2LT3A

Solution nmr structure of the c-terminal domain of cdnl from myxococcus xanthus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
113
structure length
113
Chain Sequence
b'GSHMGSVGLREIISEEDVKQVYSILKEKDISVDSTTWNRRYREYMEKIKTGSVFEIAEVLRDLYLLKGDKDLSFGERKMLDTARSLLIKELSLAKDCSEDEIESDLKKIFNLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, CarD family
publication title Structural Insights into RNA Polymerase Recognition and Essential Function of Myxococcus xanthus CdnL.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Transcription
total genus 31
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2012-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lt3A01
4ILUA 2LT3A 4XAXB 4MFRA 4L5GA 4KBMB 4KMCA
chains in the Genus database with same CATH superfamily
2L3LA 4XZCA 2Y48B 1UX4A 3FBZA 3M3ZB 2XSBA 2YN6A 1ZKEA 3UFGA 3K3NA 4NPPA 5C2TA 1OEDE 2UU9T 4DR4T 2JMKA 4P0AA 3RQWA 3HKCE 1FMVA 4JI8T 3P4RA 5L2LA 1HX1B 3ZT6A 1UCUA 3ZMZB 3ONLC 5ETWA 2HPLA 2V5CA 2RA1A 4FJOA 3H3AA 5HEOA 2V7LA 4JLEA 2VASA 4IIJE 3UTKA 1MIVA 5H6RB 4LF8T 2UXXB 4TNWA 3PUQA 2N9DA 1N34T 2KSRA 4YTMA 3ZN1B 2C0SA 3CPZA 5HEHA 1H7CA 4JYAT 2ZM6T 2Q9QD 2WS3A 4KUMB 2CEAA 2VVNA 2MYSA 2V5DA 3QNUA 5LG4A 1J5WA 1OXZA 4KBMB 3HKDE 5FY0A 1SUMB 5KMGP 4EGWA 2K9AA 2ODVA 1ZP0A 2R6GF 5LP6E 4A97A 3LBXB 3P7IA 2XPKA 2ZM8A 3E0ZA 4ZXLA 1D1CA 3OYXA 1M7KA 4V1Av 5C8YE 5FXXA 1UURA 2WWUA 4H9QC 3I0QA 1W0BA 3V5UA 1YD8G 1U4QA 5LJMA 3VRBA 3KBTA 4ZEYA 3HI2A 4JUYA 2XM2A 5JVDE 2XQYA 4DBQA 1HNXT 4DR6T 4WYVA 3AEFA 2XAHB 2X68A 3OTOT 3FZFB 3ZMUB 4UVCB 3TLWA 3NRYA 2YDSA 4DR2T 3SRZA 2PBIA 3UU3A 2HN1A 4ILUA 2EHOC 3A7MA 4CI3B 5IYZE 3KVBA 1ZV4X 2VL0A 2FBWA 3TKLB 5FKYA 2BZBA 2ODUA 1FEWA 1YXRA 2H89A 1AJ3A 2CPTA 1UK5A 4GIWA 3N2KE 5JTGA 2LEHA 5J1GA 4HFVA 4O4LE 2WSSV 1HFAA 4TN7B 2NWBA 5FP3A 4PJNA 3NVOA 1MMGA 2QGSA 4U33A 5LGUB 1B7TA 4H9SE 3AEDA 3T1YT 2E8IA 4OYJA 3PDYA 3EABA 4UEMA 5EZYE 5LA6E 2JQQA 1J1JA 3RC8A 4L9IA 3RYFE 2XUEA 3PTRB 1MNEA 2WCAA 4EXTA 3KINB 1T98A 3ZN0B 3AE8A 5DQVA 3LG7A 2UXBT 1N33T 2NW7A 2PTFA 4U7IA 2E9XD 1IZNB 4AQGA 1Z0PA 3ZEFB 4TV9E 3N5LA 1HF8A 1O3XA 4LF9T 5DQWA 3I9WA 2DCFA 4DV5T 1MMAA 4UIGA 4WBOA 1KEYA 4JEHB 3TLTA 5LJNA 3UU6A 2KLQA 3JCFA 4KI0F 3ZSTA 2CXFA 2E5LT 4AKRB 2LHNA 2CBIA 2OA5A 2C5JA 3LDQB 5ABHA 4DO0A 2J47A 5KDMC 3I9YA 2YDRA 3RF1A 1VOMA 2HH7A 1V9DA 2H88A 2ZMAA 4EZ4A 1XMOT 2IMLA 3AA1B 3ZYLA 3CK6A 1SA0E 4B3RT 3E08A 3RLFF 1T7SA 5CA1E 1OEDB 5FMNA 4IREA 2L8KA 5JDLA 3C4WA 2Q9QC 4DVDA 3RC3A 4YJ2E 2VQFT 2B76A 5L3DB 4YJ3E 2JIWA 3LK3B 4TUYE 2K24A 4YY3T 1D0YA 2XM1A 3RPUA 2WDRA 5JH7E 5AQFB 2V26A 4BJNA 1BR2A 4U2ZA 2E5VA 4ZOLE 2IUBA 5LHGB 4ZS3A 5EK3A 1US7B 3GA8A 4YSZA 4EV6A 4HFEA 2BBHA 4OFZA 2H7VC 2I59A 2KWHA 5JDNA 3N9OA 4PJLA 2E9XB 2IW5B 4X5TA 4HKAA 3AE5A 4AKGA 2DWGA 3NWIA 5JDGA 5E0OA 3AECA 3CIRA 3WAJA 4TV8E 3BQLA 2M6BA 3KVAA 3GWHA 2G0UA 3V5SA 3CVRA 4QHOA 1HCIA 2CHOA 1YKEB 5BR8T 2WP9A 1S94A 1QLBA 1E2AA 1WLXA 4F8HA 5HCMA 2VURA 5LMUT 2KNDA 3K8PC 4X20E 1UUSA 2CXLA 4UVBB 4I50E 3CKDA 5JR9A 3PJAA 1OEDC 1FIOA 4EAHA 4JI5T 4ANJA 4IE6A 1D1BA 2JQ9A 1KF6A 4E7SA 3HA4A 4JI4T 3CX8B 3RIUC 2M67A 4L5GA 2BG9C 2QA7A 1I6ZA 2VWAA 2UUCT 3T1HT 3WAKA 3MJXA 2E2AA 2GK9A 4ZI3D 5HWYA 3AE2A 4H9PC 2JQKA 4IDZA 1D0ZA 3P4QA 2JJ9A 4IE5A 2X51A 3IEEA 4X65T 2V6YA 4X1IE 4WBNE 3UU4A 2LKHA 2KINB 3LK2B 5LGTB 2X0YA 3EI0A 1ZOYA 5H6QB 1XNQT 2XAQB 2NTXA 2IAKA 2QVAA 3AEBA 5L3EB 1Y01A 3IHRA 2XQ6A 4EYUA 3HR0A 4DV4T 2KZ7B 5ABFB 3GN5B 3FZLB 4ZZCA 3TLUA 4LMKA 4JI0T 3ZYMA 3RX6A 3LJCA 3LFMA 4G2AA 3UU8A 4TWHA 4ILBA 3UT5E 4U7YA 5KXJA 4QXHB 4JI3T 5HYAA 3ANWB 2IC9A 4B3ST 1GQEA 5DABA 5AQGB 5AQJB 3DTOA 5AQSB 5FY7A 3JC6D 3RYCE 4MALA 4H9OC 3N9NA 4UF0A 2WWVA 5HEJA 3MKDA 3C51A 3OBVE 3OVUA 2RPAA 3AE3A 4LF7T 4O8SA 2CM0A 3N2OA 2HHHT 4PNIA 2LOSA 2WZHA 2ES0A 1ZEEA 3MA9A 3N2GE 3RH3A 4P1NA 4JI1T 5AFUL 3EVYA 2HPJA 2K48A 2WY2A 2WQYA 4AQFA 2EHOA 3C98B 4YSYA 3FZKB 4ILAA 4TZ4C 4X1YE 3AEGA 3UUMA 2JMHA 4PK4A 1VCTA 5JDFA 3L3PA 5AQKB 3PJAJ 5CB4E 4ILCA 4JEUB 2X9XA 1N36T 2LT3A 4TWDA 4LF4T 2VK9A 1N32T 4AIUA 4HFCA 3MACA 5AQQB 1HNWT 5F8PA 3ESLA 4YXDA 4QX7B 2PJQA 3AE1A 3MXZA 3AAIA 2QRXA 2WB5A 2VKOA 4ZS2A 2QYWA 3KV5A 2W00A 4HFHA 4HFIA 4YFSA 4LFCT 4GOUA 2W67A 4P09A 2JPFA 2X0HA 1WCRA 3Q5XA 2CBJA 2CWYA 1IAPA 3K3OA 4YSXA 5FY1A 2NP9A 2WM9A 4CQIA 4M1PA 1HR0T 