA 2C06A 3JB9G 5CKBA 2KVQG 4BY6B 3L2ZA 5HK0A 2KDSA 2ZCFB 2V8KA 4EPCA 5LJ3h 3V8LA 2MAMA 2HBPA 4ZN3A 5DY9A 1AHJB 4KUDK 2WSCE 2QTXA 4XTVA 3FB9A 5LJ3d 5GAMg 1N8RU 4KT0E 2AHJB 2WSFE 4NL3A 4LDXA 4XTYA 3CCRA 3JB9H 2RM4A 3NFCA 4FL6A 3DB3A 4KULA 3L2UA 1VQMT 2GQVA 2P0QA 3O8VA 1M1KC 1P92A 2XK0A 4XK8E 2RJCA 5I2MA 3MEUA 2OAUA 4QQ6A 3OYHA 4RMOA 1WPYA 5GANe 5GAN3 4BE1A 4DQ2A 3GP8A 5KE3A 2D0QB 4XAXB 1VQOT 1YHQT 2H3JA 3NTHA 4FM4B 1VQ4A 2DXBA 5CAIA 3X25B 4C8QG 2E70A 2LX9A 4J5YA 2GCXA 2L3RA 3OYMA 1YJ9T 5CIUA 3WXMB 4JJNK 4XQ3A 2EIFA 1M90U 2EQKA 3HFOA 1Q86U 2QI2A 4LDYA 1YI2T 3QUIA 2VYTA 2KQWA 3P8HA 1YJWT 4M77B 4N4GA 2VC8A 2DK3A 2PQWA 2RI3A 1R8OB 2RA2A 1UB4A 2PVDB 3RERA 3PTAA 3L2QA 4PJOB 4ELYC 1WNLA 2DD4A 5CKEA 5LJ3j 4FT4A 1N9RA 3QO3A 4TVRA 1K73C 3X28B 3X24B 3JCMe 3JCMb 2EFIA 1ZQ1A 3MP6A 4DOVA 3CBOA 2E6ZA 5LJ5h 4RCBA 4C5IA 1QVGS 1VQPT 2DZ9A 3OMCA 3OSVA 4X34A 2O4XA 1WQWA 5LJ5d 5GAOl 4JLGA 1QVGA 3GIBA 2QA4T 4C0DB 3QKJA 3BDLA 3A8MB 4M75E 2DVEA 2CZ6B 4EMKB 1VQ7T 4Y28E 2KY9A 3BDUA 1I4K1 3F70A 3QHSA 4J8OA 1WGSA 2DIGA 4PNOA 2QQBA 4EMGA 5GMKm 4M7DE 2E65A 4OB3B 3I55T 4N0AA 4ZGEB 2MWOA 3OMGA 3V7CA 3QZ9B 3MEAA 4M75D 5KCHA 1VQKT 5DLOA 5GAMj 5GAN7 4R56A 4JS5A 4N0AC 3L2VA 3GNFB 2VUBA 2EKOA 3UT1A 1H641 4F7UB 4E7LA 5A2QE 1M5Q1 5GANg 4C5EA 2LVMA 1YJNA 1VQ5A 3R6OA 3CPWA 2FYKA 2RI5A 2RD1A 2LDMA 1UGQB 2CZ7B 4IUVA 4J7IA 1VQLT 4ATOA 3OS5A 4ZN1A 1BI3A 2E10A 4IUQA 5KH6A 3JAME 4ZTJA 5FU7C 4J6XA 4M75A 4LDUA 1NJIC 3LX7A 4R55A 3GF5A 2DEQA 4RKUE 3L42A 2K3YA 2DD5A 2MI6A 3M53A 2YLCA 3PMTA 1UGPB 2RO0A 1X75C 2IG0A 3FLGA 2A3LA 3PT9A 4M75C 4OVAA 4BACA 1K9MU 1UGRB 4MZMA 3M57A 3CC2T 1VQMA 1KD1C 3J80E 2O01E 4O5VA 2XU8A 5A0GA 4EMHA 3HPWA 4ZGJB 3FRNA 5GAOq 1WJQA 2JUFA 2QQ9A 3A8HB 4IURA 5CKHA 5L8RE 4M78E 4B9XA 4C92B 3OS2A 1VQOA 1VUBA 1YHQA 3EFSA 5HKCA 3G7ZA 1KC8C 1Q7YU 2DTOA 3HRUA 3ASKA 5J39A 3L2RA 1YJ9A 2R5MA 3X26B 2XG8D 3AHUA 2HD0A 2K5LA 3QDRB 1YI2A 4M7DF 1G5VA 1VQ8T 3FEOA 5CK9A 4HCBA 3S3MA 2RHYA 5HK3A 2RK2A 1KQ1A 1YJWA 3E1SA 4M78D 1D3BA 1BI1A 2QEXT 2RJEA 1NJIU 3S3NA 4M7AE 3S3OA 4BDYA 4PLLA 2DAQA 1W2BA 1QW1A 1VQ6T 2CYZB 2L8DA 3OYCA 2VV5A 2IVWA 4JRPA 4MMKA 1B34B 2R57A 2DKGA 2XDDA 3G71T 5GMKe 3JCMf 3JSCA 2JN0A 2B8AA 3RMQA 5GAN4 1KQ2A 1JRIA 1M1FA 2RK1A 4XTUA 2YHTA 1VQPA 3BW1A 3ZBDA 4JRIA 2ZGWA 4NL2A 5FU6C 4M7AD 2XICA 4C8QB 4MDWA 4BD3A 1G3SA 3CCVT 5D6XA 2QA4A 2QQSA 3PMIA 4M78A 4QQGA 3RKXA 4BI8B 1LNXA 2EWNA 5GAOm 3L2WA 2X4XA 5GANj 4II1A 1VQ7A 3FDRA 3OYEA 4MZTA 4OB2B 3N5BB 2FVUA 4ZGDB 4A4GA 1Y96A 2VXEA 3QYGB 1Y07A 3I56T 3I55A 1FXXA 2E6NA 4M78C 3ZEHA 2O4XB 3JCMW 3S6WA 2KAFA 3NTIA 2LQ8A 3ER0A 4QVZA 5GMKi 2E5QA 3CCST 1GXIE 1TH7A 5GAMh 2LCLA 3QXEB 2Y90A 4J6WA 1VQKA 5CO7A 3SWNA 4M7AA 4Z02A 3RMSA 2V8IA 3OQ5A 5GAMd 2HQEA 3WVDB 5GAOn 3CCJT 3M55A 1YITT 4Q5WA 4BUGA 1XQHA 2JZ2A 5IAYA 3EFRA 4JUVA 3SWNC 1X6OA 1Q81C 1VQNT 2XD0A 4M7AC 4M78F 2K57A 3LWHA 4KUIA 2FL7A 3A8OB 4QW2A 3RKWA 3OYAA 3C94A 3QYHB 4DA4A 3JCMP 3LGFA 1VQLA 1N27A 3OYNA 2ZPBB 2Y4YA 1I5LA 3MP1A 5GAN8 5AYFA 1M1KU 4JRKA 4XTZA 3WVEB 4M77E 5KE2A 4NS5A 2MWPA 2F5TX 2GF7A 2ZPFB 3NTKA 2XKOC 3META 3PIOA 4BY6C 1O9SA 3SFMA 4XU2A 3RIRA 5I2SA 4M7AF 1Q82C 2K4YA 2BUDA 4PJOE 1N6AA 1BIAA 2D9TA 2Y4XA 3CBPA 4PLIA 2QDYB 3SB2A 3CC2A 2ZPEB 2A7YA 2DZCA 3DLMA 2EQJA 4M77D 2NLUA 3DLLA 2XIDA 1G3WA 3URGA 4EDUA 3CCET 3Q1JA 2JNGA 4HCCA 2BIVA 5LL6S 2EYQA 4JDSA 5IN1A 4IUUA 2CKKA 2CZ0B 1VIEA 2EQMA 2JOYA 3TREA 2EJFA 1S72T 2CS7A 3MHXA 1KHIA 1NPRA 3J81E 5I21A 2E1HA 3ZFJA 1I81A 2M16A 5A0DA 1H3ZA 3MEVA 1JJ2A 2QQAA 4M7DD 4OB1B 4FT2A 3CD6T 5LJ5f 3P8DA 4M75G 2E64A 3RKYA 1LJOA 3MCAB 3CPWS 3VUBA 3QZ5B 3CPFA 4QVCA 3KXTA 1K73U 3LWIA 1I8FA 2K3XA 2DXCA 1VQ8A 3HRSA 5A0LA 3CXCA 4OGCA 4M7DG 4C0FA 4M77A 4GLKA 2P0PA 4A4EA 2XI9A 2QEXA 2K2VA 5GMKh 4F7UE 2LTOA 1VQ6A 3C12A 3H8ZA 4M77C 4C5GA 1Q82U 3CMET 3JCMQ 3FC3A 4RG2A 3G71A 3LLRA 3LYIA 3QBYA 5GAN6 4HCZA 3QG1A 4M7DA 2YRVA 5M9OA 3KUFA 1XOVA 2F69A 3SDZA 3OW2S 1FWZA 3UDCA 5D6WA 1QP3A 4FIBA 3OW2A 2DXTA 2CGHA 4D6WA 5GANh 4M7DC 3CCVA 1YCYA 3JCMg 4EMKA 3JCMX 3CCLT 4LD9K 4B9WA 2PUKB 4IUTA 5GANd 1XTDA 2EJ9A 3A5ZB 4M77F 4VUBA 1BIBA 1M4ZA 1OI1A 3M4YA 1PSFA 4V2SA 5CCAA 1BKBA 4C0DC 4L6V5 3I56A 4EMKC 4XU0A 3CBMA 4IUPA 4GY5A 5GAOr 4PJOF 3RUXA 1NPPA 5CKDA 4A4FA 5LJ5e 3CCSA 2HQXA 2K5FA 2PVGB 5C0MA 2I2LA 4HA8A 4J6YA 4NOYA 3JCMc 3OYDA 1N8RC 2OTLT 2DO3A 3DKMA 2R58A 4BE2A 2ZPIB 