2LT3A

Solution nmr structure of the c-terminal domain of cdnl from myxococcus xanthus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
113
structure length
113
Chain Sequence
GSHMGSVGLREIISEEDVKQVYSILKEKDISVDSTTWNRRYREYMEKIKTGSVFEIAEVLRDLYLLKGDKDLSFGERKMLDTARSLLIKELSLAKDCSEDEIESDLKKIFNLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, CarD family
publication title Structural Insights into RNA Polymerase Recognition and Essential Function of Myxococcus xanthus CdnL.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Transcription
total genus 31
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2012-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2lt3A01
4MFRA 4ILUA 4KMCA 2LT3A 4L5GA 4KBMB 4XAXB
chains in the Genus database with same CATH superfamily
3OKQA 3NZPA 4EGWA 1NWMX 4KHPT 4O4LE 3RC3A 4LFCT 2WCAA 3WAJA 1SE7A 2XSAA 2G0UA 2KINB 4HFHA 5LGUB 3JAFA 2V6YB 3QNUA 1T98A 4O2BE 3Q5WA 3ONLC 2GK9A 4TWDA 3VR8A 4JI4T 4X1KE 3K3QC 1KEYA 4X1YE 4PJNA 3SS1A 3W15B 3ANWB 1SHZC 3VHLA 3RYFE 4CN6A 3M65A 5JRCB 2B76A 4HEAA 4LMLA 3GA8A 4EZHA 3RX6A 3JCFA 3H3AA 4U2YA 5AQPB 2WMOA 1BR1A 2PFVA 2AE9A 4COFA 3GWHA 4QXHB 4JI5T 4B3TT 3KV4A 3TKLB 4YJ2E 2J1DG 3RKOA 2XM2A 2FJEA 1IBKT 2L9QA 3V5SA 4JI1T 1MMNA 3PU8A 4JYAT 2E9XD 5HXCA 3ZYMA 1FJGT 2H7VC 3D0TA 4YY3T 1T72A 1J1JA 4P0BA 4EYUA 3I0QA 4DR1T 3ZC0A 2UXBT 2LRLA 2DHRA 3PUWF 2CLYC 4GK5E 3RKGA 2VB6A 2BG9A 5AQJB 1BR2A 1D1AA 2VASA 2V7KA 4ZEYA 2Y6XA 3ZCIA 5JDFA 2UUAT 4UEMA 2CA5A 4DV7T 3Q5XA 4X62T 3K3OA 3NZQA 3HKCE 2BVMA 3HL6A 5L3BB 2WY2A 1UUSA 5CJ5A 4KX6A 2W4XA 2BS4A 2V7IA 1QUUA 4X64T 1XWMA 3L8RA 4IDQA 1D0ZA 4M1PA 4YSYA 5LBMA 1YKEB 4WBOA 5F3JA 1T8BA 2VKJA 2QYWA 1JNRA 3E22E 3U78A 4ILBA 2BG9B 4ILUA 3AEAA 2FBWA 4QH1A 2OLTA 1B7TA 3VR9A 3TLTA 2ZM0A 2M67A 1VCTA 2HN2A 2XZEA 4ISTA 5LA6E 2D0UA 3S4UA 4HTEA 5LJNA 4HE8A 2K5BB 3FXDB 3N5LA 2VL0A 4A97A 1ZV4X 5L2LA 2K48A 3N9MA 3AE3A 4DBQA 3TLUA 5J2TE 2KSRA 1XNQT 1MNEA 1V9DA 4BJNA 2V8SV 5JTGA 4CI2B 4DV6T 3LK3B 2KNDA 2WU5A 4A98A 3QB5K 5ABEA 3PUAA 5EK4A 1DU2A 4UELA 1HG2A 4IE6A 3JC6C 4DR5T 2EHOD 4IE0A 2MOZA 5ADXL 5JR9C 3ZMVB 3BK9A 3KINB 3PTRB 5AQUB 2BS3A 4MHCA 5J1GA 1HTJF 4DR6T 2CWYA 4HWIB 3VRBA 2C0SA 5AQHB 4AI6A 3ZMTB 5AQVB 3AEFA 4NIQA 3KV9A 3FXEB 2FJDA 3EDVA 1Y01A 5FXWA 3Q9DA 3Q2MA 5LBQB 2VWAA 4IE4A 4OYKA 2ZM6T 4DV3T 2KXPB 2YKSA 3PU3A 1WR6A 5BMVE 2XAJB 3OVUA 5ETWA 2KWIB 2QGSA 2LM2A 4X20E 1O3XA 2BKNA 4LF5T 2YDRA 3R84B 3Q5EA 1X9BA 4U2ZA 2V5CA 2X9YA 3ZLIA 1VCSA 2XQ7A 5HWXA 4DBRA 4TN7B 2PG8A 4A5XA 4GKJT 4ZHQE 3SRZA 2NTXA 5IYZE 1HFAA 3T1YT 2K9AA 5L3GB 4TV8E 2BG9E 2IUBA 3UQ7A 2Q9QD 2ZMAA 2XTLA 4IDZA 1WYCA 2UXDT 2A72A 4PJMA 5AQTB 4YTPA 5CA1E 3VU7H 1OEDB 5L3CB 3JAEA 4N78D 4YXDA 3VRAA 1ZKEA 3R6NA 5DQWA 3P8CD 4I0UA 3RIAA 4G2AA 4ISSA 2V26A 4GIWA 2BKOA 2A3DA 2UU9T 1OXZA 2X9HA 2KMFA 1E2AA 5HXRA 3P4WA 5EK3A 1HS7A 2CWOA 4YSZA 3IEEA 2W66A 3PUSA 4YTMA 1HX8A 2XQ9A 5AQFB 3HKBE 2WBLA 3N9OA 4I4TE 2VL8A 2YEVC 3CKDA 3PV0F 2UUBT 4JBWF 1BR4A 5AQIB 3F31A 4NUVA 3RH3A 4HFVA 3OPCA 1YQ3A 2C5JA 3I0OA 1MIWA 4TWHA 2VQFT 3RPUA 2W63A 3I9YA 1OWAA 2J47A 3RRCA 4UR9A 2XSBA 4ASKA 5FL0A 2X67A 3WAKA 1Z8UA 2LKGA 2RA1A 3E0ZA 4HKAA 1XNRT 3PUYF 4DUZT 3FB2A 4U3CA 3N2OA 2D2SA 5DQVA 2H3RA 3UFEA 3KV5A 2WS3A 2C5KT 2CLYB 5HEOA 2IIUA 1HX1B 4DV0T 5LOVE 5LB7B 4UXNB 1LRZA 2IDOB 4P1NA 2YDSA 5FY1A 4DNDA 3LG7A 4DV2T 3PUZF 2HH7A 3AAAB 3T8OA 4A56A 2LLYA 1CHUA 3MA9A 4ZI2C 2H7OA 2ZM8A 1J5ET 2JJ9A 2X9XA 3DTOA 4HFDA 3C4ZA 2JMHA 3AEEA 3B13A 5C2TA 5JDGA 2XQ4A 2HHHT 2CXDA 4Q25A 1OEDE 4U72A 1KK7A 3SWHA 1W09A 5JREA 1D1BA 1KNRA 2A2FX 4PFOA 4HFIA 1HNWT 2X51A 5E0OA 3ZN0B 4ZI3D 1E7PA 1YKHB 5JR9A 1ZEEA 2ODVA 3LDQB 2DWGA 3AAIA 2WZIA 4EEDA 3CMLA 2BVLA 3FBLA 5HEHA 4CXYA 4WW0A 4O2AE 2MYSA 2W62A 2VVSA 2KT9A 4K0KT 4DV5T 3CVRA 2M6IA 3ONJA 2CXFA 4EAHA 1M62A 2FUPA 3E08A 4I43B 2X66A 3JADA 2DWKA 3BQIA 1L0VA 3B57A 1IAPA 2PBIA 4V1Av 4LFBT 1BR0A 3UUBA 4UIGA 2LKHA 2I59A 3MZKB 4WZXA 2NW9A 5JR9B 3P4RA 3N2KE 4LMKA 2YOEA 1KF6A 1WCRA 3C4WA 4AQYT 4AQFC 5CGMA 3QK6A 2LOSA 4B3MT 4HFBA 4TWFA 4JEUB 4WBNE 2NW8A 4ZS3A 4BJMA 4AKIA 4AIUA 3HKDE 4UVAB 1HNZT 4FI5A 3AE2A 5AQOB 2E5VA 4NXMT 2VURA 1J5WA 3AEDA 1W0BA 3OTOT 5FXVA 5AQMB 3N9LA 3CX8B 5JDLA 2AXDS 4AKRB 3PJAA 3CX7B 4EOZB 3RGLA 1US7B 3FZFB 4X66T 3ABVA 3AAEB 1IJ6A 4HGAA 4G63A 4ZOLE 3ZMUB 