2LTKA

Solution structure of a monomeric truncated mutant of trypanosoma brucei 1-c-grx1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
110
Chain Sequence
GAMVKKDIDDTIKSEDVVTFIKGLPEAPMCAYSKRMIDVLEALGLEYTSFDVLAHPVVRSYVKEVSEWPTIPQLFIKAEFVGGLDIVTKMLESGDLKKMLRDKGITCRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mono-cysteine glutaredoxin
publication title Iron-Sulfur Cluster Binding by Mitochondrial Monothiol Glutaredoxin-1 of Trypanosoma brucei: Molecular Basis of Iron-Sulfur Cluster Coordination and Relevance for Parasite Infectivity.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 29
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ltkA01
4EE0A 3GH6A 1B9XC 4J2FA 1B48A 1JLWA 1K0DA 4NHZA 1J0FA 4YQUA 3GNJA 3HVVA 5HQPA 1OKDA 3BOAA 1MD4A 2XPDA 2H76A 3KMOA 5IIZA 5EL8A 1FW1A 2PWJA 5ENUA 4KW6A 2RLIA 2YV7A 3L9UA 2YOIA 4V1Ap 1WRYA 4O7HA 1DE2A 1PX6A 2XHFA 1Y25A 5AN1A 1Z6NA 5GSSA 1BEDA 5GAPD 3HY2A 4ML6A 1F9MA 3UJ1A 2ALBA 1QFNA 1XFLA 6GSXA 4MLYA 2O89A 4NHWA 1SJZA 1UC7A 3ERGA 2CAQA 4MF6A 8GSSA 4OFTA 2O87A 3HVXA 1Z7PA 3Q19A 1FHEA 1XVWA 5IO2A 4YQMA 2B3SA 1SKWB 2BJXA 3TKSA 4KAEA 2A4VA 4ZB6A 3KGKA 5ECOB 1FO5A 3RPNA 1M99A 4HZ4A 4E8EA 1PN9A 3P90A 4K8MA 12GSA 3ZFBA 2OADA 3FR3A 1RQMA 3N5OA 3VLNA 2DC5A 4QL7A 2P0GA 2X8HA 5KN2A 1USBA 3CRUA 4I8BA 1M2AA 4KDXA 4XIHA 1TTZA 3FZ4A 2CZ2A 3IOSA 4DSQA 3MWHA 3DYRA 4HJ2A 4KDYA 2MBTA 4GWRA 4Q5FA 1V57A 4H86A 3A2WA 3DD3A 3PH9A 2AUVA 1A8LA 1A24A 1OVNA 2XC2A 1RW1A 4OFMA 5DQYA 3L4NA 4K7IA 4XCSA 2NVLA 5HR3A 5J9BA 3GHAA 3ZYWA 2I1UA 3M3MA 4XRAA 1R26A 4PUAA 1SENA 3GL3A 3QAGA 2HZEA 2AB6A 2M72A 3C1RA 4MZCA 3RBTA 1Q98A 5DJLA 2DJJA 5DJMA 4OFNA 4K7OA 3VWWA 1OE7A 4HI7A 3KMNA 2VD1A 2CVDA 2C3TA 3BCKA 2AJQB 4Q5RA 1K0BA 2C80A 1TDIA 5D9WA 4MK3A 4ZXGA 1VF2A 1K3YA 2ON5A 5B6MA 1XPVA 3JCML 2YWOA 3LXTA 2YWMA 3GRXA 3KP9A 3U6VA 2YP6A 5LCZA 2WULA 1AQXA 4ZBAA 2K8VA 1TRUA 4IJ3A 19GSA 3A5WA 3ME7A 1U3IA 4PURA 5DALB 2CVBA 4PNFA 6GSUA 2N5BA 4ZILA 4DEJA 1QK8A 2H1AA 2J9HA 5IMFA 1A23A 2B1KA 3PINA 3ZLPA 3QAVA 3ZFLA 1G0TA 4I2UA 3W8SA 3N9JA 3VPTA 4TW5A 3US3A 3APSA 2HI7A 4EXJA 2BMXA 1FAAA 2TRCP 1LU4A 5EPFA 3O6TA 1ZCPA 1F37A 1RK4A 3L9SA 4YAPA 1C72A 2DMLA 1A2MA 1SD9A 3K8NA 2C3QA 4OCFA 5KEJA 1K0CA 2WB9A 3F8UA 3P7XA 1O6JA 3QD9A 1OC3A 2CVKA 