2MPKA 3PURA 3MZKB 3UFEA 3ZCIA 2VL8A 3PUVF 4ZI2D 5LYJE 1UGOA 1LVFA 3EDUA 2ZLYA 5AQPB 4IDNA 1T8BA 5FNVE 2JRKA 2YDQA 4XAXB 4IE7A 2WDVA 3PUYF 2D5UA 5BMVE 2WZIA 3BQIA 5M4YA 2D2SA 5FXVA 4GYSA 4IT4A 2OLTA 2YU1A 3FXDB 4ZI3C 3OJAA 4ASKA 1IBLT 4DV2T 4QWNB 3FZMB 2LSYA 2N1GA 3VU7H 3DP7A 5JRCA 4KP3C 4G63A 3SOLA 3AB3B 3FXEB 1BR0A 1YKHB 5L3CB 4P0BA 4QXBB 3P8CD 4CXWA 1G73A 4COFA 2MBGA 2IHR1 4IE4A 4U31A 4NUUA 2HN2A 3TLSA 4WW0A 3N9LA 4YT0A 2PFVA 4AI6A 2NW9A 2Q9QA 1JNRA 1FMWA 2BVLA 4U74A 4K0KT 4IL4A 1T72A 4HE8A 2LSJA 5CFBA 2P9BA 4YTPA 4B3TT 1YW0A 3Q2MA 3JADA 4PW8A 2VQET 3S4UA 3OKQA 4O4JE 4TX5A 3O4XE 2J62A 4OK0A 3AXJA 4K0UA 3SWHA 4JI7T 1XDOA 3L09A 5IWAT 4AKHA 4WZXA 1U5PA 1W0AA 3IA3A 1IBMT 4HEAA 3QB5K 2L9QA 4HWDA 2D0UA 2WBLA 3ZT5A 4PAGA 5GONE 4LFAT 3PUWF 4EEBA 5TAOA 3F31A 2BKNA 3P50A 4LFBT 5FXWA 3A5XA 5AQRB 4NXNT 3PV0F 4PFOA 4HWHA 2W4XA 2V8SV 3P4PA 2XQ7A 3UULA 2XQ5A 2AE9A 3CMLA 3NRXA 2C5KT 2AXDS 3Q5EA 4PJMA 4QH5A 3KV6A 3G06A 5AQLB 3AVRA 3NZQA 4UR9A 3D0TA 4IE0A 1HTJF 4JI6T 5JREA 3VR9A 2KT9A 5J2UE 3QB5A 1LKXA 2UUBT 5L4EA 3RKOA 2WU5A 3FZHB 5FL0A 1XWMA 2A2FX 3RYHE 4O4IE 2BG9A 3ETVA 2XJ7A 5LBQB 4DV1T 4GYRA 4I0UA 3CX6B 4AKLA 2KWIB 1HS7A 5IUXA 5HAXA 2J1DG 4F6RC 4EYYR 2FJDA 3JAFA 4ISTA 2WMOA 3KDSE 4I4TE 3O1HA 3RIAA 4I43B 2N2NA 4X66T 4NUVA 4IHJE 1MIWA 3ZMVB 2CMRA 2W62A 4GK0E 4ZZBA 4DR1T 1WYBA 3J7Yq 4LF5T 5AQTB 3KV4A 2BKPA 5HEGA 4U3CA 3HKEE 2LSKA 4WNKA 2V7JA 5JR9B 2NTYA 4PK5A 4QX8B 3ZYKA 2BDEA 2JQHA 4GKKT 4CN1A 4HWFA 3N9MA 1LRZA 1YQ4A 2X9WA 4DMWA 2XQ9A 1QUUA 3KBUA 5IHYA 5JDQA 3PU8A 1MMDA 5HXCA 2V1DB 4IL9A 2XHEB 4AXPA 2BKOA 3F2EA 2EHOD 1SE7A 2XTLA 1WRDA 1I94T 3BK9A 4PJJA 4LF6T 4YHJA 1J5ET 2CWOA 1NEKA 3UQ4A 4NIQA 5LNKA 2UUAT 1KNZA 3R6NA 4DUZT 3SS1A 1WFDA 2V6YB 2E9XC 2LRKA 3EUHA 5AQIB 2CE7A 2XAJB 3R84B 3Q9DA 3VKHA 1W9RA 4H63H 2MTQA 3OYZA 2IIUA 4O2AE 4HTEA 5LXTE 3AEEA 5LHHB 3AA6B 3CX7B 4CXXA 3UUBA 4YTNA 5LHIB 4BA9A 1KNRA 2FUPA 2CXDA 1JNZA 4OYKA 2FJBA 4UXNB 3AAAB 3MK7C 4PK6A 4JV5T 2BBJA 4XBFB 1XNRT 1IJ5A 5C3JA 1D1AA 3KFWX 3QUJA 4CN4A 2A72A 4JI2T 3VKGA 3VRAA 1M62A 2YEVC 4DBRA 1X9BA 4FI5A 5HWXA 4MBQA 4IDQA 2WDQA 2V6XA 3ANWA 5LMNT 5L3GB 3ZJ2A 2VKJA 4O4HE 2ZM2A 4UF0B 4I55E 2KXPB 5EK2A 4AKIA 2A3DA 3AA7B 1L0VA 4IDPA 2Y8DA 4MFRA 4UELA 2UXCT 3QK6A 3B5MA 5J2TE 3ABVA 2K5BB 2EHOB 3RI5A 3LSVA 4Z90A 2W0GA 2MOZA 3NKZA 4X64T 4TNVA 2BG9E 1Z8UA 1XDPA 4B6XA 2DL1A 3K3QC 1E1HB 1MIYA 1KFYA 2BS3A 2C5IT 3ZC1A 4DV7T 3C50A 5FXZA 1SHZC 5CA0E 3RRWA 4LMLA 3O1IA 4U72A 5KX5E 3NZPA 5HCJA 3AAEB 3DJBA 3T8OA 3SFEA 3RRCA 2LM9A 3L39A 3LBXA 3UQ7A 2WU2A 4DIDB 3EHZA 4A98A 2KMFA 3N9QA 1CUNA 2ACZA 3M65A 3UU5A 1BR4A 4J2CA 3FBLA 5LCYA 2DNXA 1UX5A 3IF8B 3EAMA 4CXYA 2V7MA 2UXNB 3W15B 1NWMX 2XQ3A 4TWFA 5EK4A 2YK0A 3NBXX 2PG8A 4ISSA 3FB2A 3OPCA 1XMQT 4L0RA 3C64A 1LVKA 1KNPA 4IDOA 4HN9A 3X1DA 3I1AA 3HKBE 1S35A 2M6IA 1ZHCA 2XAFB 4AQFC 3F57A 1BR1A 2NR4A 4EZHA 1MMNA 3AE7A 2A9UA 2W61A 4QKNA 5LOVE 5JRCB 2XQ8A 4ERRA 4UV8B 3I0OA 3RQUA 4UV9B 3PUGA 2VVSA 2BVMA 2ACXA 2UXDT 2V7KA 1NENA 2CRBA 2YU2A 3J9X1 4OX9T 1HG2A 1YQ3A 2XASB 2X9HA 2YKSA 1G8XA 2LSGA 2Q9QB 4YLHA 3RHWA 2WMNA 3C4XA 5LB7B 2F4VT 1W09A 5AQNB 4Z91A 4A56A 2DHRA 4QXCB 4A5XA 4HFBA 4LMJA 3CQGB 2NW8A 4OHFA 5F3JA 2X0LB 2FJEA 5L4HA 4DV0T 1D0XA 2V7IA 4CZZB 3AXJB 2LHRA 5HXRA 3RGLA 4U2YA 5HEUA 3JC6C 3K1SA 2LSIA 5AQMB 4NXMT 3PU3A 3GMIA 3EDVA 5HXHA 3U78A 4ADZA 4AQYT 2SPCA 2YOEA 5LBMA 5FYMA 2XQ4A 4KHPT 4HWCA 4KMCA 2XAGB 3AEAA 2LLYA 4HGAA 4KX6A 2I6HA 2RP4A 2XQAA 3P4WA 5JQGE 1FJGT 4DV6T 2WAUA 4X62T 3WI3A 4DNDA 4Z8XA 2X9YA 4H9RC 1CHUA 3CWZB 4DMVA 4E7ZA 1XZYA 1OEDA 3PUXF 1HX8A 4ZHQE 5L3FB 3P4SA 3PUAA 2D9DA 3FHNA 5LG3A 4UVAB 5AQHB 5DJQC 2LJLA 5AQOB 1IJ6A 3UUNA 1MNDA 2LE8A 2LKGA 3RIUA 4H9NC 3ZT7A 4PFPA 3B57A 2K3WA 5CGMA 1NAFA 2BG9B 5AQVB 1OWAA 3AA0B 2XZEA 1EZ3A 3U3IA 2W66A 2BS4A 3ZSSA 4DR7T 3Q5DA 4ZI7E 2IC6A 5F5WA 3TLVA 4GKJT 1IBKT 3ZJ1A 2CLYB 4HFDA 2NOXA 2J4GA 5HXSA 3HL6A 3RYIE 4H63V 4EB6E 2E9XA 3ZC0A 3L8RA 5FVLA 3ZLIA 1X79A 4O2BE 4EOZB 4ZI2C 2LRLA 1HG5A 3CQCB 1R8IA 2BS2A 5AQUB 4C90A 3SFDA 1E7PA 4MLKA 5FVKA 3BQKA 5FL1A 3ZKRA 2X66A 4Q25A 1Y64B 5ABEA 1WR6A 3O1JA 2H7OA 5LGNB 2LOPA 2LM2A 3ONJA 3RKGA 5HXEA 2XY8B 2DWKA 2IDOB 3N9PA 2XSAA 2VKDA 3ONXA 4EEDA 2MAWA 3ZMTB 3A8YC 3IBPA 3AVSA 3LK42 4KHZF 3PE0A 3VHLA 2W2UA 4DUYT 4CI2B 3VR8A 4DR5T 5L3BB 2X67A 2I0MA 4DR3T 1HNZT 5ABGA 4DV3T 4BJMA 5ADXL 1QSDA 3KV9A 2OV9A 3H37A 5JDHA 2CA5A 3ZMSB 4CN6A 3ZPOA 2CLYC 5CJ5A 3O9XA 2YINA 3UUXB 3ZCJA 1VCSA 3AE9A 3E22E 1KK7A 4QH4A 1VRBA 4N78D 3AE6A 2ZM0A 3Q5WA 4B3MT 1DU2A 3QOFA 2VKHA 3AE4A 4EIWA 4CI1B 2Z6EA 2VB6A 2H3RA 2CCQA 3JAEA 5A1LA 3H3MA 3CQXC 4IGUA 3ETUA 3PUSA 2W63A 3C4ZA 4GK5E 4JBWF 2CHNA 4QH1A 2DI4A 3RIFA 5JDMA 4X1KE 5ABFA 2DLRA 2FJAA 3GN5A 4HWIB 3B13A 3QC9A 5JR9C 5L47A 1WR0A 4C91A 2B1EA 2Y6XA 2D0TA 1WYCA 4YHHT 4AISA 3PUZF 4MHCA 4BAYB 5J0ZA