4HT9A 4J83A 2LRQA 3QJ6A 3M9QA 4F7UA 4CRIA 3CCUT 1M1GA 4C92E 3CCJA 1W2BS 2XDBA 3OYIA 1PSEA 4BI3A 1W4SA 2JTMA 2PVOB 2DXUA 4PL6A 3JCMh 1VQNA 3VYHB 1U1TA 5GMKj 4E7IA 1KQSA 4L59A 4M78G 3JCMd 2DJZA 2ZPGB 4O6JA 3CC4T 5D6YA 2E41A 2MF2A 2E12A 2KMTA 3HL8A 3CCMT 5FLXE 3G4ST 1K8AC 2K5IA 1KD1U 5FRMA 2X4YA 5CVIA 4C92D 2OTJT 3OYGA 2DPPB 3OA6A 3UPUA 2VXFA 2RHXA 3PFSA 3GPLA 4DOWA 2LNVA 2LQKA 4RCCA 1YIJT 3LW5E 3BY7A 3PNWC 1VIFA 3PGGA 4M7AG 4N4HA 4F7UF 2RB6A 4YTLA 5GAOp 2GFAA 2XHCA 3V8JA 5FROA 3OYLA 1KC8U 3JB9I 3HSBA 1Y71A 1IZ6A 3CCEA 4C0GA 5HY6A 4C8QE 3KBGA 4C0ZA 3M4GA 1QVPA 5LJ3f 2M1HA 4BDZA 1S72A 2M9UA 4WF2A 3MO8A 4C92A 5LJ3e 3OSSC 3MP8A 4KBMB 4OP0A 5EG2A 1VQ9T 2DIQA 4IKFA 2MMPA 3CD6A 4E7JA 4E47A 4C92C 3C4SA 3V8KA 4C8QD 4XU3A 3CMAT 5CQXA 3OBWA 1JBMA 3VUZA 1Q7YC 3M56A 1K8AU 2DTHA 1IREB 3P8BB 3TEEA 1G3YA 2LCCA 4FU6A 2VGMA 1MGQA 3HKSA 3M5AA 1BI2A 4Y91A 5LJ5g 3CCQT 2RJFA 3SD4A 3G6ET 4HKEA 3E9FA 3CC7T 4P5NA 3HHTB 4XU1A 1B34A 1G3TA 5CKFA 3CMEA 1Y7XA 3FIFA 5FU7B 3LH0A 4C92F 2CZ1B 1DJ7B 4OF1A 5CR2A 1QP2A 5FRNA 3JCMJ 5J3BA 5GAMf 3JB9F 3MEWA 2L89A 2PU9B 2HNIA 3OY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYQ A;  2LT4 A;  2LT1 A;  4L5G A;  4XAX B;  2LQK A;  4KBM B; 
#chains in the Genus database with same CATH topology
 4C8Q A;  3QJY A;  1PNJ A;  3U23 A;  1X6G A;  3OS1 A;  2X35 A;  1WIE A;  2HZY A;  2LX7 A;  3OS0 A;  4PKC C;  4PJO D;  1SEM A;  1K1Z A;  1Q81 U;  2P0K A;  3VV0 A;  2PZ1 A;  2JVV A;  4ELZ C;  3CXC S;  3VU3 C;  4QQD A;  4A4K A;  1X01 A;  4RG8 A;  1VQO Q;  1V29 B;  1YJ9 Q;  1K9M C;  1LOJ A;  2JXB A;  1FX7 A;  3X20 B;  2KRO A;  4PJO A;  4MDX A;  1D1C A;  3GNG A;  3UWN A;  1M8M A;  1SRM A;  3M58 A;  1AOJ A;  3CCM A;  3G4S A;  3EGX B;  2OTJ A;  1OQK A;  1D3B B;  3JV3 A;  4UC4 A;  5KYN A;  1YIJ A;  1OYX A;  5KYX B;  3OYK A;  2M0Y A;  3EH2 A;  4X1V A;  1WJR A;  1QCN A;  2QA4 Q;  1JB0 E;  2A28 A;  4XTW A;  4C5H A;  2MPX C;  4BI4 A;  2GFU A;  1WZO A;  3M0Q A;  5GMK l;  1E6G A;  1VYT A;  1M9S A;  2CT3 A;  4L5G A;  3NHN A;  4A4H A;  1M8V A;  1SSF A;  1VQ9 A;  2NYS A;  1K9A A;  5LJ3 g;  4IIM A;  2PUO B;  2ZZD A;  2EW3 A;  5GAN f;  3TSW A;  3ME9 A;  2MIO A;  3OBY A;  2VGN A;  3HFN A;  1OZ3 A;  3CCQ A;  3EAE A;  4J7F A;  2QGF B;  2EGC A;  1UEB A;  1MMG A;  1NZ9 A;  3BFM A;  3VKI A;  1M90 C;  4C92 G;  2JMA A;  2EAY A;  2BKD N;  3JB9 G;  4BY6 B;  4AMC A;  5LJ3 h;  1GRI A;  2HCK A;  4ZN3 A;  3FB9 A;  5GAM g;  1WI7 A;  4NL3 A;  1LVK A;  2F1L A;  2CP7 A;  1VQM T;  2P0Q A;  3O8V A;  1Q82 R;  2OAU A;  1SKU B;  4QQ6 A;  4RMO A;  4XAX B;  1YHQ T;  3UA7 A;  2QAS A;  5IHI A;  1W6X A;  4JJN K;  4XQ3 A;  1M90 U;  2EQK A;  3HFO A;  1YI2 T;  1W70 A;  2VYT A;  1PWT A;  2KQW A;  4M77 B;  4N4G A;  1SG5 A;  2DX1 A;  2DMO A;  1VQ6 Q;  2RA2 A;  2PVD B;  3A1P A;  3PTA A;  4J9D A;  4PJO B;  1N9R A;  2EFI A;  1ZQ1 A;  1AD5 A;  1YP5 A;  4J9B A;  4RCB A;  1OOT A;  3H0F A;  1VQP T;  1QVG S;  1GCQ A;  1PCX A;  3PVL A;  4M75 E;  2CZ6 B;  3QHS A;  4J8O A;  1E7O A;  2AK5 A;  2E65 A;  1N5Z A;  1IGU A;  4ZGE B;  3QZ9 B;  1XJW B;  1YN8 A;  1YNZ A;  5KCH A;  2EBP A;  3CCJ Q;  4N0A C;  4JS5 A;  2D1X A;  3VS6 A;  1C1A A;  1JO8 A;  5A2Q E;  1AEY A;  1HSQ A;  3R6O A;  4A63 B;  2FYK A;  2NUZ A;  3OS5 A;  4ZN1 A;  5KH6 A;  1JQQ A;  1ZUU A;  3M0U A;  1NJI C;  4R55 A;  3RR6 A;  2YLC A;  3PMT A;  1UGP B;  2PTK A;  2A3L A;  2J6O A;  2JM9 A;  4OVA A;  4MZM A;  1X27 A;  2D0N A;  1IGQ A;  2XU8 A;  5A0G A;  4AFQ C;  3HPW A;  1WJQ A;  1KIK A;  4M78 E;  2FO0 A;  2HSP A;  3EGD B;  3EFS A;  3HRU A;  3ASK A;  1PRL C;  5J39 A;  3X26 B;  2JT4 A;  4LUE A;  1M3B A;  2C0T A;  4KH1 B;  2YUQ A;  3QDR B;  1VQ8 T;  3S3M A;  2RHY A;  1IRX A;  2RK2 A;  3E1S A;  1Q81 R;  2RJE A;  4DBH A;  1NJI U;  4M7A E;  1WA7 A;  4PLL A;  1W2B A;  2K6D A;  4JRP A;  1B34 B;  1WLP B;  3G71 T;  5GMK e;  2JN0 A;  2B8A A;  5GAN 4;  1KQ2 A;  1WYX A;  2QYZ A;  4JRI A;  1PD0 A;  3EGU A;  5D6X A;  4AG2 C;  2BE7 D;  2RN8 A;  5GAN j;  4QQG A;  2EWN A;  2ED0 A;  1Z9Z A;  1VQ7 A;  3FDR A;  4MZT A;  5D7U A;  2M02 A;  3I55 A;  1I1J A;  3NTI A;  2HKQ B;  5GMK i;  1TH7 A;  1VYV A;  2DJQ A;  3SWN A;  4Z02 A;  3RMS A;  2V8I A;  1GBQ A;  1JXO A;  2AIR B;  4RUG A;  2QG9 B;  4BUG A;  4JUV A;  3CC4 Q;  1JU5 C;  3LWH A;  2FL7 A;  2OAW A;  4RTX A;  2ZPB