4JU5A 3H79A 5D96A 2YN1A 2DJ2A 5J3RA 1M0UA 4KE3A 5DAKB 1ZL9A 1SK0A 3DRNA 1R4WA 1X5CA 4MMMA 2IMIA 1MDKA 2FWFA 3TGZA 3A2VA 1NM3A 1PL1A 5C00A 4ISDA 4NV2A 4ACSA 1BYEA 2YV9A 3ZREA 3GKKA 2EC4A 3HKRA 5DCHA 2HYXA 5G30A 3EURA 1PRXA 2A2RA 1KEBA 3CSHA 3H93A 1HNCA 4RI7A 1TI1A 1WOUA 1EP8A 2LRCA 3RAZA 2VUPA 1SK2A 3M0FA 4NXIA 5G5FA 1KBNA 3NOFA 3ZTLA 4K6XA 20GSA 2EIRA 4FO5A 4OD7A 2O7KA 1A0RP 9GSSA 4EL1A 1TRSA 4HJMA 2IJYA 1O7UA 3V1WA 2KP1A 3GL5A 4KX4A 5EVOA 1PSQA 1QXHA 1WMJA 1LBKA 3MDKA 1R7HA 5HFIA 4ZB8A 3F4SA 2DIZA 1OKTA 4FYBA 2QC7A 3UVHA 1B9YC 4MJCA 1GSQA 1Y6EA 1PKZA 3GKMA 1OE8A 2CX4A 4MPFA 2R3XA 2V41A 2H8LA 4TXOA 4K0NA 2C0GA 4HQSA 3ZVJD 1TRWA 2IMDA 18GSA 4AGSA 2YZUA 3NIVA 3KH9A 2AAWA 2PUKC 1ERTA 5GSTA 4YH2A 4YAVA 5AIVA 3MAKA 2GSQA 4TRXA 4WETA 3G7YA 2HE3A 3FK8A 4OWYA 1FOVA 4TR4A 2GQKA 2OE1A 5H5RA 3VFIA 2B5YA 1TJDA 2B6MA 2LQQA 2H1GA 5F07A 2E2GA 2VO4A 5B8AA 3FR6A 3FY7A 5D93A 3DXBA 5DAKA 4EUYA 2H66A 1VGLA 4XHMA 4AF2A 4RQRA 1VRSD 1MD3A 4OMVA 2MMOA 1GTBA 5D9XA 3QFBC 3ZMLA 5CRHA 3TKQA 4L8EA 2MMAA 3F9UA 5GAND 1V58A 4ZB9A 1T4YA 1TK0B 1N8JA 5FT3A 1SJIA 2C0FA 1Z9HA 3LFLA 1V98A 3H4KA 3UAPA 5CREA 1KTEA 5EY6A 3C1SA 1EV4A 2H6XA 1X9SB 4GF0A 5L71A 4MH2A 3EINA 4IJIA 3QFAC 3GUSA 3HA9A 3EYTA 2KHPA 1NSWA 1QGVA 3KJYA 5G1LA 3R2QA 1W4VA 1A2JA 4POLA 4KUNA 2FGXA 2GTUA 3D4MA 1XBSA 4TKYA 2PPTA 1AQVA 4X43A 2MZCA 2LSTA 4AJ8A 2GQMA 1T1VA 2ES7A 4Z7XA 4N30A 1T7PB 1ZYQB 2VL2A 5CRGA 2WJUA 3UOMA 4GSTA 4J57E 3KXOA 1ST9A 1I5GA 1SL0B 16GSA 4DSRA 1X5DA 3EU4A 5JCWA 2I4AA 2L57A 3IA1A 1QQ2A 1MEKA 2DIYA 3KM6A 2GVPA 3C8EA 2IPAA 3C7MA 11GSA 4JR6A 3TRXA 4KSOA 6GSVA 2HZEB 2A2SA 1H75A 3WGXA 2F8FA 4N11A 2JSYA 3DKSA 4ILFA 3VWVA 5B8BA 3A2XA 1OAZA 5GZZB 1GWCA 2M80A 1EWXA 1GUMA 4IQ1A 1FVJA 3QDNA 3LXZA 4KNDA 4ULXA 4GQFA 5G31A 4HDEA 4KGIA 5ECNB 2GSTA 4CDOA 1NHOA 2YCDA 1AAZA 2WRTA 3GN3A 4LL1B 2IMEA 1GNWA 4PQIA 3GSSA 1PL2A 5KN3A 4BVXA 1QUWA 1Z5YE 2DSAA 3M9KA 2VL3A 4F82A 2K6VA 5AISA 3A3TA 3WD6A 4G9HA 4EO3A 2R6KA 4POMA 2B7JA 2PVQA 4POKA 3G7IA 2X99A 4Q5QA 1URMA 1YZXA 3APOA 2IFQA 2FWHA 4JRRA 2EIOA 3GTUB 3HCZA 3IRAA 4LL4B 3E0UA 4BPYA 1BG5A 5B7CA 2MBSA 1XZOA 1M9AA 4V1Ag 4K7NA 4N0ZA 1XXUA 3ZITA 4L5OA 4ECBA 1PGTA 1GSUA 1T3BA 1YQ1A 2LJAA 1YF1A 1I9DA 5IPHA 4F2IA 2PVOC 3BD2A 3TRPA 1XWCA 1PKWA 2WDUA 5H5QA 6GSYA 3H8QA 