chains in the Genus database with same CATH topology
2L3LA 2CXLA 4XZCA 4L0RA 2Y48B 3C64A 1LVKA 5FXWA 4UVBB 4I50E 3CKDA 4HN9A 1UX4A 3FBZA 5JR9A 3A5XA 3I1AA 3HKBE 1S35A 4PFOA 1ZKEA 1FIOA 4EAHA 1ZHCA 2XAFB 4ANJA 3K3NA 4AQFC 4IE6A 1D1BA 3F57A 1BR1A 3UULA 2JMKA 4E7SA 4P0AA 4EZHA 1MMNA 1FMVA 3HKCE 3CMLA 3NRXA 2C5KT 2W61A 5L2LA 3HA4A 4PJMA 3CX8B 4QKNA 2M67A 5LOVE 5JRCB 1UCUA 3ZMZB 4L5GA 3KV6A 2QA7A 4ERRA 5ETWA 2HPLA 3AVRA 3NZQA 4UV8B 3D0TA 4IE0A 1HTJF 2RA1A 4FJOA 3I0OA 4UV9B 3H3AA 3PUGA 2VWAA 5JREA 2KT9A 2V7LA 2BVMA 2VASA 4JLEA 5J2UE 4IIJE 3WAKA 3UTKA 1MIVA 5H6RB 2ACXA 2UXXB 3PUQA 2V7KA 2N9DA 3MJXA 1LKXA 2GK9A 4ZI3D 5HWYA 3RKOA 2YU2A 4H9PC 3J9X1 1HG2A 4IDZA 2C0SA 3ZN1B 2XASB 1D0ZA 2A2FX 3CPZA 2X9HA 1H7CA 3RYHE 4O4IE 1G8XA 2JJ9A 2LSGA 2Q9QD 4IE5A 2X51A 2CEAA 4KUMB 2Q9QB 3IEEA 4YLHA 3ETVA 2MYSA 5LBQB 5LG4A 4GYRA 2WMNA 3C4XA 1OXZA 4KBMB 3HKDE 4X1IE 4WBNE 3CX6B 4A56A 5FY0A 2DHRA 4QXCB 2KINB 3LK2B 4AKLA 2KWIB 5KMGP 5LGTB 1HS7A 5HAXA 2K9AA 2J1DG 3CQGB 4F6RC 2NW8A 4EYYR 2ODVA 4OHFA 5F3JA 5LP6E 4ISTA 3LBXB 5H6QB 3P7IA 2XAQB 2WMOA 2ZM8A 2NTXA 1D1CA 2IAKA 2X0LB 3E0ZA 3KDSE 3OYXA 4I4TE 4V1Av 5L3EB 5C8YE 1D0XA 2V7IA 4CZZB 3IHRA 5FXXA 2WWUA 3O1HA 4H9QC 4I43B 3I0QA 3V5UA 2N2NA 1YD8G 4EYUA 1U4QA 3HR0A 2LHRA 2KZ7B 5HXRA 5LJMA 3GN5B 4NUVA 4IHJE 1MIWA 3ZMVB 3KBTA 2CMRA 2W62A 3JC6C 4GK0E 3HI2A 4JUYA 2LSIA 3PU3A 3GMIA 3RX6A 3ZYMA 3LJCA 2XQYA 3LFMA 5JVDE 4G2AA 4DBQA 3EDVA 1WYBA 5HXHA 3U78A 3J7Yq 3UT5E 4ADZA 2SPCA 3KV4A 5LBMA 4QXHB 5HYAA 5FYMA 3ANWB 2XAHB 2X68A 2IC9A 4KMCA 2XAGB 3ZMUB 4UVCB 3NRYA 3HKEE 2LSKA 5DABA 4HGAA 4WNKA 2V7JA 5JR9B 2RP4A 3DTOA 3SRZA 2PBIA 2NTYA 5JQGE 5FY7A 3JC6D 3RYCE 2WAUA 4MALA 4H9OC 4ILUA 2EHOC 4PK5A 3N9NA 4CI3B 3WI3A 5IYZE 4QX8B 3KVBA 4UF0A 1ZV4X 4DNDA 3ZYKA 4Z8XA 2BDEA 3MKDA 3C51A 3OBVE 2X9YA 4H9RC 3N9MA 3TKLB 4O8SA 2CM0A 3N2OA 1LRZA 2BZBA 4PNIA 2LOSA 2X9WA 4DMWA 1QUUA 2ES0A 3KBUA 3CWZB 2ODUA 5IHYA 5JDQA 4DMVA 1FEWA 4E7ZA 1ZEEA 3MA9A 3N2GE 3PU8A 1HX8A 3RH3A 1AJ3A 1MMDA 5HXCA 2V1DB 5AFUL 3EVYA 4ZHQE 2HPJA 2K48A 5L3FB 3PUAA 4GIWA 3N2KE 2XHEB 4AXPA 4AQFA 3FHNA 2EHOA 3C98B 4UVAB 2LEHA 5J1GA 3F2EA 2EHOD 4TZ4C 4X1YE 4HFVA 2XTLA 3UUMA 5DJQC 2JMHA 4O4LE 4PK4A 2LJLA 1WRDA 2WSSV 1IJ6A 3BK9A 1HFAA 4TN7B 3L3PA 5JDFA 4PJJA 3UUNA 2NWBA 5FP3A 4YHJA 1MNDA 2LE8A 4PJNA 2CWOA 4H9NC 4PFPA 1MMGA 2QGSA 3B57A 5CB4E 4JEUB 2X9XA 5LGUB 1B7TA 1NAFA 2LT3A 5LNKA 4H9SE 1KNZA 2E8IA 3R6NA 3SS1A 4OYJA 1OWAA 2E9XC 3AA0B 3PDYA 2VK9A 1EZ3A 4UEMA 3EUHA 3U3IA 5EZYE 5LA6E 2JQQA 3MACA 2CE7A 3RC8A 5F8PA 3ESLA 4L9IA 3RYFE 4ZI7E 2XUEA 2IC6A 3PTRB 2XAJB 4QX7B 3R84B 1MNEA 2PJQA 4EXTA 3KINB 3Q9DA 1T98A 3ZJ1A 3VKHA 3ZN0B 2CLYB 5DQVA 2NOXA 5HXSA 3MXZA 4H63H 3LG7A 2MTQA 3AAIA 3OYZA 3HL6A 2VKOA 3RYIE 4H63V 4ZS2A 4O2AE 2NW7A 3KV5A 4HTEA 5LXTE 2W00A 4EB6E 5LHHB 2E9XA 3AA6B 3ZC0A 3CX7B 4CXXA 4YFSA 3ZLIA 1X79A 2E9XD 4O2BE 1IZNB 4GOUA 4BA9A 5LHIB 4AQGA 1Z0PA 4EOZB 3ZEFB 4TV9E 4ZI2C 3N5LA 2CXDA 1HF8A 1O3XA 1HG5A 3CQCB 4P09A 2JPFA 4OYKA 3Q5XA 5DQWA 4UXNB 4C90A 3AAAB 3I9WA 3MK7C 2DCFA 4PK6A 2CWYA 1MMAA 4MLKA 1IAPA 3K3OA 4UIGA 3BQKA 2NP9A 5FY1A 2WM9A 4XBFB 4CQIA 4WBOA 1IJ5A 4JEHB 4M1PA 2X66A 1D1AA 3KFWX 3QUJA 5LJNA 3PURA 2A72A 3MZKB 3VKGA 2KLQA 2YEVC 1Y64B 1WR6A 4DBRA 3O1JA 2CXFA 3UFEA 2H7OA 3ZCIA 5LGNB 2VL8A 4FI5A 2LOPA 4MBQA 4ZI2D 5HWXA 5LYJE 4AKRB 1LVFA 2LHNA 3EDUA 3ANWA 2OA5A 5HXEA 2C5JA 2ZLYA 5L3GB 5FNVE 3ZJ2A 2JRKA 4DO0A 4XAXB 4IE7A 2DWKA 2D5UA 2VKJA 3N9PA 4O4HE 5BMVE 5KDMC 2ZM2A 4UF0B 3I9YA 1VOMA 2HH7A 1V9DA 4I55E 2KXPB 3BQIA 5M4YA 2D2SA 2VKDA 3ONXA 5FXVA 2ZMAA 4GYSA 3ZMTB 4EZ4A 5EK2A 4AKIA 3AA1B 3ZYLA 2A3DA 3AA7B 3IBPA 1SA0E 3E08A 3AVSA 2YU1A 3LK42 3PE0A 3VHLA 5CA1E 3FXDB 2Y8DA 4ZI3C 4MFRA 3OJAA 4ASKA 4UELA 5FMNA 3QK6A 4QWNB 4CI2B 2LSYA 2L8KA 5L3BB 2N1GA 3VU7H 3DP7A 5J2TE 5JRCA 