B;  1D09 B;  1TUG B;  2CH4 A;  1I5L A;  3MP1 A;  1NYG A;  3WVE B;  1M3C A;  2MWP A;  2F5T X;  8AT1 B;  4BY6 C;  2EPD A;  3RIR A;  1N6A A;  2D9T A;  4J9E A;  2A7Y A;  2DZC A;  3DLM A;  2EQJ A;  4EDU A;  3CCE T;  4K11 A;  5LL6 S;  1IHW A;  5IN1 A;  5LJ3 e;  2CKK A;  1VIE A;  3TRE A;  2JOY A;  1KHI A;  4Z88 A;  3ZFJ A;  1I81 A;  5A0D A;  5IHK A;  1H3Z A;  3MEV A;  1K0S A;  4OB1 B;  3P8D A;  4HVV A;  4M75 G;  3CMA Q;  3QZ5 B;  3LWI A;  2ESW A;  2K3X A;  3HRS A;  1ZLM A;  4C0F A;  4GLK A;  2QDL A;  4RTU A;  2QEX A;  1PHT A;  3CC7 Q;  2LTO A;  4M77 C;  1RAH B;  3CME T;  3JCM Q;  3FC3 A;  3QBY A;  3SEM A;  4RTT A;  2YRV A;  3KUF A;  1T3L A;  5IXB A;  1M90 R;  4FIB A;  2KE9 A;  3REA B;  4D6W A;  5GAN h;  3TVT A;  1YCY A;  4EMK A;  4LD9 K;  2H8H A;  3CCR Q;  1XTD A;  2EJ9 A;  4M77 F;  1M4Z A;  1PG5 B;  1BKB A;  2FG0 A;  5GAO r;  1E6H A;  4PJO F;  2SRC A;  4A4F A;  1KFZ A;  2X51 A;  1AVZ C;  4PJL A;  3EHQ A;  4HA8 A;  4D8K A;  4BE2 A;  1VQ4 Q;  2LRQ A;  1M1G A;  4BI3 A;  2DXU A;  4PL6 A;  2DEU A;  1U1T A;  5AT1 B;  4E7I A;  4M78 G;  4O6J A;  2E12 A;  1QMC A;  2RNA A;  5FLX E;  1K8A C;  2KYB A;  4C92 D;  3OYG A;  1SRL A;  4DOW A;  2LNV A;  2LQK A;  3BY7 A;  1J3T A;  5KYU A;  4M7A G;  1QWE A;  4YTL A;  2XHC A;  2IIM A;  1IZ6 A;  1C0M A;  1RAC B;  4R0K A;  1A0N B;  4C0Z A;  1QVP A;  5LJ3 f;  1S72 A;  2JW4 A;  4C92 A;  4KBM B;  3VS5 A;  2EKH A;  4E47 A;  2DA9 A;  2HQH A;  3C4S A;  3RNJ A;  2F2X A;  5CQX A;  1Q7Y C;  1K8A U;  1G3Y A;  2RQV A;  5LJ5 g;  3R6N A;  2JM8 A;  1W2B P;  3H0H A;  1YJN Q;  2ECZ A;  1VQ5 Q;  1UG1 A;  4XU1 A;  4J9G A;  3E2U A;  5I22 A;  2NUT A;  2CZ1 B;  4OF1 A;  4JJC A;  5GAM f;  2E5K A;  3MEW A;  2L89 A;  1VYU A;  4JZ4 A;  2AT1 B;  4OB0 B;  3CCL A;  3A98 A;  5FWB A;  4QVD A;  1NE8 A;  1YIT A;  3CEY A;  3DB4 A;  5GAN 2;  1UJ0 A;  1NJI R;  2JTE A;  1JJ2 S;  2KK4 A;  2FHD A;  2ZPH B;  4FSX A;  2CH4 W;  2YLB A;  5GAN 5;  1Q7Y U;  4X9D A;  2V26 A;  2OTL A;  1SHF A;  2SEM A;  3L1A A;  4DEY A;  3JCM V;  3OYF A;  2LC4 A;  1YWP A;  1BBZ A;  3CCU A;  3H6Z A;  2GGR A;  2BTT A;  2DET A;  1ZHI A;  1BI0 A;  3TQ7 P;  3TU4 K;  4F14 A;  1YJW Q;  3C95 A;  3M59 A;  4PFP A;  1EFN A;  4RTV A;  2HKN A;  2X4J A;  1QVF A;  2W10 A;  3HTR A;  2X3W D;  2LQW A;  1RAI B;  3PIP A;  1B07 A;  5KYW A;  1Y0M A;  1KG1 A;  3T9N A;  4J9I A;  4CC3 A;  1UHC A;  4ME7 A;  1YBY A;  1WJS A;  2FPE A;  2DLP A;  2YSQ A;  2CDT A;  3GOX A;  5KYU B;  3JRZ A;  4QT7 A;  1MMN A;  1Y96 B;  3OYB A;  5KYY B;  1KQS S;  2MYS A;  1VQK Q;  3CPW P;  4JS4 A;  1WXU A;  4OMO A;  2DTI A;  2M0O A;  3RES A;  4MZP A;  1NBE B;  3OB9 A;  4FYY B;  1RI0 A;  3G6E A;  3VYG A;  5C6S A;  4ZTF A;  1VQL Q;  1UDL A;  1HXD A;  1HK9 A;  1Q86 C;  4LDW A;  5CKB A;  3L2Z A;  2ZCF B;  2MAM A;  2HBP A;  2O9S A;  5DY9 A;  2WSC E;  2QTX A;  3C0C A;  5LJ3 d;  1N8R U;  4KT0 E;  2NUT B;  3CC2 Q;  2VWF A;  3LH5 A;  3DB3 A;  2HEQ A;  1LPL A;  2GQV A;  5I11 A;  1M1K C;  1P92 A;  5L23 A;  2JS2 A;  5GAN e;  5GAN 3;  3GP8 A;  5KE3 A;  2D0Q B;  2O31 A;  1VQO T;  2H3J A;  4FM4 B;  2DXB A;  2E70 A;  2L3R A;  1YJ9 T;  5CIU A;  1Q86 U;  2QI2 A;  3RBB B;  1MNE A;  1X2Q A;  3P8H A;  1OEB A;  2VC8 A;  5ECA A;  4CC7 A;  2RI3 A;  3THK A;  4ELY C;  2DD4 A;  5CKE A;  5LJ3 j;  2V1Q A;  3QO3 A;  4TVR A;  3X28 B;  3X24 B;  2FPD A;  4DOV A;  3MP6 A;  2E6Z A;  3CCV Q;  2O4X A;  1M2O A;  5GAO l;  2QA4 T;  3QKJ A;  4Y28 E;  1BCO A;  2KY9 A;  4WCI A;  1I4K 1;  3I56 Q;  5KYW B;  4EMG A;  1BU1 A;  2DVJ A;  3CCS Q;  3OMG A;  2K9G A;  4M75 D;  5GAM j;  4R56 A;  1SF9 A;  4E2F B;  3TSZ A;  2VUB A;  2EKO A;  2DBM A;  4F7U B;  4E7L A;  1VQN Q;  4CC4 B;  2LVM A;  2RI5 A;  4J7I A;  2C0O A;  1UGQ B;  3JAM E;  1UEC A;  4M75 A;  1HJD A;  4LDU A;  2DEQ A;  2CP5 A;  4HXJ A;  3I5S A;  2ENM A;  3L42 A;  1K8A R;  2DD5 A;  2RO0 A;  1X75 C;  3PT9 A;  2HL3 A;  1K9M U;  3M57 A;  1VQM A;  1KD1 C;  1TTH B;  4OMM A;  2FEI A;  4EMH A;  1UFF A;  2QQ9 A;  4IUR A;  5L8R E;  3OS2 A;  3CD6 Q;  3QWX X;  1YHQ A;  2KGT A;  3L2R A;  1RI9 A;  2R5M A;  3AHU A;  1YI2 A;  2OJ2 A;  2KBT A;  4M78 D;  4F16 A;  4BDY A;  1Q7Y R;  2GBQ A;  2IPO B;  1VQ6 T;  2CYZ B;  2L8D A;  3OYC A;  1QVF P;  6AT1 B;  2DKG A;  1B7T A;  1I5O B;  3JSC A;  4DBR A;  2X3X D;  2RK1 A;  2YHT A;  1VQP A;  3BW1 