4MZBA 1WWJA 3G7JA 4HU7A 4GTUA 3GKXA 3LSZA 5HR0A 4WEYA 4I5QA 1QMVA 3GH9A 2QSIA 2L6CA 3VI5A 3C71A 2JU5A 2E0QA 1AC1A 2RUFA 4GLTA 5DVBA 4NV5A 4ZIJA 5E4WA 4XS4B 3F4TA 1GSYA 3LORA 1DE1A 1ZYEA 4MCUA 2YWNA 3U5RE 1E6BA 1YF0A 1GSDA 4JE1A 4FH8A 2OE3A 4LMWA 2XBIA 4MF5A 2IWTA 2B5XA 2HFDA 4G19A 2ON7A 3TKSE 2HRFA 4JEDA 4LA1A 1AQWA 2R2JA 1XVQA 1TRVA 3APQA 1THXA 3DVXA 2GZPA 1SL1B 3DMLA 2B1LA 3CSJA 2F3MA 4K0GA 4GCIA 4I97A 3FKFA 5FWGA 1TI3A 3VWXA 4DSSA 1YEXA 2PN8A 3NZNA 3L78A 3VI7A 2VCXA 4TN8A 1O85A 1YEPA 4I6XA 2CAIA 2V6KA 1AIUA 3BCIA 2VM1A 5F8BA 1HYUA 2CQ9A 3CTFA 1XW5A 1YKCA 4AJ6A 3LG6A 2H0HA 3HDCA 2IMFA 17GSA 4NWYA 2GSRA 3TCOA 4PX1A 5ABRA 5HFKA 4QL9A 2OACA 2FA8A 2AYTA 4FYCA 3Q6OA 4MJEA 3GTUA 3EMPA 1M2DA 1TOFA 2HNLA 1DUGA 1XOBA 5CYYA 2YJ7A 4TXOB 2WFCA 1T8EB 1THOA 3GX0A 2H1DA 2LUSA 3HVSA 3HJPA 1VF3A 3O3TA 3FRCA 2IIYA 5CNWA 1K0OA 4JZQA 5IMAA 3HJOA 4F0BA 4P3YB 1Q4JA 3EE2A 5F0GA 2VOCA 2O8VB 4TR0A 4V2NA 4MPGA 2K8SA 2H72A 1JZDA 4IQAA 2FA4A 2GQLA 4K9ZA 2H30A 3FZAA 3GSTA 4KDUA 3DVWA 5G2ZA 3J7Yk 5G1KA 2VCZA 3KZQA 2LEGA 1J9BA 3Q18A 5J9CA 1X9MB 2GGTA 4FYUA 2V32A 5AGYA 2B7KA 4XS4A 2FD3A 1IYHA 2L59A 3ME8A 2LS5A 1YY7A 2TRXA 3F0IA 3J7Yb 4ZBDA 2N5AA 2L5OA 2VCVA 3M9JA 4G2EA 5J5NA 2AV4A 1GSFA 4IGJA 4NAXA 2CX3A 3GMFA 1MTCA 1O8XA 2VLUA 2FWGA 4Q5NA 5J41A 1F3AA 1KNGA 1PA3A 5ECPB 3PGTA 1TK5B 2VIMA 4E8HA 2G2QA 1O73A 3QAWA 3TJGA 2YPMA 1Z6MA 1EV9A 3UMAA 3KD0A 1HD2A 1FG4A 1GUHA 2M46A 1G7EA 2LRTA 1OC9A 2HT9A 2PERA 3GURA 2G0FA 1ERWA 1EOHA 3WGDA 3BBYA 5KN0A 3KP8A 3RPPA 1S3AA 1ERUA 1B4PA 2LNSA 2GZYA 5H5SA 3WGEA 4EDYA 4OO5A 1JLVA 3TJFA 4V2MA 1JZWA 1FB0A 3KTLA 2IL3A 3TKSC 4LMVA 4N0VA 1VF1A 1T4ZA 2PU9C 5KN1A 2GDRA 4WBJA 3TOTA 4JR4A 1V40A 2P5RA 5ELAA 2VCTA 4ZL8A 3IE3A 2H6ZA 1K0AA 1GTAA 1OC8A 5DQSA 4IP6A 3F3RA 3I69A 4ECIA 4NMUA 4PQ1A 2WZ9A 3SBCA 3VURA 4WR5A 2JZSA 5DCGA 2IMKA 1GRXA 2H19A 1F6MC 1ILOA 4KA0A 1WE0A 2KOKA 3ZIVA 1BQ7A 2JACA 1YKAA 4TR1B 4O32A 6GSSA 3CTGA 1SL2B 3PR8A 5CRWA 3HXSA 2VD0A 3AY8A 1GSEA 3O76A 4PQHA 3KIJA 5LD0A 3IPZA 2J23A 2F8AA 5G5EA 1MDJA 3TKPA 2R37A 3I9V2 4HU9A 3IC4A 4KH7A 2LQOA 3LQ7A 2GT5A 4BWSA 2YJHA 3GFKA 2VCWA 4L0UA 2IFQB 1AXDA 3M1GA 1K3OA 3CMIA 4D73B 1JFUA 4ECJA 1S3DA 1SYXA 1X9WB 3GX8A 4FIWA 3TKRA 3MNGA 5IOWA 3CRTA 4BA7A 3LGCA 13GSA 5DDLA 5CAXA 5CRDA 1XW6A 5AIXA 