3KBUA 2P9BA 1NAFA 1UCUA 1X79A 4PK5A 3PDYA 5ABGA 4TNWA 2MAWA 2N2NA 5J0ZA 5KX5E 2E9XC 3LBXA 3UUMA 2KZ7B 4H9SE 5L3DB 4DMVA 3SOLA 5FVLA 4F6RC 4IREA 3CK6A 1ZHCA 2IMLA 3P7IA 3ZMZB 2UUCT 2L8KA 1H7CA 2XQ3A 4ZZCA 2R6GF 2D0TA 4JI8T 2V6XA 2N9DA 5AQNB 1LVFA 4JI0T 2E8IA 4H9QC 1ZOYA 1LVKA 2XAQB 4IE5A 3C64A 5FKYA 2I6HA 3KVAA 4PJLA 3PUQA 3LK2B 1UK5A 5EZYE 1R8IA 5FY7A 4OYJA 2MBGA 2XQAA 3VKHA 3I9WA 2J4GA 3LBXB 2WU2A 2LSGA 3P50A 5IHYA 4B3ST 2OA5A 2OV9A 2JQ9A 4QWNB 4UV8B 5FVKA 4F8HA 1VRBA 4FJOA 3ZJ1A 4JEHB 2XQ8A 2WM9A 3SFDA 5AFUL 1QSDA 4TZ4C 2KWHA 3O1JA 4DV1T 2VKHA 5A1LA 2CHOA 1Y64B 2WDVA 3MXZA 3Q5DA 1EZ3A 3O4XE 4TUYE 2XPKA 2XM1A 3EI0A 1WRDA 3ZT7A 2CBIA 3GN5A 3F57A 3A5XA 1OEDA 5F8PA 4DO0A 4JI3T 2WMNA 3AVSA 1XMOT 1MMAA 3O1IA 3UTKA 3UU6A 2NP9A 2UXXB 3KVBA 1W9RA 1HR0T 1GQEA 3HA4A 1FMVA 2Y48B 1MIVA 3T1HT 4H63H 4XAXB 3QB5A 5LYJE 3KV6A 2DL1A 3PURA 3J7Yq 3OBVE 2EHOC 4ZXLA 1XMQT 2YN6A 3NRYA 2ES0A 3RYHE 1NENA 3OYXA 5CA0E 4CN4A 2H88A 2UXCT 4YHJA 3PUGA 3GN5B 2XJ7A 3EDUA 1N36T 4H9PC 2MTQA 4DR3T 2LRKA 2D5UA 1U5PA 3RF1A 4KMCA 2DNXA 4OFZA 1WLXA 2IAKA 3ONXA 3TLSA 3NBXX 2WWUA 4X5TA 2IC6A 1S94A 3AA1B 3X1DA 5JDMA 1IBMT 4PW8A 2L3LA 2XAGB 5ABFA 3RLFF 4HFEA 5FNVE 3HI2A 5FXZA 2YINA 5JQGE 4UV9B 1WYBA 5HXHA 4L5GA 4ILAA 3NWIA 3PUXF 2KLQA 4U7IA 1T7SA 4DR4T 2XASB 1D0YA 1NEKA 3UUXB 4I55E 5LG4A 1S35A 1MMGA 4XZCA 2XQYA 3AE6A 4BAYB 2I0MA 3EUHA 3RYCE 2RP4A 4LMJA 2Q9QC 4IHJE 4QX8B 1FMWA 3RI5A 2W67A 3N9PA 5HCJA 2LEHA 2SPCA 3ZT5A 1VOMA 1KFYA 2BBJA 3CPZA 3VKGA 1IZNB 3AEGA 2LM9A 3AEBA 3P4QA 3AXJA 4EYYR 5ABFB 4LF7T 3N9QA 1I6ZA 4HWDA 4P0AA 2PJQA 2VK9A 4H9NC 3ZYLA 2WZHA 3TLWA 3ZT6A 5H6RB 3RRWA 2LSYA 3RQWA 5FYMA 3MACA 2X0HA 2YK0A 5DJQC 5HXEA 5TAOA 3FBZA 3GMIA 5LNKA 3AECA 4KUMB 2E5LT 2CBJA 4EV6A 3HR0A 4HWFA 2WB5A 5BR8T 4IE7A 1HF8A 2JQQA 2LSJA 4IL4A 1MMDA 4IIJE 5AQGB 3K8PC 1MIYA 5HCMA 4C91A 3H3MA 2HPLA 2VQET 1G73A 4CXWA 3AA0B 2NOXA 2Z6EA 3AXJB 4PJJA 5FY0A 1SA0E 2PTFA 5LHGB 4JLEA 2WDQA 3J9X1 3UU4A 4Z90A 4CN1A 4JI2T 2V7MA 4ILCA 4LFAT 4U74A 2ACZA 4PK4A 3DP7A 2XQ5A 4HFCA 5C3JA 5HXSA 2E9XB 4EXTA 5AQLB 3UU8A 3AE1A 3NKZA 2XQ6A 3AE8A 3G06A 3QUJA 4CXXA 4DIDB 2BBHA 3ETUA 3CWZB 1IJ5A 5HEJA 2CMRA 4OHFA 2YU2A 3CIRA 4X65T 4PNIA 4K0UA 2N1GA 4IDPA 5LHHB 4WNKA 2V7JA 2H89A 3L39A 5JVDE 4Z8XA 4AKHA 1D1CA 2JRKA 3ZJ2A 4NPPA 4QXBB 4LF6T 4DUYT 2XUEA 5FMNA 2WDRA 2BZBA 3C4XA 1QLBA 3QOFA 4ERRA 1M7KA 3N9NA 5F5WA 3RIFA 4E7ZA 2W2UA 3ETVA 2XAFB 4Z91A 4HWHA 4J2CA 1E1HB 1Z0PA 2K24A 3NVOA 2CRBA 4B6XA 5LGTB 5HAXA 2X0YA 2YU1A 2J62A 4MBQA 3DJBA 2HN1A 3BQKA 3PUVF 5L4EA 4U7YA 4MLKA 4AKGA 3C98B 2QVAA 4QH4A 1N33T 2ZLYA 3NRXA 4L9IA 2DCFA 2EHOA 4ZI3C 5HYAA 3ZC1A 2WP9A 3KDSE 4H9OC 2BDEA 2V1DB 4QHOA 3O9XA 4ZS2A 5AQRB 3FZKB 3K1SA 2LSIA 4L0RA 1D0XA 5FL1A 4CI1B 1FIOA 5JDHA 5L3FB 3JC6D 3UULA 1UX4A 2RPAA 2WSSV 2LE8A 2WAUA 3LJCA 2W61A 5FXXA 3RIUC 2DI4A 4EZ4A 2BS2A 2W0GA 4YLHA 4WYVA 2W00A 2CEAA 1LKXA 3AE9A 4OK0A 4AQGA 2EHOB 3AB3B 1AJ3A 3L3PA 3PE0A 2M6BA 3FZLB 2JPFA 2NWBA 4YFSA 3LK42 3ZN1B 4GK0E 5LHIB 5JDNA 2CXLA 1FEWA 4PAGA 1YW0A 4ADZA 4YT0A 3EABA 4ZZBA 2Q9QA 2DLRA 4H63V 5LJMA 5KDMC 1G8XA 4O4HE 1KNPA 3ZPOA 4TNVA 4JI7T 5H6QB 5LP6E 2E2AA 4UF0A 1N34T 1I94T 2V7LA 3CX6B 4QH5A 2QRXA 4BA9A 2LOPA 2MPKA 2NTYA 1UURA 3KFWX 2ZM2A 4ANJA 3OYZA 4TV9E 5CFBA 1JNZA 2D9DA 3AE4A 3RYIE 4E7SA 4DV4T 2FJAA 5AQSB 2UXNB 4DR2T 2CE7A 2NW7A 2Q9QB 3RQUA 1XZYA 5L3EB 2V5DA 5AQKB 4DMWA 3K3NA 2CHNA 3FZMB 2IHR1 3ZKRA 4KP3C 5LXTE 4IGUA 5C8YE 4CZZB 5L4HA 4JV5T 4B3RT 2WWVA 2IC9A 5M4YA 3MKDA 3C51A 4O8SA 4UF0B 4ZI7E 3C50A 3U3IA 4PFPA 2C5IT 5ABHA 4JUYA 3ZMSB 5LG3A 3P4SA 4YHHT 4H9RC 4MALA 3UUNA 2HPJA 3TLVA 4AKLA 4NXNT 4LF8T 5FP3A 5JH7E 1HNXT 5KXJA 3ZSSA 1WR0A 4QXCB 3UQ4A 4AXPA 5L47A 5HWYA 4GYSA 2YDQA 3RHWA 4NUUA 1XDPA 4GYRA 2BG9C 3P4PA 4IDNA 2ACXA 2B1EA 1HG5A 3V5UA 2JMKA 5LCYA 5LGNB 3EVYA 3WI3A 3OJAA 2A9UA 5CB4E 5LMUT 4C90A 3N2GE 2JIWA 5EK2A 3SFEA 4GKKT 3LSVA 3UU5A 5LMNT 2IW5B 3IHRA 4I50E 3FZHB 2XAHB 4TX5A 1U4QA 1ZP0A 3IF8B 4IT4A 4EEBA 3QC9A 4KBMB 3KBTA 4LF4T 2VKDA 5HEGA 2VKOA 3ZSTA 3A7MA 3PJAJ 4QKNA 3M3ZB 5JDQA 4U31A 3ESLA 4P09A 4OX9T 1KNZA 1XDOA 1YD8G 2JQHA 3CQGB 3ZCJA 3AE5A 4UVBB 4QX7B 3AA6B 2LT3A 2QA7A 2XY8B 4AQFA 3ZEFB 3IBPA 3EAMA 2CPTA 3AE7A 1SUMB 1UX5A 2LHNA 5AQQB 2X0LB 4PK6A 3I1AA 5KMGP 1UGOA 4KHZF 4ZI2D 3UT5E 4GOUA 3CQXC 3L09A 5J2UE 3F2EA 2X9WA 3LFMA 2FJBA 4KI0F 4LF9T 2Y8DA 1YQ4A 5DABA 4O4IE 4HWCA 3B5MA 4O4JE 3RC8A 1MNDA 1CUNA 4UVCB 5IUXA 3FHNA 2CM0A 2VVNA 3MJXA 4CI3B 2X68A 2ODUA 4YTNA 3AA7B 2LSKA 2JQKA 2WQYA 4YSXA 3EHZA 5GONE 4IDOA 4MFRA 2E9XA 3RIUA 4EB6E 4EIWA 1IBLT 4XBFB 2K3WA 5IWAT 1W0AA 2V6YA 3AVRA 1WFDA 4JI6T 3A8YC 3HKEE 3MK7C 1HCIA 3O1HA 2LJLA 2F4VT 3ZYKA 4AISA 4HN9A 1N32T 2BKPA 3CQCB 5HEUA 3IA3A 2CCQA 3ANWA 4DR7T 4CQIA 4U33A 4YJ3E 5JRCA 2NR4A 3UU3A 4IL9A 1OEDC 3H37A 3UFGA 4X1IE 4DVDA 2LHRA 1YXRA 3BQLA 2XHEB