A;  3ZBD A;  4JJD A;  4M7A D;  4C8Q B;  1RAA B;  4MDW A;  1U3O A;  2QQS A;  1WHK A;  2EGA A;  4M78 A;  1LNX A;  3OYE A;  4OB2 B;  2FVU A;  4ORZ A;  4FYX B;  3QYG B;  1Y57 A;  1FXX A;  2O4X B;  2COW A;  2KI7 A;  5HCK A;  4LE9 A;  5GAM h;  1X69 A;  3QXE B;  1KK7 A;  4M7A A;  2BZY A;  1QKX A;  5GAO n;  3M55 A;  3CCJ T;  3EFR A;  1S1N A;  4IIO A;  2K57 A;  2ATC B;  2E3H A;  3CCM Q;  1FMW A;  4QW2 A;  3G4S Q;  2OTJ Q;  1ZSZ A;  4XTZ A;  5KE2 A;  4M77 E;  4NS5 A;  2ZPF B;  1YIJ Q;  2XKO C;  3PIO A;  1O9S A;  4XU2 A;  4PJO E;  2K4Y A;  1BIA A;  4PLI A;  3SB2 A;  2NLU A;  2J06 A;  4HCC A;  3VS3 A;  2BIV A;  2JMC A;  2EYQ A;  4JDS A;  2EQM A;  3I9Q A;  2EJF A;  2VVK A;  2CS7 A;  2LNH B;  1VQ9 Q;  4KH0 B;  1ZUY A;  2YWW A;  1H3H A;  2DBK A;  4M7D D;  4FT2 A;  5LJ5 f;  1BB9 A;  3EG3 A;  4AG1 C;  1LJO A;  3CPW S;  1N8R R;  3VUB A;  1F1B B;  1VQ8 A;  2DXC A;  1SSH A;  3CXC A;  4OGC A;  3CCQ Q;  2XI9 A;  2K2V A;  1OPL A;  1RLQ C;  3O5Z A;  3G71 A;  3LLR A;  3MPU B;  4M7D A;  5M9O A;  2DXT A;  1Q86 R;  3JCM g;  4B9W A;  5GAN d;  3A5Z B;  2C0I A;  4FYW B;  4V2S A;  5CCA A;  3M0S A;  1KSW A;  1NLO C;  2HQX A;  2DIL A;  2K5F A;  2KRM A;  5C0M A;  2I2L A;  4J6Y A;  3JCM c;  2X9H A;  4NOY A;  3OYD A;  4HT9 A;  3VS1 A;  1FMV A;  4J83 A;  3M9Q A;  4CRI A;  1YWO A;  1B3Q A;  1PSE A;  1W4S A;  1CKA A;  3JCM h;  3VYH B;  2FRY A;  2J6K A;  2ZPG B;  3CC4 T;  2MF2 A;  2LP5 A;  3GBQ A;  1M3A A;  5FRM A;  2X4Y A;  5CVI A;  3UPU A;  2EYZ A;  3GPL A;  2GQI A;  1WXT A;  5FWC A;  2COZ A;  3PNW C;  3PGG A;  4N4H A;  4F7U F;  2RB6 A;  5GAO p;  1K0X A;  1ZSZ B;  2YRC A;  1Y71 A;  2W0Z A;  3CCE A;  4C0G A;  3EG1 A;  5HY6 A;  3KBG A;  3M4G A;  4HVU A;  1YCS B;  5EG2 A;  2DIQ A;  2MMP A;  1AWJ A;  4E7J A;  4PJM A;  2KR3 A;  4M4Z A;  2EQI A;  4XU3 A;  3CMA T;  1VA7 A;  2BE9 B;  1K9M R;  3M56 A;  3P8B B;  1IRE B;  3TEE A;  1UUE A;  2G6F X;  1FMK A;  3HKS A;  2RJF A;  4EIK A;  4HKE A;  3CC7 T;  4P5N A;  3HHT B;  3CME A;  5FU7 B;  3LH0 A;  2I0N A;  5CR2 A;  1QP2 A;  3NGP A;  2FZK B;  2PU9 B;  1AZG B;  3UF4 A;  1XNI A;  4N4I A;  5DM7 R;  1RL2 A;  1WFW A;  3H9N A;  3QSU A;  4HVW A;  4LDV A;  2HAX A;  4C8Q C;  4M7D B;  4M77 G;  3CCR T;  1HYO A;  3ULR B;  5IT9 E;  4FW1 A;  2HDA A;  1O75 A;  2ABL A;  1WX6 A;  4PJO G;  3VJP A;  1MHN A;  2KSS A;  2A37 A;  2L0A A;  2EQU A;  4C8Q F;  1VQ4 T;  2L5Q A;  1K4U S;  2LCS A;  3D7S B;  5IH2 A;  1U06 A;  5GAM e;  2V8J A;  4PJO C;  2F5K A;  4OMF B;  1QVF S;  2LT4 A;  2LT1 A;  5DLQ E;  1WQ7 A;  1KHC A;  1U1S A;  2R5A A;  2RHI A;  1RUW A;  2A08 A;  5LJ5 j;  3QWY A;  2GNC A;  3BE3 A;  3MJX A;  1VQ7 Q;  4QKU A;  3HRT A;  3A8G B;  2NUP A;  1N9S A;  2HSE B;  3I55 Q;  4OGE A;  2QXF A;  1MMD A;  3QPH A;  3CXC P;  2RJD A;  2X4W A;  2LQN A;  3SWN B;  1TUD A;  1IXD A;  4M75 F;  2DRM A;  3JB9 D;  1ZA1 B;  1YJN T;  1VQ5 T;  4XTX A;  4Z89 A;  2E4H A;  2QQR A;  3OYJ A;  5HK0 A;  2CP0 A;  1NLP C;  3V8L A;  4DBF A;  1AWX A;  4KUD K;  1TU0 B;  4PFZ A;  2L3Q A;  2WSF E;  4LDX A;  3I35 A;  4LN2 A;  4XTY A;  1QLY A;  4OMP A;  2RM4 A;  3NFC A;  4KGX B;  4KUL A;  3L2U A;  2XK0 A;  3M0P A;  1QWF A;  4DQ2 A;  5CAI A;  1WHJ A;  2LX9 A;  4J5Y A;  3OYM A;  3WXM B;  2EIF A;  2QGG A;  1RAD B;  4LDY A;  1D0X A;  4DBQ A;  1G83 A;  2QEX Q;  1YJW T;  2DK3 A;  3VS4 A;  1R8O B;  1T0H A;  2DL7 A;  1UB4 A;  3RER A;  3L2Q A;  2DL8 A;  1K73 C;  3VS7 A;  3JCM e;  4RTY A;  3JCM b;  3CBO A;  2LJ1 A;  1D1A A;  5LJ5 h;  4C5I A;  2DZ9 A;  3OSV A;  2KXD A;  2MK5 A;  3EG0 A;  1T0J A;  2KT8 A;  3GIB A;  4C0D B;  1ZSZ C;  4EMK B;  1WDX A;  1M2V A;  3BDU A;  1GCQ C;  5GMK m;  2VAS A;  4N0A A;  1UHF A;  1D1B A;  1GFC A;  1VQK T;  5DLO A;  2CUD A;  5GAN 7;  2HMA A;  3L2V A;  2CP6 A;  5EC7 A;  1G2B A;  4C5E A;  3I5R A;  2EVR A;  1M27 C;  4ATO A;  2RD1 A;  1VQL T;  4IUV A;  1BI3 A;  2E10 A;  4GBQ A;  4IUQ A;  4ZTJ A;  1OU8 A;  5FU7 C;  4J6X A;  3EFO A;  3LX7 A;  4WTO B;  4J9C A;  2K2M A;  4RTZ A;  1H8K A;  2K7A A;  2DM1 A;  4BAC A;  1UGR B;  3CC2 T;  1R77 A;  2O01 E;  4FYV B;  3M0R A;  1S72 Q;  4OMN A;  3FRN A;  5GAO q;  2JUF A;  5CKH A;  4C92 B;  2DYB A;  2F2W A;  1VUB A;  1VQO A;  4KGZ B;  2B86 A;  1X2K A;  1KC8 C;  1YJ9 A;  4E7S A;  1TS9 A;  1HD3 A;  4M7D F;  1G5V A;  3FEO A;  4AFU C;  3EGX A;  