2LV3A 4XS1A 1S3CA 4IW9A 5CP1A 3FHKA 3D4TA 1GTUA 1A8YA 1F3BA 1TP9A 3W8JA 5ECMB 4WKWA 5IOXA 2L5LA 5FHIA 1GULA 3HD5A 1CQHA 2DLXA 2MYGA 2ZUPA 4POBA 3IAM2 4ZBBA 5INYA 3W6GA 1F2EA 4TVEA 1GNEA 1FB6A 5IO0A 1ON4A 6GSWA 1E2YA 2QGVA 3ZVJA 2L4CA 1AW9A 2GSSA 2E2MA 5ELGA 1SK1A 2JL4A 3VWUA 5E59A 2F51A 2KP2A 1PMTA 3GIXA 5ECKB 5IPGA 4WF4A 5F05A 1WJKA 3HJMA 2HZFA 1WPIA 1EZKA 3FW2A 5ECHB 2C0EA 3HYPA 2X8CA 5HR1A 3ZZXA 4G10A 2XBQA 4TR1A 5CO3A 2OE0A 2O85A 1PX7A 1SYRA 2GZZA 3EMXA 4MABA 2CV4A 4DSSB 2QKEA 2YANA 5COHA 4EVMA 3D6IA 4EDZA 4ZL7A 4IVFA 4BWQA 3IBHA 1U6TA 2YWIA 4MA9A 2NTOA 2KLXA 2H1BA 2HSYA 3TB2A 2V1MA 3FEUA 3IHQA 2V6OA 3H1NA 3ISOA 4HEA2 4O92A 1LJRA 2I9HA 1TK8B 2C3NA 4IS0A 4HZ2A 4K1FA 2DJ3A 4D73A 4EF0A 1OYJA 3I43A 1TW9A 2B5EA 2H0IA 2E7PA 3EWLA 4RQXA 1DSBA 5A4WA 3QCPA 4GSNA 3UARA 3F3QA 2OJLA 3KTBA 3TJJA 5J4UA 1JZOA 2H74A 3GKNA 1PD21 3E9JB 1WIKA 1K0MA 1WP0A 4F9ZA 5ID2A 4RUVA 3UEMA 2MMZA 3WT1A 2FWEA 4EKZA 3KCMA 3F4RA 1M7TA 4PXOA 5JCGA 1EGOA 2HXKA 1W89A 2VLVA 2R4VA 1XW9A 2R5GA 3ED3A 3UVTA 2AHEA 3LWAA 1EGRA 2C0DA 1N2AA 7GSSA 5ECRB 2JZRA 1XIYA 1T00A 3D5JA 3OR5A 4BVYA 4IKHA 2VCQA 3EVIA 1GL8A 3BJ5A 3KEBA 2KUCA 1K0NA 2WCIA 2L6DA 1AUCA 4MP4A 2XPEA 1ACVA 1Z3EA 2H70A 4DVCA 2DJ0A 4BL7A 1SU9A 5JCUA 2OBIA 2DJKA 4IBPA 4QQ7A 2LJRA 1BJXA 1ERVA 1SJ6A 3DEXA 3GYKA 1R5PA 1FVKA 10GSA 4TOPA 4X0XA 1GLQA 5D73A 1M9BA 4GXZA 2OA7A 3CXGA 1OC9B 2EIQA 4KB3A 2BTOT 4MH3A 3IXRA 3IK9A 2D2ZA 1GH2A 3LJRA 2H01A 1MDIA 2WS2A 2HLSA 2HRNA 3P8WA 3GA4A 3TOUA 4IN0A 2X64A 4N10A 4TR3A 3WYWA 2PBJA 4YQVA 2ZNMA 4K2DA 3Q74A 2FCHA 4OO4A 4HUAA 3LYKA 1NHYA 4WF5A 4WR4A 1YJ6A 1PQNA 4EC0A 3F6DA 3TRQA 3EC3A 2FLSA 1BX9A 2IN3A 4KCEA 4KCAA 1ZGNA 1U87A 4GQCA 3D21A 2H71A 1O8WA 1UVZA 1JZRA 3HHVA 3ZL5A 3ZMKA 1ZOFA 1EP7A 3VPQA 4IP1A 5F06A 2RM5A 3RHBA 2VL9A 2LTKA 2VLTA 1A0FA 2PGTA 5ECIB 1GLPA 3FYGA 1SKRB 3HZ8A 2GLRA 1O81A 2OKAA 2VL2C 2F9SA 4CW9A 3TDGA 4O5RA 4ML1A 1ZZYA 4PNGA 2JSZA 3QMXA 1GTIA 3UIWA 3QR6A 4MDCA 5ECLB 2RUEA 1X5EA 1CQGA 1GUKA 1TU8A 5IMVA 3ZIJA 1J08A 2TIRA 2X8GA 3G9BA 3VK9A 4I2TA 1ABAA 1ZMAA 5JWOB 3FZ5A 4ZL9A 1M2BA 4HQZA 4F03A 5A5KA 2HSHA 22GSA 4AJ7A 1V9WA 1NW2A 5C04A 6GSTA 5HFGA 1U88A 4GRFA 4IHUA 2VM2A 3FR9A 4L0WA 3WT2A 2H0GA 1G6YA 1U3AA 3ERWA 3DGQA 5IMCA 2DBCA 2P5QA 2FNOA 1TU7A 2FUG2 1XOAA 3F6FA 