chains in the Genus database with same CATH topology
3O9XA 4ZS2A 3OKQA 3IEEA 3PUSA 1HX8A 1Y64B 3NZPA 2LSIA 3MXZA 1NWMX 1HS7A 1EZ3A 3O4XE 4TUYE 4O4LE 3RC3A 4L0RA 3HKBE 1D0XA 2WBLA 3N9OA 4I4TE 4CI1B 2VL8A 2YEVC 3CKDA 1WRDA 3WAJA 3GN5A 1FIOA 1BR4A 3F57A 5JDHA 3A5XA 5L3FB 2G0UA 2KINB 3JC6D 3F31A 3UULA 5LGUB 5F8PA 4DO0A 1T98A 1UX4A 4O2BE 2WMNA 3AVSA 4NUVA 2WSSV 3Q5WA 3RH3A 2GK9A 2LE8A 2WAUA 4HFVA 3LJCA 2W61A 5FXXA 2C5JA 3I0OA 1MIWA 2DI4A 4X1KE 4EZ4A 3K3QC 3RPUA 1MMAA 2W0GA 2W63A 3O1IA 4X1YE 3I9YA 1OWAA 4PJNA 4YLHA 3UTKA 2NP9A 3SS1A 3RRCA 3W15B 2UXXB 2W00A 3KVBA 4ASKA 2CEAA 1LKXA 2X67A 3ANWB 1SHZC 4OK0A 3VHLA 3RYFE 3WAKA 4AQGA 2EHOB 3AB3B 3M65A 1AJ3A 3L3PA 5JRCB 2RA1A 3HA4A 1FMVA 2Y48B 1MIVA 3PE0A 4HEAA 3E0ZA 4H63H 2JPFA 3GA8A 2NWBA 4EZHA 3RX6A 4YFSA 3LK42 4XAXB 3ZN1B 4GK0E 4HKAA 5LYJE 3H3AA 5LHIB 2WMOA 5JDNA 3KV6A 2CXLA 1FEWA 1BR1A 2PFVA 3FB2A 3GWHA 3PURA 4PAGA 4QXHB 3J7Yq 3KV4A 3N2OA 3OBVE 2EHOC 3TKLB 1YW0A 4ADZA 4YJ2E 3NRYA 2J1DG 2D2SA 5DQVA 2ES0A 2H3RA 3RKOA 3UFEA 3RYHE 5CA0E 3KV5A 3OYXA 2L9QA 3V5SA 2Q9QA 2C5KT 1MMNA 2CLYB 3PU8A 2DLRA 4H63V 4YHJA 5LJMA 2E9XD 5KDMC 1G8XA 3PUGA 5HXCA 5LOVE 3ZYMA 4O4HE 3GN5B 2H7VC 3EDUA 3D0TA 3ZPOA 4H9PC 5H6QB 5LP6E 2MTQA 4UXNB 1LRZA 4P0BA 4UF0A 4EYUA 2D5UA 3I0QA 3ZC0A 1U5PA 5FY1A 2V7LA 4KMCA 2DNXA 2DHRA 4OFZA 1WLXA 4DNDA 2IAKA 3CX6B 2CLYC 4BA9A 3LG7A 3ONXA 4GK5E 2LOPA 2VB6A 2HH7A 2NTYA 1BR2A 1D1AA 3AAAB 3NBXX 2WWUA 2VASA 3KFWX 3T8OA 2IC6A 2ZM2A 4ANJA 2V7KA 1S94A 4A56A 3AA1B 2Y6XA 3OYZA 3ZCIA 5JDFA 3MA9A 4UEMA 4ZI2C 2H7OA 5JDMA 2CA5A 4PW8A 2ZM8A 2JJ9A 4TV9E 4E7SA 3RYIE 2L3LA 3Q5XA 2XAGB 2X9XA 3DTOA 3C4ZA 5FNVE 2JMHA 3K3OA 3NZQA 2UXNB 3B13A 5JDGA 3HI2A 2CXDA 5FXZA 2YINA 5JQGE 4U72A 2CE7A 2NW7A 3HKCE 4UV9B 1WYBA 5HXHA 4L5GA 2BVMA 1KK7A 3SWHA 5JREA 2Q9QB 2KLQA 3HL6A 5L3BB 1D1BA 5L3EB 2A2FX 4DMWA 2XASB 4PFOA 3K3NA 1D0YA 2V7IA 1QUUA 2X51A 3UUXB 4KP3C 4I55E 4IGUA 5C8YE 5LXTE 4CZZB 5E0OA 5LG4A 1S35A 2IC9A 5M4YA 3MKDA 3ZN0B 1MMGA 3C51A 4O8SA 4XZCA 1D0ZA 4ZI3D 4M1PA 4UF0B 2XQYA 5LBMA 4ZI7E 1YKHB 3C50A 3U3IA 1YKEB 3EUHA 4WBOA 5JR9A 4BAYB 5F3JA 1ZEEA 4PFPA 2RP4A 3RYCE 2C5IT 4JUYA 3ZMSB 2ODVA 2VKJA 2Q9QC 4IHJE 3E22E 4QX8B 1FMWA 3U78A 4H9RC 2DWGA 4MALA 3N9PA 2LEHA 4ILUA 3UUNA 2HPJA 2SPCA 3AAIA 1VOMA 4AKLA 3CPZA 3VKGA 1B7TA 1IZNB 5FP3A 2ZM0A 3CMLA 5JH7E 2BVLA 2LM9A 3FBLA 4QXCB 2M67A 4AXPA 4CXYA 5HWYA 4WW0A 4EYYR 4GYSA 4ISTA 4NUUA 4O2AE 2MYSA 2W62A 5LA6E 2D0UA 4GYRA 3N9QA 3S4UA 2KT9A 3CVRA 4HTEA 2ACXA 4P0AA 2CXFA 2B1EA 2PJQA 5LJNA 4HE8A 2K5BB 3FXDB 4EAHA 2VK9A 3N5LA 1HG5A 4H9NC 3E08A 4I43B 2X66A 3ZYLA 3V5UA 2DWKA 2JMKA 1ZV4X 3EVYA 5LCYA 3BQIA 5H6RB 5LGNB 3RRWA 2CWOA 2LSYA 3WI3A 5FYMA 3B57A 3MACA 1IAPA 3OJAA 5L2LA 5CB4E 2YK0A 2K48A 3N9MA 4C90A 2PBIA 4V1Av 4DBQA 3N2GE 1BR0A 5DJQC 4UIGA 5HXEA 5J2TE 1MNEA 1V9DA 2I59A 3FBZA 3GMIA 3MZKB 5TAOA 4BJNA 5EK2A 5LNKA 4CI2B 2NW9A 4KUMB 2IW5B 3LK3B 3IHRA 5JR9B 4I50E 2KNDA 3HR0A 4IE7A 3N2KE 2XAHB 1HF8A 2JQQA 2LSJA 4TX5A 1U4QA 3IF8B 1MMDA 4IIJE 3C4WA 3K8PC 4AQFC 1MIYA 3PUAA 3QK6A 2LOSA 5EK4A 4UELA 3QC9A 1HG2A 4IE6A 4KBMB 4C91A 3KBTA 3JC6C 4JEUB 4WBNE 2EHOD 2VKDA 4IE0A 2NW8A 4ZS3A 2MOZA 2HPLA 4BJMA 5ADXL 4AKIA 5JR9C 3ZMVB 2VKOA 1G73A 4CXWA 3AA0B 3BK9A 2NOXA 2Z6EA 3KINB 3HKDE 4UVAB 3PTRB 4FI5A 4PJJA 5FY0A 4MHCA 4QKNA 5JDQA 1SA0E 5J1GA 1HTJF 5LHGB 3ESLA 2CWYA 4JLEA 3J9X1 4P09A 1KNZA 2V7MA 5FXVA 1YD8G 2C0SA 3N9LA 3CQGB 3CX8B 4U74A 5JDLA 4PK4A 3ZCJA 4UVBB 3DP7A 4QX7B 3AA6B 2LT3A 4AI6A 2QA7A 3ZEFB 4AQFA 4AKRB 3IBPA 3ZMTB 3CX7B 5HXSA 2E9XB 4EOZB 3KV9A 4EXTA 3FXEB 1US7B 3EDVA 1UX5A 2LHNA 3AAEB 5FXWA 3Q9DA 3Q2MA 5LBQB 2VWAA 1IJ6A 2X0LB 4HGAA 3QUJA 4CXXA 4G63A 4IE4A 4OYKA 4PK6A 4ZOLE 3ZMUB 3KBUA 2P9BA 3I1AA 1NAFA 5KMGP 3ETUA 4ZI2D 1UCUA 3CWZB 2KXPB 3PU3A 4GOUA 1WR6A 1IJ5A 1X79A 3CQXC 3L09A 