5HK3 A;  1KQ1 A;  1X6B A;  1D3B A;  1BI1 A;  3S3N A;  3S3O A;  2O88 A;  5KYX A;  4MMK A;  2R57 A;  2XDD A;  2OI3 A;  3JCM f;  1PM3 A;  2A36 A;  4HCK A;  1UTI A;  4NL2 A;  3CCL Q;  1Z9Q A;  4PK4 A;  3CCV T;  2QA4 A;  1YIT Q;  1MV3 A;  3RKX A;  4II1 A;  4A4G A;  3I56 T;  1Y07 A;  2E6N A;  3NPF A;  3S6W A;  4QVZ A;  1C6V X;  3CCS T;  2E5Q A;  2OTL Q;  1GXI E;  2LCL A;  3CCU Q;  2O9V A;  5GAM d;  2HQE A;  3WVD B;  4Q5W A;  2COY A;  1Q81 C;  3SWN C;  1X6O A;  1VQN T;  2YUN A;  3CQT A;  1ZSG A;  4AFS C;  3OYN A;  1YFN A;  5AYF A;  2BZX A;  2YDL A;  1M1K U;  2CSI A;  4FW2 A;  2GF7 A;  3NTK A;  1OX9 A;  3MET A;  3SFM A;  5FW9 A;  1GBR A;  5I2S A;  2QDY B;  3DLL A;  4M77 D;  1PRM C;  2CP2 A;  3URG A;  3EFO B;  1V76 A;  1D0Y A;  4IUU A;  3J81 E;  2M16 A;  2J05 A;  1JJ2 A;  2QQA A;  2CSQ A;  3CD6 T;  2E64 A;  3VS2 A;  1TOV A;  2ZAE A;  3CPF A;  4QVC A;  1I8F A;  2LMJ A;  5A0L A;  1M30 A;  4M77 A;  2LJ0 A;  4LXC A;  3G6E Q;  1RAF B;  4F04 B;  5GMK h;  4FSS A;  4F7U E;  1VQ6 A;  1IO6 A;  3C12 A;  3H8Z A;  3LYI A;  5GAN 6;  2KEA A;  4HCZ A;  1CSK A;  1IB8 A;  1RAB B;  1FWZ A;  5D6W A;  1QP3 A;  3OW2 A;  2EGE A;  3UA6 A;  2PUK B;  4IUT A;  3OYI A;  4VUB A;  4AT1 B;  1R0B G;  1AWO A;  1OI1 A;  4CC2 A;  2EYX A;  4C0D C;  4L6V 5;  4EMK C;  1I07 A;  3CBM A;  1IHV A;  3RUX A;  5CKD A;  5LJ5 e;  2PVG B;  2DO3 A;  2ZPI B;  1ZBJ A;  3QJ6 A;  3CCJ A;  1W2B S;  2XDB A;  2DRK A;  3MKD A;  2BZ8 A;  2KYM A;  2JTM A;  1OU9 A;  5GJW B;  2E3I A;  1KQS A;  3JCM d;  2DJZ A;  2P84 A;  2E41 A;  3REB B;  3SHW A;  2VB6 A;  3CCM T;  3G4S T;  2K5I A;  1KD1 U;  2OTJ T;  5IXF A;  2DPP B;  3OA6 A;  2RHX A;  4RCC A;  1YIJ T;  4F17 A;  1RAE B;  2GFA A;  2KNB B;  5FRO A;  3JB9 I;  3HSB A;  1K73 R;  2RQU A;  4C8Q E;  4BDZ A;  4OMQ A;  1SPK A;  3EGD A;  2AZV A;  1LCK A;  4IKF A;  1VQ9 T;  4C92 C;  3V8K A;  1JBM A;  2NWM A;  2DL3 A;  1ZUK A;  2LCC A;  4FU6 A;  2PNI A;  2VGM A;  3M5A A;  3CCQ T;  3EG2 A;  3SD4 A;  1B34 A;  5CKF A;  1Y7X A;  3FIF A;  4C92 F;  2RF0 A;  3JB9 F;  5J3B A;  1PKS A;  3L2W A;  3OY9 A;  3RDV A;  2D6F A;  3OYY A;  4M75 B;  4X9C A;  1EIF A;  2QAZ A;  1U8R A;  4HT8 A;  2DER A;  1AT1 B;  2KRS A;  4JPB W;  1U5S A;  1QQJ A;  1VQM Q;  3JB9 J;  2EJG A;  2WAC A;  2GTO A;  3V7S A;  3QII A;  2YXY A;  4CI0 C;  2RHU A;  5CQY A;  4LUD A;  5IHN A;  3E19 A;  4LD6 A;  1YHQ Q;  1BYM A;  1ZBX A;  3HP9 A;  2CUB A;  4JRQ A;  4BE0 A;  1W1F A;  3E9G A;  1OUL A;  1YI2 Q;  2FB7 A;  3V7R A;  2FZC B;  1KC8 R;  3CC4 A;  3EH1 A;  4A53 A;  1PC0 A;  4ESR A;  2MOX A;  1WHL A;  3LGL A;  1OPK A;  5FU6 B;  2KXC A;  4MML A;  4E7H A;  1VQP Q;  3FJP A;  3GLX A;  4F7U G;  5J26 A;  3J7A F;  1OX8 A;  4BB7 A;  3A8L B;  2DNU A;  2XDP A;  3M54 A;  4M78 B;  3TCJ A;  2EYY A;  1M1K R;  1JJ2 P;  2GTJ A;  4A54 A;  4B6M A;  9ATC B;  2RH2 A;  1RLP C;  1ZX6 A;  2XMF A;  5KCO A;  2JTF A;  3INZ A;  2G3R A;  2A0F B;  4E7K A;  2V1R A;  3CMA A;  1OZ2 A;  4M7A B;  3G1J A;  2WSE E;  1JEG A;  1UGS B;  1VOM A;  2Z0W A;  1TXQ A;  2RHZ A;  3CC7 A;  2F2V A;  4JLI A;  2CP3 A;  2RI2 A;  2C06 A;  2P4T A;  3H41 A;  1NG2 A;  2KVQ G;  2KDS A;  1GL5 A;  3OW2 P;  2V8K A;  1WHM A;  4EPC A;  1AHJ B;  4XTV A;  2RQT A;  2AHJ B;  2KT1 A;  3EG9 A;  3CCR A;  4AFZ C;  3JB9 H;  3NMZ C;  2H3E B;  4FL6 A;  3UAT A;  4XK8 E;  2RJC A;  2HBW A;  5I2M A;  3MEU A;  1MUZ A;  3OYH A;  1WPY A;  2FRW A;  4BE1 A;  1T3S A;  3NTH A;  1VQ4 A;  3X25 B;  4C8Q G;  2GCX A;  4PJJ A;  1UJY A;  1VQ8 Q;  1KQS P;  4J9H A;  7AT1 B;  3QUI A;  1PKT A;  2DFU A;  1PD1 A;  2JJ9 A;  3VRY A;  2CRE A;  2PQW A;  4JJB A;  2AKK A;  2FPF A;  3G71 Q;  1WNL A;  4FT4 A;  2L3S A;  1WXB A;  4PFO A;  3OMC A;  4X34 A;  1WQW A;  4LNP A;  5LJ5 d;  4JLG A;  1QVG A;  3BDL A;  3A8M B;  2DVE A;  1VQ7 T;  1KD1 R;  4ANJ A;  3F70 A;  1WGS A;  2DIG A;  2K3B A;  4PNO A;  2QQB A;  4M7D E;  4OB3 B;  3I55 T;  4FCY A;  2MWO A;  3V7C A;  3MEA A;  3M0T A;  2QTV A;  3IQL A;  3GNF B;  3UT1 A;  1H64 1;  1M5Q 1;  5GAN g;  3VRZ A;  1YJN A;  1VQ5 A;  3CPW A;  2LDM A;  2CZ7 B;  1MMA A;  2L3P A;  1KJW A;  3GF5 A;  4RKU E;  2K3Y A;  4GLM A;  2MI6 A;  3M53 A;  3FLG A;  2IG0 A;  2M51 A;  1MND A;  1V1C A;  4M75 C;  1RAG B;  1SHG A;  3CCE Q;  2J7I A;  3PE0 A;  3J80 E;  4O5V A;  2DYI A;  1ZA2 B;  4KGV B;  1JXM