2X67A 5JDLA 2K5BB 3C4WA 2EHOB 2Q9QC 4KP3C 4G63A 3SOLA 4DVDA 3RC3A 4YJ2E 4BJMA 2W0GA 5ADXL 3AB3B 2MOZA 1QSDA 3KV9A 3FXEB 1BR0A 1YKHB 3H37A 5L3CB 4P0BA 4QXBB 3P8CD 2CA5A 5JDHA 4CXWA 1G73A 5L3DB 4YJ3E 2MBGA 3LK3B 4TUYE 2K24A 4IE4A 4NUUA 4WW0A 3ZMSB 1D0YA 4B6XA 3RPUA 3ZPOA 3N9LA 5JH7E 2CLYC 2PFVA 3K3QC 4AI6A 2NW9A 1E1HB 2Q9QA 3O9XA 2YINA 1MIYA 3UUXB 2V26A 3ZCJA 2C5IT 3ZC1A 4BJNA 1FMWA 3C50A 3E22E 1BR2A 5FXZA 1SHZC 1KK7A 5CA0E 3RRWA 3O1IA 4ZOLE 4U72A 2BVLA 4U74A 5LHGB 1VRBA 4ZS3A 4N78D 5EK3A 1US7B 3GA8A 2ZM0A 3Q5WA 4HE8A 2LSJA 2P9BA 2VKHA 4OFZA 5KX5E 4EIWA 3NZPA 4CI1B 2H7VC 2I59A 3AAEB 2Z6EA 1YW0A 2VB6A 3DJBA 3T8OA 3RRCA 2H3RA 3Q2MA 2CCQA 2LM9A 2KWHA 3LBXA 4PW8A 5JDNA 5A1LA 3CQXC 3S4UA 3N9OA 4PJLA 2E9XB 4IGUA 3OKQA 3ETUA 3PUSA 4O4JE 2KMFA 3N9QA 2W63A 2IW5B 4HKAA 4TX5A 3O4XE 4AKGA 2DWGA 4OK0A 1CUNA 5JDGA 3C4ZA 5E0OA 4GK5E 4K0UA 2DI4A 3SWHA 3M65A 5JDMA 4X1KE 1BR4A 4J2CA 2DLRA 3GN5A 3B13A 3FBLA 3L09A 5LCYA 2DNXA 1UX5A 3QC9A 3IF8B 5JR9C 4AKHA 3WAJA 4TV8E 1U5PA 4CXYA 4C91A 2V7MA 2B1EA 2UXNB 3BQLA 1NWMX 3W15B 4HEAA 3KVAA 2Y6XA 3GWHA 2D0TA 2G0UA 1WYCA 3V5SA 3CVRA 4QHOA 1HCIA 2L9QA 5EK4A 1YKEB 2YK0A 3NBXX 2PG8A 2D0UA 2WBLA 4PAGA 1S94A 4MHCA 5GONE 1WLXA 4ISSA 3FB2A 2KNDA 4BAYB 3K8PC 4X20E 5TAOA 3F31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ILU A;  2LT3 A;  4XAX B;  4MFR A;  4L5G A;  4KBM B;  4KMC A; 
#chains in the Genus database with same CATH topology
 2L3L A;  4XZC A;  2Y48 B;  1UX4 A;  3FBZ A;  3M3Z B;  2XSB A;  2YN6 A;  1ZKE A;  3UFG A;  3K3N A;  4NPP A;  5C2T A;  1OED E;  2UU9 T;  4DR4 T;  2JMK A;  4P0A A;  3RQW A;  3HKC E;  1FMV A;  4JI8 T;  3P4R A;  5L2L A;  1HX1 B;  3ZT6 A;  1UCU A;  3ZMZ B;  3ONL C;  5ETW A;  2HPL A;  2V5C A;  2RA1 A;  4FJO A;  3H3A A;  5HEO A;  2V7L A;  4JLE A;  2VAS A;  4IIJ E;  3UTK A;  1MIV A;  5H6R B;  4LF8 T;  2UXX B;  4TNW A;  3PUQ A;  2N9D A;  1N34 T;  2KSR A;  4YTM A;  3ZN1 B;  2C0S A;  3CPZ A;  5HEH A;  1H7C A;  4JYA T;  2ZM6 T;  2Q9Q D;  2WS3 A;  4KUM B;  2CEA A;  2VVN A;  2MYS A;  2V5D A;  3QNU A;  5LG4 A;  1J5W A;  1OXZ A;  4KBM B;  3HKD E;  5FY0 A;  1SUM B;  5KMG P;  4EGW A;  2K9A A;  2ODV A;  1ZP0 A;  2R6G F;  5LP6 E;  4A97 A;  3LBX B;  3P7I A;  2XPK A;  2ZM8 A;  3E0Z A;  4ZXL A;  1D1C A;  3OYX A;  1M7K A;  4V1A v;  5C8Y E;  5FXX A;  1UUR A;  2WWU A;  4H9Q C;  3I0Q A;  1W0B A;  3V5U A;  1YD8 G;  1U4Q A;  5LJM A;  3VRB A;  3KBT A;  4ZEY A;  3HI2 A;  4JUY A;  2XM2 A;  5JVD E;  2XQY A;  4DBQ A;  1HNX T;  4DR6 T;  4WYV A;  3AEF A;  2XAH B;  2X68 A;  3OTO T;  3FZF B;  3ZMU B;  4UVC B;  3TLW A;  3NRY A;  2YDS A;  4DR2 T;  3SRZ A;  2PBI A;  3UU3 A;  2HN1 A;  4ILU A;  2EHO C;  3A7M A;  4CI3 B;  5IYZ E;  3KVB A;  1ZV4 X;  2VL0 A;  2FBW A;  3TKL B;  5FKY A;  2BZB A;  2ODU A;  1FEW A;  1YXR A;  2H89 A;  1AJ3 A;  2CPT A;  1UK5 A;  4GIW A;  3N2K E;  5JTG A;  2LEH A;  5J1G A;  4HFV A;  4O4L E;  2WSS V;  1HFA A;  4TN7 B;  2NWB A;  5FP3 A;  4PJN A;  3NVO A;  1MMG A;  2QGS A;  4U33 A;  5LGU B;  1B7T A;  4H9S E;  3AED A;  3T1Y T;  2E8I A;  4OYJ A;  3PDY A;  3EAB A;  4UEM A;  5EZY E;  5LA6 E;  2JQQ A;  1J1J A;  3RC8 A;  4L9I A;  3RYF E;  2XUE A;  3PTR B;  1MNE A;  2WCA A;  4EXT A;  3KIN B;  1T98 A;  3ZN0 B;  3AE8 A;  5DQV A;  3LG7 A;  2UXB T;  1N33 T;  2NW7 A;  2PTF A;  4U7I A;  2E9X D;  1IZN B;  4AQG A;  1Z0P A;  3ZEF B;  4TV9 E;  3N5L A;  1HF8 A;  1O3X A;  4LF9 T;  5DQW A;  3I9W A;  2DCF A;  4DV5 T;  1MMA A;  4UIG A;  4WBO A;  1KEY A;  4JEH B;  3TLT A;  5LJN A;  3UU6 A;  2KLQ A;  3JCF A;  4KI0 F;  3ZST A;  2CXF A;  2E5L T;  4AKR B;  2LHN A;  2CBI A;  2OA5 A;  2C5J A;  3LDQ B;  5ABH A;  4DO0 A;  2J47 A;  5KDM C;  3I9Y A;  2YDR A;  3RF1 A;  1VOM A;  2HH7 A;  1V9D A;  2H88 A;  2ZMA A;  4EZ4 A;  1XMO T;  2IML A;  3AA1 B;  3ZYL A;  3CK6 A;  1SA0 E;  4B3R T;  3E08 A;  3RLF F;  1T7S A;  5CA1 E;  1OED B;  5FMN A;  4IRE A;  2L8K A;  5JDL A;  3C4W A;  2Q9Q C;  4DVD A;  3RC3 A;  4YJ2 E;  2VQF T;  2B76 A;  5L3D B;  4YJ3 E;  2JIW A;  3LK3 B;  4TUY E;  2K24 A;  4YY3 T;  1D0Y A;  2XM1 A;  3RPU A;  2WDR A;  5JH7 E;  5AQF B;  2V26 A;  4BJN A;  1BR2 A;  4U2Z A;  2E5V A;  4ZOL E;  2IUB A;  5LHG B;  4ZS3 A;  5EK3 A;  1US7 B;  3GA8 A;  4YSZ A;  4EV6 A;  4HFE A;  2BBH A;  4OFZ A;  2H7V C;  2I59 A;  