5BMVE 5J2UE 2CMRA 4PK5A 4OHFA 3F2EA 3PDYA 2XAJB 2X9WA 2YU2A 3LFMA 2N2NA 5ETWA 5KX5E 2E9XC 2KWIB 3LBXA 2QGSA 3UUMA 2Y8DA 5DABA 4X20E 1O3XA 4PNIA 4K0UA 2N1GA 4O4IE 2KZ7B 4H9SE 5L3DB 3R84B 3SOLA 4DMVA 5LHHB 4WNKA 4F6RC 4O4JE 3RC8A 1MNDA 2V7JA 1CUNA 4UVCB 3FHNA 2CM0A 1ZHCA 5JVDE 4Z8XA 3MJXA 4CI3B 4AKHA 2X68A 2X9YA 3P7IA 3ZMZB 2ODUA 1D1CA 2L8KA 3ZLIA 3AA7B 2LSKA 2JRKA 1H7CA 3ZJ2A 4QXBB 5HWXA 2XUEA 5FMNA 4DBRA 4TN7B 2D0TA 2PG8A 2BZBA 5GONE 4ZHQE 4MFRA 3C4XA 3SRZA 2N9DA 1LVFA 2NTXA 2E8IA 4H9QC 1HFAA 5IYZE 4ERRA 2K9AA 1LVKA 5L3GB 4TV8E 2XAQB 2E9XA 3N9NA 4EB6E 4IE5A 4EIWA 3C64A 2Q9QD 2ZMAA 4E7ZA 2XTLA 4IDZA 3ETVA 1WYCA 4XBFB 2XAFB 4J2CA 1E1HB 1Z0PA 2K24A 2A72A 3KVAA 4PJLA 3PUQA 3LK2B 4PJMA 5EZYE 5LGTB 4B6XA 5FY7A 5HAXA 5CA1E 3VU7H 3AVRA 2YU1A 4OYJA 2MBGA 4MBQA 3HKEE 3DJBA 3VKHA 5L3CB 3MK7C 4N78D 1HCIA 3O1HA 1ZKEA 3BQKA 2LJLA 3I9WA 3ZYKA 3R6NA 3LBXB 2LSGA 4HN9A 5DQWA 3CQCB 3P8CD 5IHYA 3UT5E 4MLKA 4AKGA 2CCQA 3C98B 2OA5A 2ZLYA 3NRXA 4L9IA 3ANWA 2DCFA 4CQIA 2EHOA 4QWNB 4ZI3C 4UV8B 5HYAA 3ZC1A 4G2AA 4ISSA 4YJ3E 5JRCA 3KDSE 1VRBA 4FJOA 3ZJ1A 2V26A 3H37A 4GIWA 4H9OC 4JEHB 2WM9A 2A3DA 5AFUL 4X1IE 1OXZA 2X9HA 4DVDA 2KMFA 2BDEA 2LHRA 5HXRA 1QSDA 4TZ4C 2KWHA 2V1DB 3O1JA 3BQLA 2VKHA 5EK3A 2XHEB 5A1LA 4QHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFR A;  4ILU A;  4KMC A;  2LT3 A;  4L5G A;  4KBM B;  4XAX B; 
#chains in the Genus database with same CATH topology
 3OKQ A;  3NZP A;  4EGW A;  1NWM X;  4KHP T;  4O4L E;  3RC3 A;  4LFC T;  2WCA A;  3WAJ A;  1SE7 A;  2XSA A;  2G0U A;  2KIN B;  4HFH A;  5LGU B;  3JAF A;  2V6Y B;  3QNU A;  1T98 A;  4O2B E;  3Q5W A;  3ONL C;  2GK9 A;  4TWD A;  3VR8 A;  4JI4 T;  4X1K E;  3K3Q C;  1KEY A;  4X1Y E;  4PJN A;  3SS1 A;  3W15 B;  3ANW B;  1SHZ C;  3VHL A;  3RYF E;  4CN6 A;  3M65 A;  5JRC B;  2B76 A;  4HEA A;  4LML A;  3GA8 A;  4EZH A;  3RX6 A;  3JCF A;  3H3A A;  4U2Y A;  5AQP B;  2WMO A;  1BR1 A;  2PFV A;  2AE9 A;  4COF A;  3GWH A;  4QXH B;  4JI5 T;  4B3T T;  3KV4 A;  3TKL B;  4YJ2 E;  2J1D G;  3RKO A;  2XM2 A;  2FJE A;  1IBK T;  2L9Q A;  3V5S A;  4JI1 T;  1MMN A;  3PU8 A;  4JYA T;  2E9X D;  5HXC A;  3ZYM A;  1FJG T;  2H7V C;  3D0T A;  4YY3 T;  1T72 A;  1J1J A;  4P0B A;  4EYU A;  3I0Q A;  4DR1 T;  3ZC0 A;  2UXB T;  2LRL A;  2DHR A;  3PUW F;  2CLY C;  4GK5 E;  3RKG A;  2VB6 A;  2BG9 A;  5AQJ B;  1BR2 A;  1D1A A;  2VAS A;  2V7K A;  4ZEY A;  2Y6X A;  3ZCI A;  5JDF A;  2UUA T;  4UEM A;  2CA5 A;  4DV7 T;  3Q5X A;  4X62 T;  3K3O A;  3NZQ A;  3HKC E;  2BVM A;  3HL6 A;  5L3B B;  2WY2 A;  1UUS A;  5CJ5 A;  4KX6 A;  2W4X A;  2BS4 A;  2V7I A;  1QUU A;  4X64 T;  1XWM A;  3L8R A;  4IDQ A;  1D0Z A;  4M1P A;  4YSY A;  5LBM A;  1YKE B;  4WBO A;  5F3J A;  1T8B A;  2VKJ A;  2QYW A;  1JNR A;  3E22 E;  3U78 A;  4ILB A;  2BG9 B;  4ILU A;  3AEA A;  2FBW A;  4QH1 A;  2OLT A;  1B7T A;  3VR9 A;  3TLT A;  2ZM0 A;  2M67 A;  1VCT A;  2HN2 A;  2XZE A;  4IST A;  5LA6 E;  2D0U A;  3S4U A;  4HTE A;  5LJN A;  4HE8 A;  2K5B B;  3FXD B;  3N5L A;  2VL0 A;  4A97 A;  1ZV4 X;  5L2L A;  2K48 A;  3N9M A;  3AE3 A;  4DBQ A;  3TLU A;  5J2T E;  2KSR A;  1XNQ T;  1MNE A;  1V9D A;  4BJN A;  2V8S V;  5JTG A;  4CI2 B;  4DV6 T;  3LK3 B;  2KND A;  2WU5 A;  4A98 A;  3QB5 K;  5ABE A;  3PUA A;  5EK4 A;  1DU2 A;  4UEL A;  1HG2 A;  4IE6 A;  3JC6 C;  4DR5 T;  2EHO D;  4IE0 A;  2MOZ A;  5ADX L;  5JR9 C;  3ZMV B;  3BK9 A;  3KIN B;  3PTR B;  5AQU B;  2BS3 A;  4MHC A;  5J1G A;  1HTJ F;  4DR6 T;  2CWY A;  4HWI B;  3VRB A;  2C0S A;  5AQH B;  4AI6 A;  3ZMT B;  5AQV B;  3AEF A;  4NIQ A;  3KV9 A;  3FXE B;  2FJD A;  3EDV A;  1Y01 A;  5FXW A;  3Q9D A;  3Q2M A;  5LBQ B;  2VWA A;  4IE4 A;  4OYK A;  2ZM6 T;  4DV3 T;  2KXP B;  2YKS A;  3PU3 A;  1WR6 A;  5BMV E;  2XAJ B;  3OVU A;  5ETW A;  2KWI B;  2QGS A;  2LM2 A;  4X20 E;  1O3X A;  2BKN A;  4LF5 T;  2YDR A;  3R84 B;  3Q5E A;  1X9B A;  4U2Z A;  2V5C A;  2X9Y A;  3ZLI A;  1VCS A;  2XQ7 A;  5HWX A;  4DBR A;  4TN7 B;  2PG8 A;  4A5X A;  4GKJ T;  4ZHQ E;  3SRZ A;  2NTX A;  5IYZ E;  1HFA A;  3T1Y T;  2K9A A;  5L3G B;  4TV8 E;  2BG9 E;  2IUB A;  3UQ7 A;  2Q9Q D;  2ZMA A;  2XTL A;  4IDZ A;  1WYC A;  2UXD T;  2A72 A;  4PJM A;  5AQT B;  4YTP A;  5CA1 E;  3VU7 H;  1OED B;  5L3C B;  3JAE A;  4N78 D;  4YXD A;  