A;  2VKN A;  2JS0 A;  4ZGJ B;  3A8H B;  3PVQ A;  2YT6 A;  4B9X A;  3EG9 B;  2ROT A;  1H92 A;  1D0Z A;  1QCF A;  5HKC A;  3G7Z A;  1NEB A;  2DTO A;  2AZS A;  1R0C B;  2XG8 D;  1TUC A;  1FYN A;  2HD0 A;  2K5L A;  2QK0 A;  5CK9 A;  5GJV B;  4HCB A;  1YJW A;  2FZG B;  1ARK A;  1ABO A;  1TG0 A;  1Q95 G;  2QEX T;  2O2O A;  2DAQ A;  4JZ3 A;  3EHR A;  3CME Q;  1QW1 A;  1ACM B;  1UGV A;  2AKL A;  2IVW A;  2VV5 A;  3ZL7 C;  1ABQ A;  1EZZ B;  3RMQ A;  1JRI A;  4Z8A A;  1M1F A;  4XTU A;  1OV3 A;  2J6F A;  2ZGW A;  5FU6 C;  2XIC A;  4BD3 A;  1G3S A;  3PMI A;  1G8X A;  4BI8 B;  5GAO m;  2X4X A;  1BK2 A;  1EX4 A;  3N5B B;  4ZGD B;  1Y96 A;  2VXE A;  3ZEH A;  4M78 C;  5KYY A;  3JCM W;  2KAF A;  2LQ8 A;  3ER0 A;  2Y90 A;  4J6W A;  1VQK A;  5CO7 A;  3OQ5 A;  2RQW A;  2K79 A;  1XQH A;  2JZ2 A;  5IAY A;  4M7A C;  2XD0 A;  2L2P A;  4M78 F;  4KUI A;  2KRN A;  1TWB A;  3A8O B;  3OYA A;  3RKW A;  4DA4 A;  3C94 A;  3QYH B;  3JCM P;  1VQL A;  3LGF A;  1N27 A;  2Y4Y A;  3KFV A;  5GAN 8;  4JRK A;  3QDF A;  2EYW A;  2ED1 A;  3VS0 A;  2D8J A;  4M7A F;  1Q82 C;  2BUD A;  2YRD A;  3CC2 A;  2Y4X A;  3CBP A;  2ZPE B;  1NEG A;  2XID A;  1G3W A;  3Q1J A;  2JNG A;  1WHH A;  2CZ0 B;  1S72 T;  2NUP B;  3MHX A;  2CT4 A;  1NPR A;  5I21 A;  2E1H A;  1GFD A;  3H0I A;  4KRT A;  3RKY A;  2HL5 C;  3MCA B;  2RMO A;  3KXT A;  2YUP A;  2D8H A;  1K73 U;  4M7D G;  1AWW A;  1I0C A;  2P0P A;  4A4E A;  1MV0 B;  1QCO A;  4C5G A;  1Q82 U;  4RG2 A;  2LZ6 B;  3QG1 A;  3SDZ A;  1XOV A;  2F69 A;  2LJ3 A;  3OW2 S;  3UDC A;  8ATC B;  1QVG P;  2CGH A;  4Y92 A;  4M7D C;  3CCV A;  3JCM X;  1BCM A;  3CCL T;  1YIT T;  1BIB A;  3M4Y A;  1PSF A;  2YUO A;  3I56 A;  4XU0 A;  4IUP A;  4GY5 A;  1NPP A;  3CCS A;  2ROL A;  1NYF A;  2OTL T;  1N8R C;  2OX7 A;  3DKM A;  2R58 A;  1AZE A;  4F7U A;  3CCU T;  4C92 E;  2PVO B;  2DE0 X;  1VQN A;  5GMK j;  4D8D A;  4L59 A;  4PJN A;  4DEX A;  5D6Y A;  1NM7 A;  3HL8 A;  2KMT A;  1GCP A;  1UE9 A;  4E6R A;  2DL5 A;  2VXF A;  3PFS A;  1TSF A;  2RQR A;  3LW5 E;  1VIF A;  2MCN A;  3FJ5 A;  2RPN A;  1KC8 U;  3V8J A;  3OYL A;  1WHG A;  4ZNX A;  1CKB A;  2M1H A;  2M9U A;  4WF2 A;  3MO8 A;  3OSS C;  1M2V B;  3AT1 B;  3MP8 A;  4RTW A;  4OP0 A;  3CD6 A;  1X43 A;  1QKW A;  4C8Q D;  2DF6 A;  3OBW A;  3VUZ A;  2DTH A;  1K76 A;  1MGQ A;  2P4R A;  1BI2 A;  4OML A;  4Y91 A;  3G6E T;  3E9F A;  1G3T A;  2DL4 A;  1DJ7 B;  5FRN A;  3JCM J;  4E7Z A;  4J9F A;  2HNI A; 
#chains in the Genus database with same CATH homology
 4C8Q A;  3QJY A;  1XNI A;  4N4I A;  5DM7 R;  2D6F A;  3OYY A;  1RL2 A;  4OB0 B;  4M75 B;  4X9C A;  3QSU A;  1EIF A;  3OS1 A;  2X35 A;  1U8R A;  3CCL A;  4HT8 A;  4LDV A;  2HAX A;  4QVD A;  1NE8 A;  4C8Q C;  3CEY A;  3DB4 A;  5GAN 2;  1YIT A;  3OS0 A;  4M7D B;  4PKC C;  4PJO D;  4M77 G;  3CCR T;  1JJ2 S;  3JB9 J;  2KK4 A;  5IT9 E;  2FHD A;  2EJG A;  2ZPH B;  2WAC A;  4FSX A;  3V7S A;  1O75 A;  2P0K A;  3QII A;  3VV0 A;  1Q81 U;  2YLB A;  4PJO G;  2JVV A;  4ELZ C;  4CI0 C;  2RHU A;  5GAN 5;  4X9D A;  3VJP A;  5CQY A;  1MHN A;  3CXC S;  3VU3 C;  2KSS A;  2OTL A;  4QQD A;  3L1A A;  1X01 A;  4RG8 A;  4A4K A;  3E19 A;  4LD6 A;  1BYM A;  2EQU A;  1ZBX A;  3HP9 A;  4JRQ A;  3JCM V;  4C8Q F;  3OYF A;  1V29 B;  2LC4 A;  3CCU A;  4BE0 A;  3E9G A;  2L5Q A;  3H6Z A;  1VQ4 T;  1LOJ A;  1K9M C;  1FX7 A;  3X20 B;  1ZHI A;  1BI0 A;  2FB7 A;  3V7R A;  3TU4 K;  4MDX A;  4PJO A;  3GNG A;  3UWN A;  3CC4 A;  3M58 A;  4A53 A;  3C95 A;  3CCM A;  3M59 A;  3G4S A;  5GAM e;  2V8J A;  4PJO C;  2OTJ A;  1D3B B;  2F5K A;  4OMF B;  4UC4 A;  1QVF S;  2LT4 A;  2LT1 A;  5DLQ E;  2X4J A;  1YIJ A;  1OYX A;  3LGL A;  3OYK A;  1QVF A;  1WQ7 A;  5FU6 B;  1KHC A;  4MML A;  4E7H A;  1U1S A;  2R5A A;  2RHI A;  3PIP A;  3FJP A;  1WJR A;  3GLX A;  4F7U G;  5J26 A;  5LJ5 j;  1KG1 A;  3T9N A;  3J7A F;  1JB0 E;  4ME7 A;  4XTW A;  1YBY A;  1WJS A;  4BB7 A;  3A8L B;  4C5H A;  4BI4 A;  2XDP A;  2GFU A;  3HRT A;  3A8G B;  3M54 A;  4M78 B;  5GMK l;  3GOX A;  1N9S A;  3TCJ A;  1M9S A;  3JRZ A;  4L5G A;  4A4H A;  1M8V A;  4A54 A;  1SSF A;  1Y96 B;  1VQ9 A;  2RH2 A;  4OGE A;  3OYB A;  2QXF A;  2JTF A;  5KCO A;  3INZ A;  2G3R A;  5LJ3 g;  2PUO B;  2ZZD A;  3QPH A;  1KQS S;  4E7K A;  3CMA A;  5GAN f;  1OZ2 A;  3ME9 A;  4JS4 A;  