4MZWA 4XTSA 4MJBA 1HNAA 3TUEA 2MMNA 3LEFA 3UBKA 5A4VA 2FY6A 4WXTA 3CYNA 4IELA 3UL3A 2NPBA 2REMA 4WBRD 2H75A 4KSMA 4XRDA 4ECCA 4HOJA 4X1UA 1EEMA 1XWKA 2CT6A 1B8XA 2ZCTA 1K3LA 5D9TA 2K9FA 14GSA 2C1YA 1G7OA 4J56E 2I81A 3CBUA 1XWAA 2Z9SA 2GS3A 5DBQA 2RM6A 1GSSA 5DALA 1Z7RA 3D0ZA 3FZ9A 3TJBA 3MSZA 3GV1A 2JADA 1B4QA 2DMMA 3IV4A 3EU3A 1GP1A 5IMZA 1EEJA 2LNTA 3F63A 4TXVA 2WGRA 2PMTA 3KH7A 3IDVA 1SD8A 4PGTA 5HR2A 3C73A 4XS6A 4NPBA 3RHCA 3HZ4A 3DIEA 1X0RA 4L5LA 1VF4A 3SWLA 3TJKA 4RI6A 1DBYA 1BAYA 3IR4A 1XWBA 2JZTA 3CSIA 1UA5A 1IYIA 2LRNA 4V2LA 1TKDB 1R5AA 3LYPA 5JWRB 4CHSA 5D8IA 2YNXA 3D22A 2YZHA 2C8UA 1ML6A 4F0CA 2DJ1A 2GT6A 5B6NA 2CZ3A 2I3YA 2P31A 4PUFC 2LJKA 1HQOA 3P2AA 2NDOA 2K18A 3I6AA 5D9VA 2OBKA 1SKSB 2V2GA 3ZRDA 5ID2B 3RDWA 4LLRA 3ERFA 3QPMA 2FHEA 4JBBA 3S9FA 4ID0A 4OCEA 3UBLA 4HS1A 2C4JA 3L9VA 2VAFA 1JHBA 2H6YA 3IAS2 1TXXA 2LKUA 2NBSA 4MJAA 1V2AA 5JWQB 5ECSA 5ECQB 1H4OA 2H73A 4GSSA 3L0HA 1G6WA 5A4UA 1EOGA 5LNKe 2CA8A 4MF7A 3IK7A 3M8NA 3E3EA 3QOUA 1HNBA 5IMDA 1XWGA 2L4QA 1XCCA 1YDKA 1UN2A 1A2LA 2N5FA 3DWVA 5IQYA 2RIIA 5IM9A
chains in the Genus database with same CATH superfamily
4EE0A 3GH6A 1B9XC 4J2FA 1B48A 1JLWA 1K0DA 4NHZA 1J0FA 4YQUA 3GNJA 3HVVA 5HQPA 1OKDA 3BOAA 1MD4A 2XPDA 2H76A 3KMOA 5IIZA 5EL8A 1FW1A 2PWJA 5ENUA 4KW6A 2RLIA 2YV7A 3L9UA 2YOIA 4V1Ap 1WRYA 4O7HA 1DE2A 1PX6A 2XHFA 1Y25A 5AN1A 1Z6NA 5GSSA 1BEDA 5GAPD 3HY2A 4ML6A 1F9MA 3UJ1A 2ALBA 1QFNA 1XFLA 6GSXA 4MLYA 2O89A 4NHWA 1SJZA 1UC7A 3ERGA 2CAQA 4MF6A 8GSSA 4OFTA 2O87A 3HVXA 1Z7PA 3Q19A 1FHEA 1XVWA 5IO2A 4YQMA 2B3SA 1SKWB 2BJXA 3TKSA 4KAEA 2A4VA 4ZB6A 3KGKA 5ECOB 1FO5A 3RPNA 1M99A 4HZ4A 4E8EA 1PN9A 3P90A 4K8MA 12GSA 3ZFBA 2OADA 3FR3A 4KF9A 1RQMA 3N5OA 3VLNA 2DC5A 4QL7A 2P0GA 2X8HA 5KN2A 1USBA 3CRUA 4I8BA 1M2AA 4KDXA 4XIHA 1TTZA 3FZ4A 2CZ2A 3IOSA 4DSQA 4EIQA 3MWHA 3DYRA 4HJ2A 4KDYA 2MBTA 4GWRA 4Q5FA 1V57A 4H86A 3A2WA 3DD3A 3PH9A 2AUVA 1A8LA 1A24A 1OVNA 2XC2A 1RW1A 4OFMA 5DQYA 3L4NA 4K7IA 4XCSA 2NVLA 5HR3A 5J9BA 3GHAA 3ZYWA 2I1UA 3M3MA 4XRAA 1R26A 4PUAA 1SENA 3GL3A 3QAGA 2HZEA 2AB6A 2M72A 3C1RA 4MZCA 3RBTA 3MIXA 1Q98A 5DJLA 2DJJA 5DJMA 4OFNA 4K7OA 3VWWA 1OE7A 4HI7A 3KMNA 2VD1A 2CVDA 2C3TA 3BCKA 2AJQB 4Q5RA 1K0BA 2C80A 1TDIA 5D9WA 4MK3A 4ZXGA 1VF2A 1K3YA 2ON5A 5B6MA 1XPVA 3JCML 