3VRA A;  1ZKE A;  3R6N A;  5DQW A;  3P8C D;  4I0U A;  3RIA A;  4G2A A;  4ISS A;  2V26 A;  4GIW A;  2BKO A;  2A3D A;  2UU9 T;  1OXZ A;  2X9H A;  2KMF A;  1E2A A;  5HXR A;  3P4W A;  5EK3 A;  1HS7 A;  2CWO A;  4YSZ A;  3IEE A;  2W66 A;  3PUS A;  4YTM A;  1HX8 A;  2XQ9 A;  5AQF B;  3HKB E;  2WBL A;  3N9O A;  4I4T E;  2VL8 A;  2YEV C;  3CKD A;  3PV0 F;  2UUB T;  4JBW F;  1BR4 A;  5AQI B;  3F31 A;  4NUV A;  3RH3 A;  4HFV A;  3OPC A;  1YQ3 A;  2C5J A;  3I0O A;  1MIW A;  4TWH A;  2VQF T;  3RPU A;  2W63 A;  3I9Y A;  1OWA A;  2J47 A;  3RRC A;  4UR9 A;  2XSB A;  4ASK A;  5FL0 A;  2X67 A;  3WAK A;  1Z8U A;  2LKG A;  2RA1 A;  3E0Z A;  4HKA A;  1XNR T;  3PUY F;  4DUZ T;  3FB2 A;  4U3C A;  3N2O A;  2D2S A;  5DQV A;  2H3R A;  3UFE A;  3KV5 A;  2WS3 A;  2C5K T;  2CLY B;  5HEO A;  2IIU A;  1HX1 B;  4DV0 T;  5LOV E;  5LB7 B;  4UXN B;  1LRZ A;  2IDO B;  4P1N A;  2YDS A;  5FY1 A;  4DND A;  3LG7 A;  4DV2 T;  3PUZ F;  2HH7 A;  3AAA B;  3T8O A;  4A56 A;  2LLY A;  1CHU A;  3MA9 A;  4ZI2 C;  2H7O A;  2ZM8 A;  1J5E T;  2JJ9 A;  2X9X A;  3DTO A;  4HFD A;  3C4Z A;  2JMH A;  3AEE A;  3B13 A;  5C2T A;  5JDG A;  2XQ4 A;  2HHH T;  2CXD A;  4Q25 A;  1OED E;  4U72 A;  1KK7 A;  3SWH A;  1W09 A;  5JRE A;  1D1B A;  1KNR A;  2A2F X;  4PFO A;  4HFI A;  1HNW T;  2X51 A;  5E0O A;  3ZN0 B;  4ZI3 D;  1E7P A;  1YKH B;  5JR9 A;  1ZEE A;  2ODV A;  3LDQ B;  2DWG A;  3AAI A;  2WZI A;  4EED A;  3CML A;  2BVL A;  3FBL A;  5HEH A;  4CXY A;  4WW0 A;  4O2A E;  2MYS A;  2W62 A;  2VVS A;  2KT9 A;  4K0K T;  4DV5 T;  3CVR A;  2M6I A;  3ONJ A;  2CXF A;  4EAH A;  1M62 A;  2FUP A;  3E08 A;  4I43 B;  2X66 A;  3JAD A;  2DWK A;  3BQI A;  1L0V A;  3B57 A;  1IAP A;  2PBI A;  4V1A v;  4LFB T;  1BR0 A;  3UUB A;  4UIG A;  2LKH A;  2I59 A;  3MZK B;  4WZX A;  2NW9 A;  5JR9 B;  3P4R A;  3N2K E;  4LMK A;  2YOE A;  1KF6 A;  1WCR A;  3C4W A;  4AQY T;  4AQF C;  5CGM A;  3QK6 A;  2LOS A;  4B3M T;  4HFB A;  4TWF A;  4JEU B;  4WBN E;  2NW8 A;  4ZS3 A;  4BJM A;  4AKI A;  4AIU A;  3HKD E;  4UVA B;  1HNZ T;  4FI5 A;  3AE2 A;  5AQO B;  2E5V A;  4NXM T;  2VUR A;  1J5W A;  3AED A;  1W0B A;  3OTO T;  5FXV A;  5AQM B;  3N9L A;  3CX8 B;  5JDL A;  2AXD S;  4AKR B;  3PJA A;  3CX7 B;  4EOZ B;  3RGL A;  1US7 B;  3FZF B;  4X66 T;  3ABV A;  3AAE B;  1IJ6 A;  4HGA A;  4G63 A;  4ZOL E;  3ZMU B;  3KBU A;  2P9B A;  1NAF A;  1UCU A;  1X79 A;  4PK5 A;  3PDY A;  5ABG A;  4TNW A;  2MAW A;  2N2N A;  5J0Z A;  5KX5 E;  2E9X C;  3LBX A;  3UUM A;  2KZ7 B;  4H9S E;  5L3D B;  4DMV A;  3SOL A;  5FVL A;  4F6R C;  4IRE A;  3CK6 A;  1ZHC A;  2IML A;  3P7I A;  3ZMZ B;  2UUC T;  2L8K A;  1H7C A;  2XQ3 A;  4ZZC A;  2R6G F;  2D0T A;  4JI8 T;  2V6X A;  2N9D A;  5AQN B;  1LVF A;  4JI0 T;  2E8I A;  4H9Q C;  1ZOY A;  1LVK A;  2XAQ B;  4IE5 A;  3C64 A;  5FKY A;  2I6H A;  3KVA A;  4PJL A;  3PUQ A;  3LK2 B;  1UK5 A;  5EZY E;  1R8I A;  5FY7 A;  4OYJ A;  2MBG A;  2XQA A;  3VKH A;  3I9W A;  2J4G A;  3LBX B;  2WU2 A;  2LSG A;  3P50 A;  5IHY A;  4B3S T;  2OA5 A;  2OV9 A;  2JQ9 A;  4QWN B;  4UV8 B;  5FVK A;  4F8H A;  1VRB A;  4FJO A;  3ZJ1 A;  4JEH B;  2XQ8 A;  2WM9 A;  3SFD A;  5AFU L;  1QSD A;  4TZ4 C;  2KWH A;  3O1J A;  4DV1 T;  2VKH A;  5A1L A;  2CHO A;  1Y64 B;  2WDV A;  3MXZ A;  3Q5D A;  1EZ3 A;  3O4X E;  4TUY E;  2XPK A;  2XM1 A;  3EI0 A;  1WRD A;  3ZT7 A;  2CBI A;  3GN5 A;  3F57 A;  3A5X A;  1OED A;  5F8P A;  4DO0 A;  4JI3 T;  2WMN A;  3AVS A;  1XMO T;  1MMA A;  3O1I A;  3UTK A;  3UU6 A;  2NP9 A;  2UXX B;  3KVB A;  1W9R A;  1HR0 T;  1GQE A;  3HA4 A;  1FMV A;  2Y48 B;  1MIV A;  3T1H T;  4H63 H;  4XAX B;  3QB5 A;  5LYJ E;  3KV6 A;  2DL1 A;  3PUR A;  3J7Y q;  3OBV E;  2EHO C;  4ZXL A;  1XMQ T;  2YN6 A;  3NRY A;  2ES0 A;  3RYH E;  1NEN A;  3OYX A;  5CA0 E;  4CN4 A;  2H88 A;  2UXC T;  4YHJ A;  3PUG A;  3GN5 B;  2XJ7 A;  3EDU A;  1N36 T;  4H9P C;  2MTQ A;  4DR3 T;  2LRK A;  2D5U A;  1U5P A;  3RF1 A;  4KMC A;  2DNX A;  4OFZ A;  1WLX A;  2IAK A;  3ONX A;  3TLS A;  3NBX X;  2WWU A;  4X5T A;  2IC6 A;  1S94 A;  3AA1 B;  3X1D A;  5JDM A;  1IBM T;  4PW8 A;  2L3L A;  2XAG B;  5ABF A;  3RLF F;  4HFE A;  5FNV E;  3HI2 A;  5FXZ A;  2YIN A;  5JQG E;  4UV9 B;  1WYB A;  5HXH A;  4L5G A;  4ILA A;  3NWI A;  3PUX F;  2KLQ A;  4U7I A;  1T7S A;  