2KWH A;  5JDN A;  3N9O A;  4PJL A;  2E9X B;  2IW5 B;  4X5T A;  4HKA A;  3AE5 A;  4AKG A;  2DWG A;  3NWI A;  5JDG A;  5E0O A;  3AEC A;  3CIR A;  3WAJ A;  4TV8 E;  3BQL A;  2M6B A;  3KVA A;  3GWH A;  2G0U A;  3V5S A;  3CVR A;  4QHO A;  1HCI A;  2CHO A;  1YKE B;  5BR8 T;  2WP9 A;  1S94 A;  1QLB A;  1E2A A;  1WLX A;  4F8H A;  5HCM A;  2VUR A;  5LMU T;  2KND A;  3K8P C;  4X20 E;  1UUS A;  2CXL A;  4UVB B;  4I50 E;  3CKD A;  5JR9 A;  3PJA A;  1OED C;  1FIO A;  4EAH A;  4JI5 T;  4ANJ A;  4IE6 A;  1D1B A;  2JQ9 A;  1KF6 A;  4E7S A;  3HA4 A;  4JI4 T;  3CX8 B;  3RIU C;  2M67 A;  4L5G A;  2BG9 C;  2QA7 A;  1I6Z A;  2VWA A;  2UUC T;  3T1H T;  3WAK A;  3MJX A;  2E2A A;  2GK9 A;  4ZI3 D;  5HWY A;  3AE2 A;  4H9P C;  2JQK A;  4IDZ A;  1D0Z A;  3P4Q A;  2JJ9 A;  4IE5 A;  2X51 A;  3IEE A;  4X65 T;  2V6Y A;  4X1I E;  4WBN E;  3UU4 A;  2LKH A;  2KIN B;  3LK2 B;  5LGT B;  2X0Y A;  3EI0 A;  1ZOY A;  5H6Q B;  1XNQ T;  2XAQ B;  2NTX A;  2IAK A;  2QVA A;  3AEB A;  5L3E B;  1Y01 A;  3IHR A;  2XQ6 A;  4EYU A;  3HR0 A;  4DV4 T;  2KZ7 B;  5ABF B;  3GN5 B;  3FZL B;  4ZZC A;  3TLU A;  4LMK A;  4JI0 T;  3ZYM A;  3RX6 A;  3LJC A;  3LFM A;  4G2A A;  3UU8 A;  4TWH A;  4ILB A;  3UT5 E;  4U7Y A;  5KXJ A;  4QXH B;  4JI3 T;  5HYA A;  3ANW B;  2IC9 A;  4B3S T;  1GQE A;  5DAB A;  5AQG B;  5AQJ B;  3DTO A;  5AQS B;  5FY7 A;  3JC6 D;  3RYC E;  4MAL A;  4H9O C;  3N9N A;  4UF0 A;  2WWV A;  5HEJ A;  3MKD A;  3C51 A;  3OBV E;  3OVU A;  2RPA A;  3AE3 A;  4LF7 T;  4O8S A;  2CM0 A;  3N2O A;  2HHH T;  4PNI A;  2LOS A;  2WZH A;  2ES0 A;  1ZEE A;  3MA9 A;  3N2G E;  3RH3 A;  4P1N A;  4JI1 T;  5AFU L;  3EVY A;  2HPJ A;  2K48 A;  2WY2 A;  2WQY A;  4AQF A;  2EHO A;  3C98 B;  4YSY A;  3FZK B;  4ILA A;  4TZ4 C;  4X1Y E;  3AEG A;  3UUM A;  2JMH A;  4PK4 A;  1VCT A;  5JDF A;  3L3P A;  5AQK B;  3PJA J;  5CB4 E;  4ILC A;  4JEU B;  2X9X A;  1N36 T;  2LT3 A;  4TWD A;  4LF4 T;  2VK9 A;  1N32 T;  4AIU A;  4HFC A;  3MAC A;  5AQQ B;  1HNW T;  5F8P A;  3ESL A;  4YXD A;  4QX7 B;  2PJQ A;  3AE1 A;  3MXZ A;  3AAI A;  2QRX A;  2WB5 A;  2VKO A;  4ZS2 A;  2QYW A;  3KV5 A;  2W00 A;  4HFH A;  4HFI A;  4YFS A;  4LFC T;  4GOU A;  2W67 A;  4P09 A;  2JPF A;  2X0H A;  1WCR A;  3Q5X A;  2CBJ A;  2CWY A;  1IAP A;  3K3O A;  4YSX A;  5FY1 A;  2NP9 A;  2WM9 A;  4CQI A;  4M1P A;  1HR0 T;  2MPK A;  3PUR A;  3MZK B;  3UFE A;  3ZCI A;  2VL8 A;  3PUV F;  4ZI2 D;  5LYJ E;  1UGO A;  1LVF A;  3EDU A;  2ZLY A;  5AQP B;  4IDN A;  1T8B A;  5FNV E;  2JRK A;  2YDQ A;  4XAX B;  4IE7 A;  2WDV A;  3PUY F;  2D5U A;  5BMV E;  2WZI A;  3BQI A;  5M4Y A;  2D2S A;  5FXV A;  4GYS A;  4IT4 A;  2OLT A;  2YU1 A;  3FXD B;  4ZI3 C;  3OJA A;  4ASK A;  1IBL T;  4DV2 T;  4QWN B;  3FZM B;  2LSY A;  2N1G A;  3VU7 H;  3DP7 A;  5JRC A;  4KP3 C;  4G63 A;  3SOL A;  3AB3 B;  3FXE B;  1BR0 A;  1YKH B;  5L3C B;  4P0B A;  4QXB B;  3P8C D;  4CXW A;  1G73 A;  4COF A;  2MBG A;  2IHR 1;  4IE4 A;  4U31 A;  4NUU A;  2HN2 A;  3TLS A;  4WW0 A;  3N9L A;  4YT0 A;  2PFV A;  4AI6 A;  2NW9 A;  2Q9Q A;  1JNR A;  1FMW A;  2BVL A;  4U74 A;  4K0K T;  4IL4 A;  1T72 A;  4HE8 A;  2LSJ A;  5CFB A;  2P9B A;  4YTP A;  4B3T T;  1YW0 A;  3Q2M A;  3JAD A;  4PW8 A;  2VQE T;  3S4U A;  3OKQ A;  4O4J E;  4TX5 A;  3O4X E;  2J62 A;  4OK0 A;  3AXJ A;  4K0U A;  3SWH A;  4JI7 T;  1XDO A;  3L09 A;  5IWA T;  4AKH A;  4WZX A;  1U5P A;  1W0A A;  3IA3 A;  1IBM T;  4HEA A;  3QB5 K;  2L9Q A;  4HWD A;  2D0U A;  2WBL A;  3ZT5 A;  4PAG A;  5GON E;  4LFA T;  3PUW F;  4EEB A;  5TAO A;  3F31 A;  2BKN A;  3P50 A;  4LFB T;  5FXW A;  3A5X A;  5AQR B;  4NXN T;  3PV0 F;  4PFO A;  4HWH A;  2W4X A;  2V8S V;  3P4P A;  2XQ7 A;  3UUL A;  2XQ5 A;  2AE9 A;  3CML A;  3NRX A;  2C5K T;  2AXD S;  3Q5E A;  4PJM A;  4QH5 A;  3KV6 A;  3G06 A;  5AQL B;  3AVR A;  3NZQ A;  4UR9 A;  3D0T A;  4IE0 A;  1HTJ F;  4JI6 T;  5JRE A;  3VR9 A;  2KT9 A;  5J2U E;  3QB5 A;  1LKX A;  2UUB T;  5L4E A;  3RKO A;  2WU5 A;  3FZH B;  5FL0 A;  1XWM A;  2A2F X;  3RYH E;  4O4I E;  2BG9 A;  3ETV A;  2XJ7 A;  5LBQ B;  4DV1 T;  4GYR A;  4I0U A;  3CX6 B;  4AKL A;  2KWI B;  1HS7 A;  5IUX A;  5HAX A;  2J1D G;  4F6R C;  4EYY R;  2FJD A;  3JAF A;  4IST A;  2WMO A;  3KDS E;  4I4T E;  3O1H A;  3RIA A;  4I43 B;  2N2N A;  4X66 T;  