2YWOA 3LXTA 2YWMA 3GRXA 3KP9A 1PN0A 1ZYNA 3U6VA 2YP6A 5LCZA 2WULA 1AQXA 4ZBAA 2K8VA 1TRUA 4IJ3A 19GSA 3A5WA 3ME7A 1U3IA 4PURA 5DALB 2CVBA 4PNFA 6GSUA 2N5BA 4ZILA 4DEJA 1QK8A 2H1AA 2J9HA 5IMFA 1A23A 2B1KA 3PINA 3ZLPA 3QAVA 3ZFLA 1G0TA 4I2UA 3W8SA 3N9JA 3VPTA 4TW5A 3US3A 3APSA 2HI7A 4EXJA 2BMXA 1FAAA 2TRCP 1LU4A 5EPFA 3O6TA 1ZCPA 1F37A 1RK4A 3L9SA 4YAPA 1C72A 2DMLA 1A2MA 1SD9A 4MNNA 4O5UA 3K8NA 2C3QA 4X4JA 4OCFA 5KEJA 1K0CA 2WB9A 3F8UA 3P7XA 1O6JA 3QD9A 1OC3A 2CVKA 4JU5A 3H79A 5D96A 2YN1A 2DJ2A 5J3RA 1M0UA 4KE3A 5DAKB 1ZL9A 1SK0A 3DRNA 1R4WA 1X5CA 4MMMA 2IMIA 1MDKA 2FWFA 3TGZA 3A2VA 4CY6A 1NM3A 1PL1A 5C00A 4ISDA 4NV2A 4ACSA 1BYEA 2YV9A 3ZREA 3GKKA 2EC4A 3HKRA 5DCHA 2HYXA 5G30A 3EURA 1PRXA 2A2RA 1KEBA 3CSHA 3H93A 1HNCA 4RI7A 1TI1A 1WOUA 1EP8A 2LRCA 3RAZA 2VUPA 1SK2A 3M0FA 4NXIA 5G5FA 1KBNA 3NOFA 3ZTLA 4K6XA 20GSA 2EIRA 4FO5A 4OD7A 2O7KA 1A0RP 9GSSA 4EL1A 1TRSA 4HJMA 2IJYA 1O7UA 3V1WA 2KP1A 3GL5A 4KX4A 5EVOA 1PSQA 1QXHA 1WMJA 1LBKA 3MDKA 1R7HA 5HFIA 4ZB8A 3F4SA 2DIZA 1OKTA 4FYBA 2QC7A 3UVHA 1B9YC 4MJCA 1GSQA 1Y6EA 1PKZA 3GKMA 1OE8A 2CX4A 4MPFA 2R3XA 2V41A 2H8LA 4TXOA 4K0NA 2C0GA 4HQSA 2QA1A 3ZVJD 1TRWA 4K2XA 2IMDA 18GSA 4AGSA 2YZUA 3NIVA 3KH9A 2AAWA 1XG8A 2PUKC 1ERTA 5GSTA 4YH2A 4YAVA 5AIVA 3MAKA 2GSQA 4TRXA 4WETA 3G7YA 2HE3A 3FK8A 4OWYA 1FOVA 5KOWA 4TR4A 2GQKA 3IHGA 4K5RA 2OE1A 5H5RA 3VFIA 2B5YA 1ZYPA 1FOHA 1TJDA 2B6MA 2LQQA 2H1GA 5F07A 2E2GA 2VO4A 5B8AA 3FR6A 3FY7A 5D93A 3DXBA 5DAKA 4EUYA 2H66A 1VGLA 4XHMA 4AF2A 4RQRA 1VRSD 1MD3A 4OMVA 2MMOA 1GTBA 5D9XA 3QFBC 3ZMLA 5CRHA 3TKQA 4L8EA 4EIPA 2MMAA 4USSA 3F9UA 5GAND 1V58A 4ZB9A 3CQFA 1T4YA 1TK0B 1N8JA 5FT3A 1SJIA 2C0FA 3IC8A 1Z9HA 3LFLA 1V98A 3H4KA 3UAPA 5CREA 1KTEA 5EY6A 3C1SA 1EV4A 2H6XA 1X9SB 4GF0A 5L71A 4MH2A 3EINA 4IJIA 3QFAC 3GUSA 3HA9A 3EYTA 2KHPA 1NSWA 1QGVA 3KJYA 5G1LA 3R2QA 1W4VA 1A2JA 4POLA 4KUNA 2FGXA 2GTUA 3D4MA 1XBSA 4TKYA 2PPTA 1AQVA 4X43A 2MZCA 2LSTA 1M3JA 4AJ8A 2GQMA 1T1VA 2ES7A 4Z7XA 4N30A 1T7PB 1ZYQB 2VL2A 5CRGA 2WJUA 3UOMA 4GSTA 4J57E 3KXOA 1ST9A 3EPTA 1I5GA 1SL0B 16GSA 4DSRA 1X5DA 3EU4A 5JCWA 2I4AA 2L57A 3IA1A 1QQ2A 1MEKA 2DIYA 3KM6A 2GVPA 3C8EA 2IPAA 3C7MA 11GSA 4JR6A 3TRXA 3PPUA 4KSOA 2QA2A 6GSVA 5KOXA 2HZEB 2A2SA 1H75A 3WGXA 2F8FA 4N11A 2JSYA 3DKSA 4ILFA 3VWVA 