4DR4 T;  2XAS B;  1D0Y A;  1NEK A;  3UUX B;  4I55 E;  5LG4 A;  1S35 A;  1MMG A;  4XZC A;  2XQY A;  3AE6 A;  4BAY B;  2I0M A;  3EUH A;  3RYC E;  2RP4 A;  4LMJ A;  2Q9Q C;  4IHJ E;  4QX8 B;  1FMW A;  3RI5 A;  2W67 A;  3N9P A;  5HCJ A;  2LEH A;  2SPC A;  3ZT5 A;  1VOM A;  1KFY A;  2BBJ A;  3CPZ A;  3VKG A;  1IZN B;  3AEG A;  2LM9 A;  3AEB A;  3P4Q A;  3AXJ A;  4EYY R;  5ABF B;  4LF7 T;  3N9Q A;  1I6Z A;  4HWD A;  4P0A A;  2PJQ A;  2VK9 A;  4H9N C;  3ZYL A;  2WZH A;  3TLW A;  3ZT6 A;  5H6R B;  3RRW A;  2LSY A;  3RQW A;  5FYM A;  3MAC A;  2X0H A;  2YK0 A;  5DJQ C;  5HXE A;  5TAO A;  3FBZ A;  3GMI A;  5LNK A;  3AEC A;  4KUM B;  2E5L T;  2CBJ A;  4EV6 A;  3HR0 A;  4HWF A;  2WB5 A;  5BR8 T;  4IE7 A;  1HF8 A;  2JQQ A;  2LSJ A;  4IL4 A;  1MMD A;  4IIJ E;  5AQG B;  3K8P C;  1MIY A;  5HCM A;  4C91 A;  3H3M A;  2HPL A;  2VQE T;  1G73 A;  4CXW A;  3AA0 B;  2NOX A;  2Z6E A;  3AXJ B;  4PJJ A;  5FY0 A;  1SA0 E;  2PTF A;  5LHG B;  4JLE A;  2WDQ A;  3J9X 1;  3UU4 A;  4Z90 A;  4CN1 A;  4JI2 T;  2V7M A;  4ILC A;  4LFA T;  4U74 A;  2ACZ A;  4PK4 A;  3DP7 A;  2XQ5 A;  4HFC A;  5C3J A;  5HXS A;  2E9X B;  4EXT A;  5AQL B;  3UU8 A;  3AE1 A;  3NKZ A;  2XQ6 A;  3AE8 A;  3G06 A;  3QUJ A;  4CXX A;  4DID B;  2BBH A;  3ETU A;  3CWZ B;  1IJ5 A;  5HEJ A;  2CMR A;  4OHF A;  2YU2 A;  3CIR A;  4X65 T;  4PNI A;  4K0U A;  2N1G A;  4IDP A;  5LHH B;  4WNK A;  2V7J A;  2H89 A;  3L39 A;  5JVD E;  4Z8X A;  4AKH A;  1D1C A;  2JRK A;  3ZJ2 A;  4NPP A;  4QXB B;  4LF6 T;  4DUY T;  2XUE A;  5FMN A;  2WDR A;  2BZB A;  3C4X A;  1QLB A;  3QOF A;  4ERR A;  1M7K A;  3N9N A;  5F5W A;  3RIF A;  4E7Z A;  2W2U A;  3ETV A;  2XAF B;  4Z91 A;  4HWH A;  4J2C A;  1E1H B;  1Z0P A;  2K24 A;  3NVO A;  2CRB A;  4B6X A;  5LGT B;  5HAX A;  2X0Y A;  2YU1 A;  2J62 A;  4MBQ A;  3DJB A;  2HN1 A;  3BQK A;  3PUV F;  5L4E A;  4U7Y A;  4MLK A;  4AKG A;  3C98 B;  2QVA A;  4QH4 A;  1N33 T;  2ZLY A;  3NRX A;  4L9I A;  2DCF A;  2EHO A;  4ZI3 C;  5HYA A;  3ZC1 A;  2WP9 A;  3KDS E;  4H9O C;  2BDE A;  2V1D B;  4QHO A;  3O9X A;  4ZS2 A;  5AQR B;  3FZK B;  3K1S A;  2LSI A;  4L0R A;  1D0X A;  5FL1 A;  4CI1 B;  1FIO A;  5JDH A;  5L3F B;  3JC6 D;  3UUL A;  1UX4 A;  2RPA A;  2WSS V;  2LE8 A;  2WAU A;  3LJC A;  2W61 A;  5FXX A;  3RIU C;  2DI4 A;  4EZ4 A;  2BS2 A;  2W0G A;  4YLH A;  4WYV A;  2W00 A;  2CEA A;  1LKX A;  3AE9 A;  4OK0 A;  4AQG A;  2EHO B;  3AB3 B;  1AJ3 A;  3L3P A;  3PE0 A;  2M6B A;  3FZL B;  2JPF A;  2NWB A;  4YFS A;  3LK4 2;  3ZN1 B;  4GK0 E;  5LHI B;  5JDN A;  2CXL A;  1FEW A;  4PAG A;  1YW0 A;  4ADZ A;  4YT0 A;  3EAB A;  4ZZB A;  2Q9Q A;  2DLR A;  4H63 V;  5LJM A;  5KDM C;  1G8X A;  4O4H E;  1KNP A;  3ZPO A;  4TNV A;  4JI7 T;  5H6Q B;  5LP6 E;  2E2A A;  4UF0 A;  1N34 T;  1I94 T;  2V7L A;  3CX6 B;  4QH5 A;  2QRX A;  4BA9 A;  2LOP A;  2MPK A;  2NTY A;  1UUR A;  3KFW X;  2ZM2 A;  4ANJ A;  3OYZ A;  4TV9 E;  5CFB A;  1JNZ A;  2D9D A;  3AE4 A;  3RYI E;  4E7S A;  4DV4 T;  2FJA A;  5AQS B;  2UXN B;  4DR2 T;  2CE7 A;  2NW7 A;  2Q9Q B;  3RQU A;  1XZY A;  5L3E B;  2V5D A;  5AQK B;  4DMW A;  3K3N A;  2CHN A;  3FZM B;  2IHR 1;  3ZKR A;  4KP3 C;  5LXT E;  4IGU A;  5C8Y E;  4CZZ B;  5L4H A;  4JV5 T;  4B3R T;  2WWV A;  2IC9 A;  5M4Y A;  3MKD A;  3C51 A;  4O8S A;  4UF0 B;  4ZI7 E;  3C50 A;  3U3I A;  4PFP A;  2C5I T;  5ABH A;  4JUY A;  3ZMS B;  5LG3 A;  3P4S A;  4YHH T;  4H9R C;  4MAL A;  3UUN A;  2HPJ A;  3TLV A;  4AKL A;  4NXN T;  4LF8 T;  5FP3 A;  5JH7 E;  1HNX T;  5KXJ A;  3ZSS A;  1WR0 A;  4QXC B;  3UQ4 A;  4AXP A;  5L47 A;  5HWY A;  4GYS A;  2YDQ A;  3RHW A;  4NUU A;  1XDP A;  4GYR A;  2BG9 C;  3P4P A;  4IDN A;  2ACX A;  2B1E A;  1HG5 A;  3V5U A;  2JMK A;  5LCY A;  5LGN B;  3EVY A;  3WI3 A;  3OJA A;  2A9U A;  5CB4 E;  5LMU T;  4C90 A;  3N2G E;  2JIW A;  5EK2 A;  3SFE A;  4GKK T;  3LSV A;  3UU5 A;  5LMN T;  2IW5 B;  3IHR A;  4I50 E;  3FZH B;  2XAH B;  4TX5 A;  1U4Q A;  1ZP0 A;  3IF8 B;  4IT4 A;  4EEB A;  3QC9 A;  4KBM B;  3KBT A;  4LF4 T;  2VKD A;  5HEG A;  2VKO A;  3ZST A;  3A7M A;  3PJA J;  4QKN A;  3M3Z B;  5JDQ A;  4U31 A;  3ESL A;  4P09 A;  4OX9 T;  1KNZ A;  1XDO A;  1YD8 G;  2JQH A;  3CQG B;  3ZCJ A;  3AE5 A;  4UVB B;  4QX7 B;  3AA6 B;  2LT3 A;  2QA7 A;  2XY8 B;  4AQF A;  3ZEF