4NUV A;  4IHJ E;  1MIW A;  3ZMV B;  2CMR A;  2W62 A;  4GK0 E;  4ZZB A;  4DR1 T;  1WYB A;  3J7Y q;  4LF5 T;  5AQT B;  3KV4 A;  2BKP A;  5HEG A;  4U3C A;  3HKE E;  2LSK A;  4WNK A;  2V7J A;  5JR9 B;  2NTY A;  4PK5 A;  4QX8 B;  3ZYK A;  2BDE A;  2JQH A;  4GKK T;  4CN1 A;  4HWF A;  3N9M A;  1LRZ A;  1YQ4 A;  2X9W A;  4DMW A;  2XQ9 A;  1QUU A;  3KBU A;  5IHY A;  5JDQ A;  3PU8 A;  1MMD A;  5HXC A;  2V1D B;  4IL9 A;  2XHE B;  4AXP A;  2BKO A;  3F2E A;  2EHO D;  1SE7 A;  2XTL A;  1WRD A;  1I94 T;  3BK9 A;  4PJJ A;  4LF6 T;  4YHJ A;  1J5E T;  2CWO A;  1NEK A;  3UQ4 A;  4NIQ A;  5LNK A;  2UUA T;  1KNZ A;  3R6N A;  4DUZ T;  3SS1 A;  1WFD A;  2V6Y B;  2E9X C;  2LRK A;  3EUH A;  5AQI B;  2CE7 A;  2XAJ B;  3R84 B;  3Q9D A;  3VKH A;  1W9R A;  4H63 H;  2MTQ A;  3OYZ A;  2IIU A;  4O2A E;  4HTE A;  5LXT E;  3AEE A;  5LHH B;  3AA6 B;  3CX7 B;  4CXX A;  3UUB A;  4YTN A;  5LHI B;  4BA9 A;  1KNR A;  2FUP A;  2CXD A;  1JNZ A;  4OYK A;  2FJB A;  4UXN B;  3AAA B;  3MK7 C;  4PK6 A;  4JV5 T;  2BBJ A;  4XBF B;  1XNR T;  1IJ5 A;  5C3J A;  1D1A A;  3KFW X;  3QUJ A;  4CN4 A;  2A72 A;  4JI2 T;  3VKG A;  3VRA A;  1M62 A;  2YEV C;  4DBR A;  1X9B A;  4FI5 A;  5HWX A;  4MBQ A;  4IDQ A;  2WDQ A;  2V6X A;  3ANW A;  5LMN T;  5L3G B;  3ZJ2 A;  2VKJ A;  4O4H E;  2ZM2 A;  4UF0 B;  4I55 E;  2KXP B;  5EK2 A;  4AKI A;  2A3D A;  3AA7 B;  1L0V A;  4IDP A;  2Y8D A;  4MFR A;  4UEL A;  2UXC T;  3QK6 A;  3B5M A;  5J2T E;  3ABV A;  2K5B B;  2EHO B;  3RI5 A;  3LSV A;  4Z90 A;  2W0G A;  2MOZ A;  3NKZ A;  4X64 T;  4TNV A;  2BG9 E;  1Z8U A;  1XDP A;  4B6X A;  2DL1 A;  3K3Q C;  1E1H B;  1MIY A;  1KFY A;  2BS3 A;  2C5I T;  3ZC1 A;  4DV7 T;  3C50 A;  5FXZ A;  1SHZ C;  5CA0 E;  3RRW A;  4LML A;  3O1I A;  4U72 A;  5KX5 E;  3NZP A;  5HCJ A;  3AAE B;  3DJB A;  3T8O A;  3SFE A;  3RRC A;  2LM9 A;  3L39 A;  3LBX A;  3UQ7 A;  2WU2 A;  4DID B;  3EHZ A;  4A98 A;  2KMF A;  3N9Q A;  1CUN A;  2ACZ A;  3M65 A;  3UU5 A;  1BR4 A;  4J2C A;  3FBL A;  5LCY A;  2DNX A;  1UX5 A;  3IF8 B;  3EAM A;  4CXY A;  2V7M A;  2UXN B;  3W15 B;  1NWM X;  2XQ3 A;  4TWF A;  5EK4 A;  2YK0 A;  3NBX X;  2PG8 A;  4ISS A;  3FB2 A;  3OPC A;  1XMQ T;  4L0R A;  3C64 A;  1LVK A;  1KNP A;  4IDO A;  4HN9 A;  3X1D A;  3I1A A;  3HKB E;  1S35 A;  2M6I A;  1ZHC A;  2XAF B;  4AQF C;  3F57 A;  1BR1 A;  2NR4 A;  4EZH A;  1MMN A;  3AE7 A;  2A9U A;  2W61 A;  4QKN A;  5LOV E;  5JRC B;  2XQ8 A;  4ERR A;  4UV8 B;  3I0O A;  3RQU A;  4UV9 B;  3PUG A;  2VVS A;  2BVM A;  2ACX A;  2UXD T;  2V7K A;  1NEN A;  2CRB A;  2YU2 A;  3J9X 1;  4OX9 T;  1HG2 A;  1YQ3 A;  2XAS B;  2X9H A;  2YKS A;  1G8X A;  2LSG A;  2Q9Q B;  4YLH A;  3RHW A;  2WMN A;  3C4X A;  5LB7 B;  2F4V T;  1W09 A;  5AQN B;  4Z91 A;  4A56 A;  2DHR A;  4QXC B;  4A5X A;  4HFB A;  4LMJ A;  3CQG B;  2NW8 A;  4OHF A;  5F3J A;  2X0L B;  2FJE A;  5L4H A;  4DV0 T;  1D0X A;  2V7I A;  4CZZ B;  3AXJ B;  2LHR A;  5HXR A;  3RGL A;  4U2Y A;  5HEU A;  3JC6 C;  3K1S A;  2LSI A;  5AQM B;  4NXM T;  3PU3 A;  3GMI A;  3EDV A;  5HXH A;  3U78 A;  4ADZ A;  4AQY T;  2SPC A;  2YOE A;  5LBM A;  5FYM A;  2XQ4 A;  4KHP T;  4HWC A;  4KMC A;  2XAG B;  3AEA A;  2LLY A;  4HGA A;  4KX6 A;  2I6H A;  2RP4 A;  2XQA A;  3P4W A;  5JQG E;  1FJG T;  4DV6 T;  2WAU A;  4X62 T;  3WI3 A;  4DND A;  4Z8X A;  2X9Y A;  4H9R C;  1CHU A;  3CWZ B;  4DMV A;  4E7Z A;  1XZY A;  1OED A;  3PUX F;  1HX8 A;  4ZHQ E;  5L3F B;  3P4S A;  3PUA A;  2D9D A;  3FHN A;  5LG3 A;  4UVA B;  5AQH B;  5DJQ C;  2LJL A;  5AQO B;  1IJ6 A;  3UUN A;  1MND A;  2LE8 A;  2LKG A;  3RIU A;  4H9N C;  3ZT7 A;  4PFP A;  3B57 A;  2K3W A;  5CGM A;  1NAF A;  2BG9 B;  5AQV B;  1OWA A;  3AA0 B;  2XZE A;  1EZ3 A;  3U3I A;  2W66 A;  2BS4 A;  3ZSS A;  4DR7 T;  3Q5D A;  4ZI7 E;  2IC6 A;  5F5W A;  3TLV A;  4GKJ T;  1IBK T;  3ZJ1 A;  2CLY B;  4HFD A;  2NOX A;  2J4G A;  5HXS A;  3HL6 A;  3RYI E;  4H63 V;  4EB6 E;  2E9X A;  3ZC0 A;  3L8R A;  5FVL A;  3ZLI A;  1X79 A;  4O2B E;  4EOZ B;  4ZI2 C;  2LRL A;  1HG5 A;  3CQC B;  1R8I A;  2BS2 A;  5AQU B;  4C90 A;  3SFD A;  1E7P A;  4MLK A;  5FVK A;  3BQK A;  5FL1 A;  3ZKR A;  2X66 A;  4Q25 A;  1Y64 B;  5ABE A;  1WR6 A;  3O1J A;  2H7O A;  5LGN B;  2LOP A;  2LM2 A;  3ONJ A;  3RKG A;  5HXE A;  2XY8 B;  2DWK A;  2IDO