5B8BA 3A2XA 1OAZA 5GZZB 1GWCA 2M80A 1EWXA 1GUMA 4IQ1A 1FVJA 3QDNA 3LXZA 4KNDA 4ULXA 4GQFA 5G31A 4HDEA 4KGIA 5ECNB 2GSTA 4CDOA 1NHOA 2YCDA 1AAZA 2WRTA 3GN3A 4LL1B 2IMEA 1GNWA 4PQIA 3GSSA 1PL2A 5KN3A 4BVXA 1QUWA 1Z5YE 2DSAA 3M9KA 2VL3A 4F82A 3MYDA 2K6VA 5AISA 3A3TA 3WD6A 4G9HA 4EO3A 2HRAA 2R6KA 4POMA 2B7JA 2PVQA 4POKA 3G7IA 2X99A 4Q5QA 1URMA 1YZXA 3APOA 2IFQA 2FWHA 4JRRA 2EIOA 3GTUB 3HCZA 3IRAA 4LL4B 3E0UA 4BPYA 1BG5A 5B7CA 2MBSA 1XZOA 1M9AA 4V1Ag 4K7NA 4N0ZA 1XXUA 3ZITA 4L5OA 4ECBA 1PGTA 1GSUA 1T3BA 1YQ1A 2LJAA 1YF1A 1I9DA 5IPHA 4G0KA 4F2IA 2PVOC 3BD2A 3TRPA 1XWCA 1PKWA 2UZ8A 2WDUA 5H5QA 6GSYA 3H8QA 4MZBA 1WWJA 3G7JA 4HU7A 2DKIA 4GTUA 3GKXA 3LSZA 5HR0A 4WEYA 4FQUA 4I5QA 1QMVA 3GH9A 2QSIA 2L6CA 3VI5A 3C71A 2JU5A 2E0QA 1AC1A 2RUFA 4GLTA 5DVBA 4NV5A 4ZIJA 5E4WA 2DKHA 4XS4B 3F4TA 1GSYA 3LORA 1DE1A 1ZYEA 4MCUA 2YWNA 3U5RE 1E6BA 1YF0A 1GSDA 4JE1A 4FH8A 2OE3A 2HRKA 4LMWA 2XBIA 4MF5A 2IWTA 2B5XA 2HFDA 4G19A 2ON7A 3TKSE 2HRFA 4JEDA 4LA1A 1AQWA 2R2JA 1XVQA 1TRVA 3APQA 1THXA 3DVXA 2GZPA 1SL1B 3DMLA 2B1LA 3CSJA 2F3MA 4K0GA 4GCIA 4I97A 4HSCX 3FKFA 5FWGA 1TI3A 3VWXA 4ICYA 4DSSA 4G0IA 1YEXA 2A4HA 2PN8A 3NZNA 3L78A 3VI7A 2VCXA 4TN8A 1O85A 1YEPA 4I6XA 2CAIA 2V6KA 1AIUA 3BCIA 2VM1A 5F8BA 1HYUA 2CQ9A 3CTFA 1XW5A 1YKCA 4AJ6A 3LG6A 2H0HA 3HDCA 2IMFA 17GSA 4NWYA 2GSRA 3TCOA 4PX1A 5ABRA 5HFKA 4QL9A 2OACA 2FA8A 2AYTA 4FYCA 3Q6OA 4MJEA 3GTUA 3EMPA 1M2DA 1TOFA 2HNLA 3FMWA 1DUGA 1XOBA 5CYYA 2YJ7A 4TXOB 2WFCA 1T8EB 1THOA 3GX0A 2H1DA 2LUSA 3HVSA 3HJPA 1VF3A 3O3TA 3FRCA 2IIYA 5CNWA 1K0OA 4JZQA 5IMAA 3HJOA 4F0BA 4P3YB 1Q4JA 3EE2A 5F0GA 2VOCA 2O8VB 4TR0A 4V2NA 4MPGA 3HVNA 2K8SA 2H72A 1JZDA 4IQAA 2FA4A 2GQLA 4K9ZA 2H30A 3FZAA 3GSTA 4KDUA 3DVWA 5G2ZA 3J7Yk 5G1KA 2VCZA 3KZQA 2LEGA 1J9BA 3Q18A 5J9CA 1X9MB 2GGTA 4FYUA 2V32A 5AGYA 2B7KA 4XS4A 2FD3A 1IYHA 2L59A 3ME8A 2LS5A 1YY7A 2TRXA 3F0IA 3J7Yb 4ZBDA 2N5AA 2L5OA 2VCVA 3M9JA 4G2EA 5J5NA 2AV4A 1GSFA 4IGJA 4NAXA 2CX3A 3GMFA 1MTCA 1O8XA 2VLUA 2FWGA 4Q5NA 5J41A 5BMUA 1F3AA 1KNGA 1PA3A 5ECPB 3PGTA 1TK5B 1M3IA 2VIMA 4E8HA 2G2QA 1O73A 3QAWA 3TJGA 2YPMA 1Z6MA 1EV9A 3UMAA 3KD0A 1HD2A 1FG4A 1GUHA 2M46A 1G7EA 2LRTA 1OC9A 2HT9A 2PERA 3GURA 2G0FA 1ERWA 1EOHA 3WGDA 3BBYA 5KN0A 3KP8A 3RPPA 4G0LA 1S3AA 1ERUA 1B4PA 2LNSA 2GZYA 5H5SA 3WGEA 