B;  3IBP A;  3EAM A;  2CPT A;  3AE7 A;  1SUM B;  1UX5 A;  2LHN A;  5AQQ B;  2X0L B;  4PK6 A;  3I1A A;  5KMG P;  1UGO A;  4KHZ F;  4ZI2 D;  3UT5 E;  4GOU A;  3CQX C;  3L09 A;  5J2U E;  3F2E A;  2X9W A;  3LFM A;  2FJB A;  4KI0 F;  4LF9 T;  2Y8D A;  1YQ4 A;  5DAB A;  4O4I E;  4HWC A;  3B5M A;  4O4J E;  3RC8 A;  1MND A;  1CUN A;  4UVC B;  5IUX A;  3FHN A;  2CM0 A;  2VVN A;  3MJX A;  4CI3 B;  2X68 A;  2ODU A;  4YTN A;  3AA7 B;  2LSK A;  2JQK A;  2WQY A;  4YSX A;  3EHZ A;  5GON E;  4IDO A;  4MFR A;  2E9X A;  3RIU A;  4EB6 E;  4EIW A;  1IBL T;  4XBF B;  2K3W A;  5IWA T;  1W0A A;  2V6Y A;  3AVR A;  1WFD A;  4JI6 T;  3A8Y C;  3HKE E;  3MK7 C;  1HCI A;  3O1H A;  2LJL A;  2F4V T;  3ZYK A;  4AIS A;  4HN9 A;  1N32 T;  2BKP A;  3CQC B;  5HEU A;  3IA3 A;  2CCQ A;  3ANW A;  4DR7 T;  4CQI A;  4U33 A;  4YJ3 E;  5JRC A;  2NR4 A;  3UU3 A;  4IL9 A;  1OED C;  3H37 A;  3UFG A;  4X1I E;  4DVD A;  2LHR A;  1YXR A;  3BQL A;  2XHE B; 
#chains in the Genus database with same CATH homology
 3O9X A;  4ZS2 A;  3OKQ A;  3IEE A;  3PUS A;  1HX8 A;  1Y64 B;  3NZP A;  2LSI A;  3MXZ A;  1NWM X;  1HS7 A;  1EZ3 A;  3O4X E;  4TUY E;  4O4L E;  3RC3 A;  4L0R A;  3HKB E;  1D0X A;  2WBL A;  3N9O A;  4I4T E;  4CI1 B;  2VL8 A;  2YEV C;  3CKD A;  1WRD A;  3WAJ A;  3GN5 A;  1FIO A;  1BR4 A;  3F57 A;  5JDH A;  3A5X A;  5L3F B;  2G0U A;  2KIN B;  3JC6 D;  3F31 A;  3UUL A;  5LGU B;  5F8P A;  4DO0 A;  1T98 A;  1UX4 A;  4O2B E;  2WMN A;  3AVS A;  4NUV A;  2WSS V;  3Q5W A;  3RH3 A;  2GK9 A;  2LE8 A;  2WAU A;  4HFV A;  3LJC A;  2W61 A;  5FXX A;  2C5J A;  3I0O A;  1MIW A;  2DI4 A;  4X1K E;  4EZ4 A;  3K3Q C;  3RPU A;  1MMA A;  2W0G A;  2W63 A;  3O1I A;  4X1Y E;  3I9Y A;  1OWA A;  4PJN A;  4YLH A;  3UTK A;  2NP9 A;  3SS1 A;  3RRC A;  3W15 B;  2UXX B;  2W00 A;  3KVB A;  4ASK A;  2CEA A;  1LKX A;  2X67 A;  3ANW B;  1SHZ C;  4OK0 A;  3VHL A;  3RYF E;  3WAK A;  4AQG A;  2EHO B;  3AB3 B;  3M65 A;  1AJ3 A;  3L3P A;  5JRC B;  2RA1 A;  3HA4 A;  1FMV A;  2Y48 B;  1MIV A;  3PE0 A;  4HEA A;  3E0Z A;  4H63 H;  2JPF A;  3GA8 A;  2NWB A;  4EZH A;  3RX6 A;  4YFS A;  3LK4 2;  4XAX B;  3ZN1 B;  4GK0 E;  4HKA A;  5LYJ E;  3H3A A;  5LHI B;  2WMO A;  5JDN A;  3KV6 A;  2CXL A;  1FEW A;  1BR1 A;  2PFV A;  3FB2 A;  3GWH A;  3PUR A;  4PAG A;  4QXH B;  3J7Y q;  3KV4 A;  3N2O A;  3OBV E;  2EHO C;  3TKL B;  1YW0 A;  4ADZ A;  4YJ2 E;  3NRY A;  2J1D G;  2D2S A;  5DQV A;  2ES0 A;  2H3R A;  3RKO A;  3UFE A;  3RYH E;  5CA0 E;  3KV5 A;  3OYX A;  2L9Q A;  3V5S A;  2Q9Q A;  2C5K T;  1MMN A;  2CLY B;  3PU8 A;  2DLR A;  4H63 V;  4YHJ A;  5LJM A;  2E9X D;  5KDM C;  1G8X A;  3PUG A;  5HXC A;  5LOV E;  3ZYM A;  4O4H E;  3GN5 B;  2H7V C;  3EDU A;  3D0T A;  3ZPO A;  4H9P C;  5H6Q B;  5LP6 E;  2MTQ A;  4UXN B;  1LRZ A;  4P0B A;  4UF0 A;  4EYU A;  2D5U A;  3I0Q A;  3ZC0 A;  1U5P A;  5FY1 A;  2V7L A;  4KMC A;  2DNX A;  2DHR A;  4OFZ A;  1WLX A;  4DND A;  2IAK A;  3CX6 B;  2CLY C;  4BA9 A;  3LG7 A;  3ONX A;  4GK5 E;  2LOP A;  2VB6 A;  2HH7 A;  2NTY A;  1BR2 A;  1D1A A;  3AAA B;  3NBX X;  2WWU A;  2VAS A;  3KFW X;  3T8O A;  2IC6 A;  2ZM2 A;  4ANJ A;  2V7K A;  1S94 A;  4A56 A;  3AA1 B;  2Y6X A;  3OYZ A;  3ZCI A;  5JDF A;  3MA9 A;  4UEM A;  4ZI2 C;  2H7O A;  5JDM A;  2CA5 A;  4PW8 A;  2ZM8 A;  2JJ9 A;  4TV9 E;  4E7S A;  3RYI E;  2L3L A;  3Q5X A;  2XAG B;  2X9X A;  3DTO A;  3C4Z A;  5FNV E;  2JMH A;  3K3O A;  3NZQ A;  2UXN B;  3B13 A;  5JDG A;  3HI2 A;  2CXD A;  5FXZ A;  2YIN A;  5JQG E;  4U72 A;  2CE7 A;  2NW7 A;  3HKC E;  4UV9 B;  1WYB A;  5HXH A;  4L5G A;  2BVM A;  1KK7 A;  3SWH A;  5JRE A;  2Q9Q B;  2KLQ A;  3HL6 A;  5L3B B;  1D1B A;  5L3E B;  2A2F X;  4DMW A;  2XAS B;  4PFO A;  3K3N A;  1D0Y A;  2V7I A;  1QUU A;  2X51 A;  3UUX B;  4KP3 C;  4I55 E;  4IGU A;  5C8Y E;  5LXT E;  4CZZ B;  5E0O A;  5LG4 A;  1S35 A;  2IC9 A;  5M4Y A;  3MKD A;  3ZN0 B;  1MMG A;  3C51 A;  4O8S A;  4XZC A;  1D0Z A;  4ZI3 D;  4M1P A;  4UF0 B;  2XQY A;  5LBM A;  4ZI7 E;  1YKH B;  3C50 A;  3U3I A;  1YKE B;  3EUH A;  4WBO A;  5JR9 A;  4BAY B;  5F3J A;  1ZEE A;  4PFP A;  2RP4 A;  3RYC E;  2C5I T;  4JUY A;  3ZMS B;  2ODV A;  2VKJ A;  2Q9Q C;  4IHJ E;  3E22 E;  4QX8 B;  1FMW A;  3U78 A;  4H9R C;  2DWG A;  4MAL A;  3N9P A;  2LEH A;  