B;  3N9P A;  2XSA A;  2VKD A;  3ONX A;  4EED A;  2MAW A;  3ZMT B;  3A8Y C;  3IBP A;  3AVS A;  3LK4 2;  4KHZ F;  3PE0 A;  3VHL A;  2W2U A;  4DUY T;  4CI2 B;  3VR8 A;  4DR5 T;  5L3B B;  2X67 A;  2I0M A;  4DR3 T;  1HNZ T;  5ABG A;  4DV3 T;  4BJM A;  5ADX L;  1QSD A;  3KV9 A;  2OV9 A;  3H37 A;  5JDH A;  2CA5 A;  3ZMS B;  4CN6 A;  3ZPO A;  2CLY C;  5CJ5 A;  3O9X A;  2YIN A;  3UUX B;  3ZCJ A;  1VCS A;  3AE9 A;  3E22 E;  1KK7 A;  4QH4 A;  1VRB A;  4N78 D;  3AE6 A;  2ZM0 A;  3Q5W A;  4B3M T;  1DU2 A;  3QOF A;  2VKH A;  3AE4 A;  4EIW A;  4CI1 B;  2Z6E A;  2VB6 A;  2H3R A;  2CCQ A;  3JAE A;  5A1L A;  3H3M A;  3CQX C;  4IGU A;  3ETU A;  3PUS A;  2W63 A;  3C4Z A;  4GK5 E;  4JBW F;  2CHN A;  4QH1 A;  2DI4 A;  3RIF A;  5JDM A;  4X1K E;  5ABF A;  2DLR A;  2FJA A;  3GN5 A;  4HWI B;  3B13 A;  3QC9 A;  5JR9 C;  5L47 A;  1WR0 A;  4C91 A;  2B1E A;  2Y6X A;  2D0T A;  1WYC A;  4YHH T;  4AIS A;  3PUZ F;  4MHC A;  4BAY B;  5J0Z A; 
#chains in the Genus database with same CATH homology
 2L3L A;  2CXL A;  4XZC A;  4L0R A;  2Y48 B;  3C64 A;  1LVK A;  5FXW A;  4UVB B;  4I50 E;  3CKD A;  4HN9 A;  1UX4 A;  3FBZ A;  5JR9 A;  3A5X A;  3I1A A;  3HKB E;  1S35 A;  4PFO A;  1ZKE A;  1FIO A;  4EAH A;  1ZHC A;  2XAF B;  4ANJ A;  3K3N A;  4AQF C;  4IE6 A;  1D1B A;  3F57 A;  1BR1 A;  3UUL A;  2JMK A;  4E7S A;  4P0A A;  4EZH A;  1MMN A;  1FMV A;  3HKC E;  3CML A;  3NRX A;  2C5K T;  2W61 A;  5L2L A;  3HA4 A;  4PJM A;  3CX8 B;  4QKN A;  2M67 A;  5LOV E;  5JRC B;  1UCU A;  3ZMZ B;  4L5G A;  3KV6 A;  2QA7 A;  4ERR A;  5ETW A;  2HPL A;  3AVR A;  3NZQ A;  4UV8 B;  3D0T A;  4IE0 A;  1HTJ F;  2RA1 A;  4FJO A;  3I0O A;  4UV9 B;  3H3A A;  3PUG A;  2VWA A;  5JRE A;  2KT9 A;  2V7L A;  2BVM A;  2VAS A;  4JLE A;  5J2U E;  4IIJ E;  3WAK A;  3UTK A;  1MIV A;  5H6R B;  2ACX A;  2UXX B;  3PUQ A;  2V7K A;  2N9D A;  3MJX A;  1LKX A;  2GK9 A;  4ZI3 D;  5HWY A;  3RKO A;  2YU2 A;  4H9P C;  3J9X 1;  1HG2 A;  4IDZ A;  2C0S A;  3ZN1 B;  2XAS B;  1D0Z A;  2A2F X;  3CPZ A;  2X9H A;  1H7C A;  3RYH E;  4O4I E;  1G8X A;  2JJ9 A;  2LSG A;  2Q9Q D;  4IE5 A;  2X51 A;  2CEA A;  4KUM B;  2Q9Q B;  3IEE A;  4YLH A;  3ETV A;  2MYS A;  5LBQ B;  5LG4 A;  4GYR A;  2WMN A;  3C4X A;  1OXZ A;  4KBM B;  3HKD E;  4X1I E;  4WBN E;  3CX6 B;  4A56 A;  5FY0 A;  2DHR A;  4QXC B;  2KIN B;  3LK2 B;  4AKL A;  2KWI B;  5KMG P;  5LGT B;  1HS7 A;  5HAX A;  2K9A A;  2J1D G;  3CQG B;  4F6R C;  2NW8 A;  4EYY R;  2ODV A;  4OHF A;  5F3J A;  5LP6 E;  4IST A;  3LBX B;  5H6Q B;  3P7I A;  2XAQ B;  2WMO A;  2ZM8 A;  2NTX A;  1D1C A;  2IAK A;  2X0L B;  3E0Z A;  3KDS E;  3OYX A;  4I4T E;  4V1A v;  5L3E B;  5C8Y E;  1D0X A;  2V7I A;  4CZZ B;  3IHR A;  5FXX A;  2WWU A;  3O1H A;  4H9Q C;  4I43 B;  3I0Q A;  3V5U A;  2N2N A;  1YD8 G;  4EYU A;  1U4Q A;  3HR0 A;  2LHR A;  2KZ7 B;  5HXR A;  5LJM A;  3GN5 B;  4NUV A;  4IHJ E;  1MIW A;  3ZMV B;  3KBT A;  2CMR A;  2W62 A;  3JC6 C;  4GK0 E;  3HI2 A;  4JUY A;  2LSI A;  3PU3 A;  3GMI A;  3RX6 A;  3ZYM A;  3LJC A;  2XQY A;  3LFM A;  5JVD E;  4G2A A;  4DBQ A;  3EDV A;  1WYB A;  5HXH A;  3U78 A;  3J7Y q;  3UT5 E;  4ADZ A;  2SPC A;  3KV4 A;  5LBM A;  4QXH B;  5HYA A;  5FYM A;  3ANW B;  2XAH B;  2X68 A;  2IC9 A;  4KMC A;  2XAG B;  3ZMU B;  4UVC B;  3NRY A;  3HKE E;  2LSK A;  5DAB A;  4HGA A;  4WNK A;  2V7J A;  5JR9 B;  2RP4 A;  3DTO A;  3SRZ A;  2PBI A;  2NTY A;  5JQG E;  5FY7 A;  3JC6 D;  3RYC E;  2WAU A;  4MAL A;  4H9O C;  4ILU A;  2EHO C;  4PK5 A;  3N9N A;  4CI3 B;  3WI3 A;  5IYZ E;  4QX8 B;  3KVB A;  4UF0 A;  1ZV4 X;  4DND A;  3ZYK A;  4Z8X A;  2BDE A;  3MKD A;  3C51 A;  3OBV E;  2X9Y A;  4H9R C;  3N9M A;  3TKL B;  4O8S A;  2CM0 A;  3N2O A;  1LRZ A;  2BZB A;  4PNI A;  2LOS A;  2X9W A;  4DMW A;  1QUU A;  2ES0 A;  3KBU A;  3CWZ B;  2ODU A;  5IHY A;  5JDQ A;  4DMV A;  1FEW A;  4E7Z A;  1ZEE A;  3MA9 A;  3N2G E;  3PU8 A;  1HX8 A;  3RH3 A;  1AJ3 A;  1MMD A;  5HXC A;  2V1D B;  5AFU L;  3EVY A;  4ZHQ E;  2HPJ A;  2K48 A;  5L3F B;  3PUA A;  4GIW A;  3N2K E;  2XHE B;  4AXP A;  4AQF A;  3FHN A;  2EHO A;  3C98 B;  4UVA B;  2LEH A;  5J1G A;  3F2E A;  2EHO D;  4TZ4 C;  4X1Y E;  4HFV A;  2XTL A;  3UUM A;  5DJQ C;  2JMH A;  4O4L E;  4PK4 A;  2LJL A;  1WRD A;  2WSS V;  1IJ6 A;  3BK9 A;  