2RJD A;  2X4W A;  3OBY A;  2DTI A;  2VGN A;  2M0O A;  3HFN A;  4M7A B;  3RES A;  3SWN B;  1OZ3 A;  4MZP A;  4M75 F;  3CCQ A;  2WSE E;  3EAE A;  4J7F A;  3OB9 A;  1UGS B;  1RI0 A;  1UEB A;  3VYG A;  5C6S A;  3G6E A;  2RHZ A;  3CC7 A;  1NZ9 A;  3JB9 D;  4ZTF A;  1YJN T;  1VQ5 T;  3BFM A;  3VKI A;  1M90 C;  4XTX A;  1HXD A;  1HK9 A;  4JLI A;  1Q86 C;  2RI2 A;  2QQR A;  4LDW A;  4C92 G;  3OYJ A;  2EAY A;  2BKD N;  2P4T A;  2C06 A;  3JB9 G;  5CKB A;  2KVQ G;  4BY6 B;  3L2Z A;  5HK0 A;  2KDS A;  2ZCF B;  2V8K A;  4EPC A;  5LJ3 h;  3V8L A;  2MAM A;  2HBP A;  4ZN3 A;  5DY9 A;  1AHJ B;  4KUD K;  2WSC E;  2QTX A;  4XTV A;  3FB9 A;  5LJ3 d;  5GAM g;  1N8R U;  4KT0 E;  2AHJ B;  2WSF E;  4NL3 A;  4LDX A;  4XTY A;  3CCR A;  3JB9 H;  2RM4 A;  3NFC A;  4FL6 A;  3DB3 A;  4KUL A;  3L2U A;  1VQM T;  2GQV A;  2P0Q A;  3O8V A;  1M1K C;  1P92 A;  2XK0 A;  4XK8 E;  2RJC A;  5I2M A;  3MEU A;  2OAU A;  4QQ6 A;  3OYH A;  4RMO A;  1WPY A;  5GAN e;  5GAN 3;  4BE1 A;  4DQ2 A;  3GP8 A;  5KE3 A;  2D0Q B;  4XAX B;  1VQO T;  1YHQ T;  2H3J A;  3NTH A;  4FM4 B;  1VQ4 A;  2DXB A;  5CAI A;  3X25 B;  4C8Q G;  2E70 A;  2LX9 A;  4J5Y A;  2GCX A;  2L3R A;  3OYM A;  1YJ9 T;  5CIU A;  3WXM B;  4JJN K;  4XQ3 A;  2EIF A;  1M90 U;  2EQK A;  3HFO A;  1Q86 U;  2QI2 A;  4LDY A;  1YI2 T;  3QUI A;  2VYT A;  2KQW A;  3P8H A;  1YJW T;  4M77 B;  4N4G A;  2VC8 A;  2DK3 A;  2PQW A;  2RI3 A;  1R8O B;  2RA2 A;  1UB4 A;  2PVD B;  3RER A;  3PTA A;  3L2Q A;  4PJO B;  4ELY C;  1WNL A;  2DD4 A;  5CKE A;  5LJ3 j;  4FT4 A;  1N9R A;  3QO3 A;  4TVR A;  1K73 C;  3X28 B;  3X24 B;  3JCM e;  3JCM b;  2EFI A;  1ZQ1 A;  3MP6 A;  4DOV A;  3CBO A;  2E6Z A;  5LJ5 h;  4RCB A;  4C5I A;  1QVG S;  1VQP T;  2DZ9 A;  3OMC A;  3OSV A;  4X34 A;  2O4X A;  1WQW A;  5LJ5 d;  5GAO l;  4JLG A;  1QVG A;  3GIB A;  2QA4 T;  4C0D B;  3QKJ A;  3BDL A;  3A8M B;  4M75 E;  2DVE A;  2CZ6 B;  4EMK B;  1VQ7 T;  4Y28 E;  2KY9 A;  3BDU A;  1I4K 1;  3F70 A;  3QHS A;  4J8O A;  1WGS A;  2DIG A;  4PNO A;  2QQB A;  4EMG A;  5GMK m;  4M7D E;  2E65 A;  4OB3 B;  3I55 T;  4N0A A;  4ZGE B;  2MWO A;  3OMG A;  3V7C A;  3QZ9 B;  3MEA A;  4M75 D;  5KCH A;  1VQK T;  5DLO A;  5GAM j;  5GAN 7;  4R56 A;  4JS5 A;  4N0A C;  3L2V A;  3GNF B;  2VUB A;  2EKO A;  3UT1 A;  1H64 1;  4F7U B;  4E7L A;  5A2Q E;  1M5Q 1;  5GAN g;  4C5E A;  2LVM A;  1YJN A;  1VQ5 A;  3R6O A;  3CPW A;  2FYK A;  2RI5 A;  2RD1 A;  2LDM A;  1UGQ B;  2CZ7 B;  4IUV A;  4J7I A;  1VQL T;  4ATO A;  3OS5 A;  4ZN1 A;  1BI3 A;  2E10 A;  4IUQ A;  5KH6 A;  3JAM E;  4ZTJ A;  5FU7 C;  4J6X A;  4M75 A;  4LDU A;  1NJI C;  3LX7 A;  4R55 A;  3GF5 A;  2DEQ A;  4RKU E;  3L42 A;  2K3Y A;  2DD5 A;  2MI6 A;  3M53 A;  2YLC A;  3PMT A;  1UGP B;  2RO0 A;  1X75 C;  2IG0 A;  3FLG A;  2A3L A;  3PT9 A;  4M75 C;  4OVA A;  4BAC A;  1K9M U;  1UGR B;  4MZM A;  3M57 A;  3CC2 T;  1VQM A;  1KD1 C;  3J80 E;  2O01 E;  4O5V A;  2XU8 A;  5A0G A;  4EMH A;  3HPW A;  4ZGJ B;  3FRN A;  5GAO q;  1WJQ A;  2JUF A;  2QQ9 A;  3A8H B;  4IUR A;  5CKH A;  5L8R E;  4M78 E;  4B9X A;  4C92 B;  3OS2 A;  1VQO A;  1VUB A;  1YHQ A;  3EFS A;  5HKC A;  3G7Z A;  1KC8 C;  1Q7Y U;  2DTO A;  3HRU A;  3ASK A;  5J39 A;  3L2R A;  1YJ9 A;  2R5M A;  3X26 B;  2XG8 D;  3AHU A;  2HD0 A;  2K5L A;  3QDR B;  1YI2 A;  4M7D F;  1G5V A;  1VQ8 T;  3FEO A;  5CK9 A;  4HCB A;  3S3M A;  2RHY A;  5HK3 A;  2RK2 A;  1KQ1 A;  1YJW A;  3E1S A;  4M78 D;  1D3B A;  1BI1 A;  2QEX T;  2RJE A;  1NJI U;  3S3N A;  4M7A E;  3S3O A;  4BDY A;  4PLL A;  2DAQ A;  1W2B A;  1QW1 A;  1VQ6 T;  2CYZ B;  2L8D A;  3OYC A;  2VV5 A;  2IVW A;  4JRP A;  4MMK A;  1B34 B;  2R57 A;  2DKG A;  2XDD A;  3G71 T;  5GMK e;  3JCM f;  3JSC A;  2JN0 A;  2B8A A;  3RMQ A;  5GAN 4;  1KQ2 A;  1JRI A;  1M1F A;  2RK1 A;  4XTU A;  2YHT A;  1VQP A;  3BW1 A;  3ZBD A;  4JRI A;  2ZGW A;  4NL2 A;  5FU6 C;  4M7A D;  2XIC A;  4C8Q B;  4MDW A;  4BD3 A;  1G3S A;  3CCV T;  5D6X A;  2QA4 A;  2QQS A;  3PMI A;  4M78 A;  4QQG A;  3RKX A;  4BI8 B;  1LNX A;  2EWN A;  5GAO m;  3L2W A;  2X4X A;  5GAN j;  4II1 A;  1VQ7 A;  3FDR A;  3OYE A;  4MZT A;  4OB2 B;  3N5B B;  2FVU A;  4ZGD B;  4A4G A;  1Y96 A;  2VXE A;  3QYG B;  1Y07 A;  3I56 T;  3I55 A;  1FXX A;  2E6N A;  4M78 C;  3ZEH A;  2O4X B;  3JCM W;  3S6W A;  2KAF A;  3NTI A;  2LQ8 A;  