4ILU A;  3UUN A;  2HPJ A;  2SPC A;  3AAI A;  1VOM A;  4AKL A;  3CPZ A;  3VKG A;  1B7T A;  1IZN B;  5FP3 A;  2ZM0 A;  3CML A;  5JH7 E;  2BVL A;  2LM9 A;  3FBL A;  4QXC B;  2M67 A;  4AXP A;  4CXY A;  5HWY A;  4WW0 A;  4EYY R;  4GYS A;  4IST A;  4NUU A;  4O2A E;  2MYS A;  2W62 A;  5LA6 E;  2D0U A;  4GYR A;  3N9Q A;  3S4U A;  2KT9 A;  3CVR A;  4HTE A;  2ACX A;  4P0A A;  2CXF A;  2B1E A;  2PJQ A;  5LJN A;  4HE8 A;  2K5B B;  3FXD B;  4EAH A;  2VK9 A;  3N5L A;  1HG5 A;  4H9N C;  3E08 A;  4I43 B;  2X66 A;  3ZYL A;  3V5U A;  2DWK A;  2JMK A;  1ZV4 X;  3EVY A;  5LCY A;  3BQI A;  5H6R B;  5LGN B;  3RRW A;  2CWO A;  2LSY A;  3WI3 A;  5FYM A;  3B57 A;  3MAC A;  1IAP A;  3OJA A;  5L2L A;  5CB4 E;  2YK0 A;  2K48 A;  3N9M A;  4C90 A;  2PBI A;  4V1A v;  4DBQ A;  3N2G E;  1BR0 A;  5DJQ C;  4UIG A;  5HXE A;  5J2T E;  1MNE A;  1V9D A;  2I59 A;  3FBZ A;  3GMI A;  3MZK B;  5TAO A;  4BJN A;  5EK2 A;  5LNK A;  4CI2 B;  2NW9 A;  4KUM B;  2IW5 B;  3LK3 B;  3IHR A;  5JR9 B;  4I50 E;  2KND A;  3HR0 A;  4IE7 A;  3N2K E;  2XAH B;  1HF8 A;  2JQQ A;  2LSJ A;  4TX5 A;  1U4Q A;  3IF8 B;  1MMD A;  4IIJ E;  3C4W A;  3K8P C;  4AQF C;  1MIY A;  3PUA A;  3QK6 A;  2LOS A;  5EK4 A;  4UEL A;  3QC9 A;  1HG2 A;  4IE6 A;  4KBM B;  4C91 A;  3KBT A;  3JC6 C;  4JEU B;  4WBN E;  2EHO D;  2VKD A;  4IE0 A;  2NW8 A;  4ZS3 A;  2MOZ A;  2HPL A;  4BJM A;  5ADX L;  4AKI A;  5JR9 C;  3ZMV B;  2VKO A;  1G73 A;  4CXW A;  3AA0 B;  3BK9 A;  2NOX A;  2Z6E A;  3KIN B;  3HKD E;  4UVA B;  3PTR B;  4FI5 A;  4PJJ A;  5FY0 A;  4MHC A;  4QKN A;  5JDQ A;  1SA0 E;  5J1G A;  1HTJ F;  5LHG B;  3ESL A;  2CWY A;  4JLE A;  3J9X 1;  4P09 A;  1KNZ A;  2V7M A;  5FXV A;  1YD8 G;  2C0S A;  3N9L A;  3CQG B;  3CX8 B;  4U74 A;  5JDL A;  4PK4 A;  3ZCJ A;  4UVB B;  3DP7 A;  4QX7 B;  3AA6 B;  2LT3 A;  4AI6 A;  2QA7 A;  3ZEF B;  4AQF A;  4AKR B;  3IBP A;  3ZMT B;  3CX7 B;  5HXS A;  2E9X B;  4EOZ B;  3KV9 A;  4EXT A;  3FXE B;  1US7 B;  3EDV A;  1UX5 A;  2LHN A;  3AAE B;  5FXW A;  3Q9D A;  3Q2M A;  5LBQ B;  2VWA A;  1IJ6 A;  2X0L B;  4HGA A;  3QUJ A;  4CXX A;  4G63 A;  4IE4 A;  4OYK A;  4PK6 A;  4ZOL E;  3ZMU B;  3KBU A;  2P9B A;  3I1A A;  1NAF A;  5KMG P;  3ETU A;  4ZI2 D;  1UCU A;  3CWZ B;  2KXP B;  3PU3 A;  4GOU A;  1WR6 A;  1IJ5 A;  1X79 A;  3CQX C;  3L09 A;  5BMV E;  5J2U E;  2CMR A;  4PK5 A;  4OHF A;  3F2E A;  3PDY A;  2XAJ B;  2X9W A;  2YU2 A;  3LFM A;  2N2N A;  5ETW A;  5KX5 E;  2E9X C;  2KWI B;  3LBX A;  2QGS A;  3UUM A;  2Y8D A;  5DAB A;  4X20 E;  1O3X A;  4PNI A;  4K0U A;  2N1G A;  4O4I E;  2KZ7 B;  4H9S E;  5L3D B;  3R84 B;  3SOL A;  4DMV A;  5LHH B;  4WNK A;  4F6R C;  4O4J E;  3RC8 A;  1MND A;  2V7J A;  1CUN A;  4UVC B;  3FHN A;  2CM0 A;  1ZHC A;  5JVD E;  4Z8X A;  3MJX A;  4CI3 B;  4AKH A;  2X68 A;  2X9Y A;  3P7I A;  3ZMZ B;  2ODU A;  1D1C A;  2L8K A;  3ZLI A;  3AA7 B;  2LSK A;  2JRK A;  1H7C A;  3ZJ2 A;  4QXB B;  5HWX A;  2XUE A;  5FMN A;  4DBR A;  4TN7 B;  2D0T A;  2PG8 A;  2BZB A;  5GON E;  4ZHQ E;  4MFR A;  3C4X A;  3SRZ A;  2N9D A;  1LVF A;  2NTX A;  2E8I A;  4H9Q C;  1HFA A;  5IYZ E;  4ERR A;  2K9A A;  1LVK A;  5L3G B;  4TV8 E;  2XAQ B;  2E9X A;  3N9N A;  4EB6 E;  4IE5 A;  4EIW A;  3C64 A;  2Q9Q D;  2ZMA A;  4E7Z A;  2XTL A;  4IDZ A;  3ETV A;  1WYC A;  4XBF B;  2XAF B;  4J2C A;  1E1H B;  1Z0P A;  2K24 A;  2A72 A;  3KVA A;  4PJL A;  3PUQ A;  3LK2 B;  4PJM A;  5EZY E;  5LGT B;  4B6X A;  5FY7 A;  5HAX A;  5CA1 E;  3VU7 H;  3AVR A;  2YU1 A;  4OYJ A;  2MBG A;  4MBQ A;  3HKE E;  3DJB A;  3VKH A;  5L3C B;  3MK7 C;  4N78 D;  1HCI A;  3O1H A;  1ZKE A;  3BQK A;  2LJL A;  3I9W A;  3ZYK A;  3R6N A;  3LBX B;  2LSG A;  4HN9 A;  5DQW A;  3CQC B;  3P8C D;  5IHY A;  3UT5 E;  4MLK A;  4AKG A;  2CCQ A;  3C98 B;  2OA5 A;  2ZLY A;  3NRX A;  4L9I A;  3ANW A;  2DCF A;  4CQI A;  2EHO A;  4QWN B;  4ZI3 C;  4UV8 B;  5HYA A;  3ZC1 A;  4G2A A;  4ISS A;  4YJ3 E;  5JRC A;  3KDS E;  1VRB A;  4FJO A;  3ZJ1 A;  2V26 A;  3H37 A;  4GIW A;  4H9O C;  4JEH B;  2WM9 A;  2A3D A;  5AFU L;  4X1I E;  1OXZ A;  2X9H A;  4DVD A;  2KMF A;  2BDE A;  2LHR A;  5HXR A;  1QSD A;  4TZ4 C;  2KWH A;  2V1D B;  3O1J A;  3BQL A;  2VKH A;  5EK3 A;  2XHE B;  5A1L A;  4QHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...