1HFA A;  4TN7 B;  3L3P A;  5JDF A;  4PJJ A;  3UUN A;  2NWB A;  5FP3 A;  4YHJ A;  1MND A;  2LE8 A;  4PJN A;  2CWO A;  4H9N C;  4PFP A;  1MMG A;  2QGS A;  3B57 A;  5CB4 E;  4JEU B;  2X9X A;  5LGU B;  1B7T A;  1NAF A;  2LT3 A;  5LNK A;  4H9S E;  1KNZ A;  2E8I A;  3R6N A;  3SS1 A;  4OYJ A;  1OWA A;  2E9X C;  3AA0 B;  3PDY A;  2VK9 A;  1EZ3 A;  4UEM A;  3EUH A;  3U3I A;  5EZY E;  5LA6 E;  2JQQ A;  3MAC A;  2CE7 A;  3RC8 A;  5F8P A;  3ESL A;  4L9I A;  3RYF E;  4ZI7 E;  2XUE A;  2IC6 A;  3PTR B;  2XAJ B;  4QX7 B;  3R84 B;  1MNE A;  2PJQ A;  4EXT A;  3KIN B;  3Q9D A;  1T98 A;  3ZJ1 A;  3VKH A;  3ZN0 B;  2CLY B;  5DQV A;  2NOX A;  5HXS A;  3MXZ A;  4H63 H;  3LG7 A;  2MTQ A;  3AAI A;  3OYZ A;  3HL6 A;  2VKO A;  3RYI E;  4H63 V;  4ZS2 A;  4O2A E;  2NW7 A;  3KV5 A;  4HTE A;  5LXT E;  2W00 A;  4EB6 E;  5LHH B;  2E9X A;  3AA6 B;  3ZC0 A;  3CX7 B;  4CXX A;  4YFS A;  3ZLI A;  1X79 A;  2E9X D;  4O2B E;  1IZN B;  4GOU A;  4BA9 A;  5LHI B;  4AQG A;  1Z0P A;  4EOZ B;  3ZEF B;  4TV9 E;  4ZI2 C;  3N5L A;  2CXD A;  1HF8 A;  1O3X A;  1HG5 A;  3CQC B;  4P09 A;  2JPF A;  4OYK A;  3Q5X A;  5DQW A;  4UXN B;  4C90 A;  3AAA B;  3I9W A;  3MK7 C;  2DCF A;  4PK6 A;  2CWY A;  1MMA A;  4MLK A;  1IAP A;  3K3O A;  4UIG A;  3BQK A;  2NP9 A;  5FY1 A;  2WM9 A;  4XBF B;  4CQI A;  4WBO A;  1IJ5 A;  4JEH B;  4M1P A;  2X66 A;  1D1A A;  3KFW X;  3QUJ A;  5LJN A;  3PUR A;  2A72 A;  3MZK B;  3VKG A;  2KLQ A;  2YEV C;  1Y64 B;  1WR6 A;  4DBR A;  3O1J A;  2CXF A;  3UFE A;  2H7O A;  3ZCI A;  5LGN B;  2VL8 A;  4FI5 A;  2LOP A;  4MBQ A;  4ZI2 D;  5HWX A;  5LYJ E;  4AKR B;  1LVF A;  2LHN A;  3EDU A;  3ANW A;  2OA5 A;  5HXE A;  2C5J A;  2ZLY A;  5L3G B;  5FNV E;  3ZJ2 A;  2JRK A;  4DO0 A;  4XAX B;  4IE7 A;  2DWK A;  2D5U A;  2VKJ A;  3N9P A;  4O4H E;  5BMV E;  5KDM C;  2ZM2 A;  4UF0 B;  3I9Y A;  1VOM A;  2HH7 A;  1V9D A;  4I55 E;  2KXP B;  3BQI A;  5M4Y A;  2D2S A;  2VKD A;  3ONX A;  5FXV A;  2ZMA A;  4GYS A;  3ZMT B;  4EZ4 A;  5EK2 A;  4AKI A;  3AA1 B;  3ZYL A;  2A3D A;  3AA7 B;  3IBP A;  1SA0 E;  3E08 A;  3AVS A;  2YU1 A;  3LK4 2;  3PE0 A;  3VHL A;  5CA1 E;  3FXD B;  2Y8D A;  4ZI3 C;  4MFR A;  3OJA A;  4ASK A;  4UEL A;  5FMN A;  3QK6 A;  4QWN B;  4CI2 B;  2LSY A;  2L8K A;  5L3B B;  2N1G A;  3VU7 H;  3DP7 A;  5J2T E;  5JRC A;  2X67 A;  5JDL A;  2K5B B;  3C4W A;  2EHO B;  2Q9Q C;  4KP3 C;  4G63 A;  3SOL A;  4DVD A;  3RC3 A;  4YJ2 E;  4BJM A;  2W0G A;  5ADX L;  3AB3 B;  2MOZ A;  1QSD A;  3KV9 A;  3FXE B;  1BR0 A;  1YKH B;  3H37 A;  5L3C B;  4P0B A;  4QXB B;  3P8C D;  2CA5 A;  5JDH A;  4CXW A;  1G73 A;  5L3D B;  4YJ3 E;  2MBG A;  3LK3 B;  4TUY E;  2K24 A;  4IE4 A;  4NUU A;  4WW0 A;  3ZMS B;  1D0Y A;  4B6X A;  3RPU A;  3ZPO A;  3N9L A;  5JH7 E;  2CLY C;  2PFV A;  3K3Q C;  4AI6 A;  2NW9 A;  1E1H B;  2Q9Q A;  3O9X A;  2YIN A;  1MIY A;  3UUX B;  2V26 A;  3ZCJ A;  2C5I T;  3ZC1 A;  4BJN A;  1FMW A;  3C50 A;  3E22 E;  1BR2 A;  5FXZ A;  1SHZ C;  1KK7 A;  5CA0 E;  3RRW A;  3O1I A;  4ZOL E;  4U72 A;  2BVL A;  4U74 A;  5LHG B;  1VRB A;  4ZS3 A;  4N78 D;  5EK3 A;  1US7 B;  3GA8 A;  2ZM0 A;  3Q5W A;  4HE8 A;  2LSJ A;  2P9B A;  2VKH A;  4OFZ A;  5KX5 E;  4EIW A;  3NZP A;  4CI1 B;  2H7V C;  2I59 A;  3AAE B;  2Z6E A;  1YW0 A;  2VB6 A;  3DJB A;  3T8O A;  3RRC A;  2H3R A;  3Q2M A;  2CCQ A;  2LM9 A;  2KWH A;  3LBX A;  4PW8 A;  5JDN A;  5A1L A;  3CQX C;  3S4U A;  3N9O A;  4PJL A;  2E9X B;  4IGU A;  3OKQ A;  3ETU A;  3PUS A;  4O4J E;  2KMF A;  3N9Q A;  2W63 A;  2IW5 B;  4HKA A;  4TX5 A;  3O4X E;  4AKG A;  2DWG A;  4OK0 A;  1CUN A;  5JDG A;  3C4Z A;  5E0O A;  4GK5 E;  4K0U A;  2DI4 A;  3SWH A;  3M65 A;  5JDM A;  4X1K E;  1BR4 A;  4J2C A;  2DLR A;  3GN5 A;  3B13 A;  3FBL A;  3L09 A;  5LCY A;  2DNX A;  1UX5 A;  3QC9 A;  3IF8 B;  5JR9 C;  4AKH A;  3WAJ A;  4TV8 E;  1U5P A;  4CXY A;  4C91 A;  2V7M A;  2B1E A;  2UXN B;  3BQL A;  1NWM X;  3W15 B;  4HEA A;  3KVA A;  2Y6X A;  3GWH A;  2D0T A;  2G0U A;  1WYC A;  3V5S A;  3CVR A;  4QHO A;  1HCI A;  2L9Q A;  5EK4 A;  1YKE B;  2YK0 A;  3NBX X;  2PG8 A;  2D0U A;  2WBL A;  4PAG A;  1S94 A;  4MHC A;  5GON E;  1WLX A;  4ISS A;  3FB2 A;  2KND A;  4BAY B;  3K8P C;  4X20 E;  5TAO A;  3F31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...