3ER0 A;  4QVZ A;  5GMK i;  2E5Q A;  3CCS T;  1GXI E;  1TH7 A;  5GAM h;  2LCL A;  3QXE B;  2Y90 A;  4J6W A;  1VQK A;  5CO7 A;  3SWN A;  4M7A A;  4Z02 A;  3RMS A;  2V8I A;  3OQ5 A;  5GAM d;  2HQE A;  3WVD B;  5GAO n;  3CCJ T;  3M55 A;  1YIT T;  4Q5W A;  4BUG A;  1XQH A;  2JZ2 A;  5IAY A;  3EFR A;  4JUV A;  3SWN C;  1X6O A;  1Q81 C;  1VQN T;  2XD0 A;  4M7A C;  4M78 F;  2K57 A;  3LWH A;  4KUI A;  2FL7 A;  3A8O B;  4QW2 A;  3RKW A;  3OYA A;  3C94 A;  3QYH B;  4DA4 A;  3JCM P;  3LGF A;  1VQL A;  1N27 A;  3OYN A;  2ZPB B;  2Y4Y A;  1I5L A;  3MP1 A;  5GAN 8;  5AYF A;  1M1K U;  4JRK A;  4XTZ A;  3WVE B;  4M77 E;  5KE2 A;  4NS5 A;  2MWP A;  2F5T X;  2GF7 A;  2ZPF B;  3NTK A;  2XKO C;  3MET A;  3PIO A;  4BY6 C;  1O9S A;  3SFM A;  4XU2 A;  3RIR A;  5I2S A;  4M7A F;  1Q82 C;  2K4Y A;  2BUD A;  4PJO E;  1N6A A;  1BIA A;  2D9T A;  2Y4X A;  3CBP A;  4PLI A;  2QDY B;  3SB2 A;  3CC2 A;  2ZPE B;  2A7Y A;  2DZC A;  3DLM A;  2EQJ A;  4M77 D;  2NLU A;  3DLL A;  2XID A;  1G3W A;  3URG A;  4EDU A;  3CCE T;  3Q1J A;  2JNG A;  4HCC A;  2BIV A;  5LL6 S;  2EYQ A;  4JDS A;  5IN1 A;  4IUU A;  2CKK A;  2CZ0 B;  1VIE A;  2EQM A;  2JOY A;  3TRE A;  2EJF A;  1S72 T;  2CS7 A;  3MHX A;  1KHI A;  1NPR A;  3J81 E;  5I21 A;  2E1H A;  3ZFJ A;  1I81 A;  2M16 A;  5A0D A;  1H3Z A;  3MEV A;  1JJ2 A;  2QQA A;  4M7D D;  4OB1 B;  4FT2 A;  3CD6 T;  5LJ5 f;  3P8D A;  4M75 G;  2E64 A;  3RKY A;  1LJO A;  3MCA B;  3CPW S;  3VUB A;  3QZ5 B;  3CPF A;  4QVC A;  3KXT A;  1K73 U;  3LWI A;  1I8F A;  2K3X A;  2DXC A;  1VQ8 A;  3HRS A;  5A0L A;  3CXC A;  4OGC A;  4M7D G;  4C0F A;  4M77 A;  4GLK A;  2P0P A;  4A4E A;  2XI9 A;  2QEX A;  2K2V A;  5GMK h;  4F7U E;  2LTO A;  1VQ6 A;  3C12 A;  3H8Z A;  4M77 C;  4C5G A;  1Q82 U;  3CME T;  3JCM Q;  3FC3 A;  4RG2 A;  3G71 A;  3LLR A;  3LYI A;  3QBY A;  5GAN 6;  4HCZ A;  3QG1 A;  4M7D A;  2YRV A;  5M9O A;  3KUF A;  1XOV A;  2F69 A;  3SDZ A;  3OW2 S;  1FWZ A;  3UDC A;  5D6W A;  1QP3 A;  4FIB A;  3OW2 A;  2DXT A;  2CGH A;  4D6W A;  5GAN h;  4M7D C;  3CCV A;  1YCY A;  3JCM g;  4EMK A;  3JCM X;  3CCL T;  4LD9 K;  4B9W A;  2PUK B;  4IUT A;  5GAN d;  1XTD A;  2EJ9 A;  3A5Z B;  4M77 F;  4VUB A;  1BIB A;  1M4Z A;  1OI1 A;  3M4Y A;  1PSF A;  4V2S A;  5CCA A;  1BKB A;  4C0D C;  4L6V 5;  3I56 A;  4EMK C;  4XU0 A;  3CBM A;  4IUP A;  4GY5 A;  5GAO r;  4PJO F;  3RUX A;  1NPP A;  5CKD A;  4A4F A;  5LJ5 e;  3CCS A;  2HQX A;  2K5F A;  2PVG B;  5C0M A;  2I2L A;  4HA8 A;  4J6Y A;  4NOY A;  3JCM c;  3OYD A;  1N8R C;  2OTL T;  2DO3 A;  3DKM A;  2R58 A;  4BE2 A;  2ZPI B;  4HT9 A;  4J83 A;  2LRQ A;  3QJ6 A;  3M9Q A;  4F7U A;  4CRI A;  3CCU T;  1M1G A;  4C92 E;  3CCJ A;  1W2B S;  2XDB A;  3OYI A;  1PSE A;  4BI3 A;  1W4S A;  2JTM A;  2PVO B;  2DXU A;  4PL6 A;  3JCM h;  1VQN A;  3VYH B;  1U1T A;  5GMK j;  4E7I A;  1KQS A;  4L59 A;  4M78 G;  3JCM d;  2DJZ A;  2ZPG B;  4O6J A;  3CC4 T;  5D6Y A;  2E41 A;  2MF2 A;  2E12 A;  2KMT A;  3HL8 A;  3CCM T;  5FLX E;  3G4S T;  1K8A C;  2K5I A;  1KD1 U;  5FRM A;  2X4Y A;  5CVI A;  4C92 D;  2OTJ T;  3OYG A;  2DPP B;  3OA6 A;  3UPU A;  2VXF A;  2RHX A;  3PFS A;  3GPL A;  4DOW A;  2LNV A;  2LQK A;  4RCC A;  1YIJ T;  3LW5 E;  3BY7 A;  3PNW C;  1VIF A;  3PGG A;  4M7A G;  4N4H A;  4F7U F;  2RB6 A;  4YTL A;  5GAO p;  2GFA A;  2XHC A;  3V8J A;  5FRO A;  3OYL A;  1KC8 U;  3JB9 I;  3HSB A;  1Y71 A;  1IZ6 A;  3CCE A;  4C0G A;  5HY6 A;  4C8Q E;  3KBG A;  4C0Z A;  3M4G A;  1QVP A;  5LJ3 f;  2M1H A;  4BDZ A;  1S72 A;  2M9U A;  4WF2 A;  3MO8 A;  4C92 A;  5LJ3 e;  3OSS C;  3MP8 A;  4KBM B;  4OP0 A;  5EG2 A;  1VQ9 T;  2DIQ A;  4IKF A;  2MMP A;  3CD6 A;  4E7J A;  4E47 A;  4C92 C;  3C4S A;  3V8K A;  4C8Q D;  4XU3 A;  3CMA T;  5CQX A;  3OBW A;  1JBM A;  3VUZ A;  1Q7Y C;  3M56 A;  1K8A U;  2DTH A;  1IRE B;  3P8B B;  3TEE A;  1G3Y A;  2LCC A;  4FU6 A;  2VGM A;  1MGQ A;  3HKS A;  3M5A A;  1BI2 A;  4Y91 A;  5LJ5 g;  3CCQ T;  2RJF A;  3SD4 A;  3G6E T;  4HKE A;  3E9F A;  3CC7 T;  4P5N A;  3HHT B;  4XU1 A;  1B34 A;  1G3T A;  5CKF A;  3CME A;  1Y7X A;  3FIF A;  5FU7 B;  3LH0 A;  4C92 F;  2CZ1 B;  1DJ7 B;  4OF1 A;  5CR2 A;  1QP2 A;  5FRN A;  3JCM J;  5J3B A;  5GAM f;  3JB9 F;  3MEW A;  2L89 A;  2PU9 B;  2HNI A;  3OY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...