4EDYA 2R0CA 4OO5A 1JLVA 3TJFA 4V2MA 1JZWA 1FB0A 3KTLA 2IL3A 3TKSC 4LMVA 4N0VA 1VF1A 1T4ZA 2PU9C 5KN1A 2GDRA 4WBJA 3TOTA 4JR4A 1V40A 2P5RA 5ELAA 2VCTA 4ZL8A 3IE3A 2H6ZA 1K0AA 1GTAA 1OC8A 5DQSA 4IP6A 3F3RA 3I69A 4ECIA 4NMUA 4PQ1A 2WZ9A 3SBCA 3VURA 4WR5A 2JZSA 5DCGA 2IMKA 1GRXA 2H19A 1F6MC 1ILOA 4KA0A 1WE0A 2KOKA 3ZIVA 1BQ7A 2JACA 1YKAA 4TR1B 4O32A 6GSSA 3CTGA 1SL2B 3PR8A 5CRWA 3HXSA 2VD0A 3AY8A 1GSEA 3O76A 4BVXB 4PQHA 3KIJA 5LD0A 3IPZA 2J23A 2F8AA 5G5EA 1MDJA 3TKPA 2R37A 3I9V2 4HU9A 3IC4A 4KH7A 2LQOA 3LQ7A 2GT5A 4BWSA 2YJHA 3GFKA 2VCWA 4L0UA 2IFQB 1AXDA 3M1GA 1K3OA 3CMIA 4D73B 1JFUA 4ECJA 1S3DA 1SYXA 1X9WB 3GX8A 4FIWA 3TKRA 3MNGA 5IOWA 3CRTA 4BA7A 3LGCA 13GSA 5DDLA 5CAXA 5CRDA 1XW6A 5AIXA 2LV3A 4XS1A 1S3CA 4IW9A 5CP1A 3FHKA 3D4TA 1GTUA 1A8YA 1F3BA 1TP9A 3W8JA 5ECMB 4WKWA 5IOXA 2L5LA 5FHIA 1GULA 3HD5A 1CQHA 4BIKA 2DLXA 2MYGA 2ZUPA 4POBA 3IAM2 4ZBBA 5INYA 3W6GA 1F2EA 4TVEA 1GNEA 1FB6A 5IO0A 1ON4A 6GSWA 1E2YA 2QGVA 3ZVJA 2L4CA 1AW9A 2GSSA 2E2MA 5ELGA 1SK1A 2JL4A 3VWUA 5E59A 2F51A 2KP2A 1PMTA 3GIXA 5ECKB 5IPGA 4WF4A 5F05A 1WJKA 3HJMA 2HZFA 1WPIA 1EZKA 3FW2A 5ECHB 2C0EA 3HYPA 2X8CA 5HR1A 3ZZXA 4G10A 2XBQA 4TR1A 5CO3A 2OE0A 2O85A 1PX7A 1SYRA 2GZZA 3EMXA 4MABA 2CV4A 4DSSB 2QKEA 2YANA 5COHA 4EVMA 3D6IA 4EDZA 4ZL7A 4IVFA 4BWQA 3IBHA 1U6TA 2YWIA 4MA9A 4YKFA 2NTOA 2KLXA 2H1BA 2HSYA 3TB2A 2V1MA 3FEUA 3IHQA 2V6OA 3H1NA 3ISOA 4HEA2 4O92A 1LJRA 2I9HA 1TK8B 2C3NA 4IS0A 4Z2UA 4HZ2A 4K1FA 2DJ3A 4D73A 4EF0A 1OYJA 3I43A 1TW9A 2B5EA 3A5IA 2H0IA 1PFOA 2E7PA 3EWLA 4RQXA 1DSBA 5A4WA 3QCPA 4GSNA 3UARA 3F3QA 2OJLA 3KTBA 3TJJA 5J4UA 1JZOA 2H74A 3GKNA 1PD21 3E9JB 1WIKA 1K0MA 1WP0A 4F9ZA 5ID2A 4RUVA 3UEMA 2MMZA 3WT1A 2FWEA 4EKZA 3KCMA 3F4RA 1M7TA 4PXOA 5JCGA 1EGOA 2HXKA 1W89A 2VLVA 2R4VA 1XW9A 2R5GA 3ED3A 3UVTA 2AHEA 3LWAA 3R3EA 1EGRA 2C0DA 1N2AA 7GSSA 5ECRB 2R0PA 2JZRA 1XIYA 1T00A 3D5JA 3OR5A 4BVYA 4IKHA 2VCQA 3EVIA 1GL8A 3BJ5A 3KEBA 2KUCA 1K0NA 2WCIA 2L6DA 1AUCA 4MP4A 2XPEA 1ACVA 1Z3EA 2H70A 4DVCA 2DJ0A 4Z2RA 4BL7A 1SU9A 5JCUA 2OBIA 2DJKA 4IBPA 4QQ7A 2LJRA 1BJXA 1ERVA 1SJ6A 3DEXA 3GYKA 1R5PA 1FVKA 10GSA 4TOPA 4X0XA 4K5SA 1GLQA 5D73A 1M9BA 4GXZA 2OA7A 3CXGA 1OC9B 2EIQA 4KB3A 2BTOT 4MH3A 3IXRA 4YKGA 3IK9A 2D2ZA 1GH2A 3LJRA 2H01A 1MDIA 2WS2A 2HLSA 2X4AA 2HRNA 3P8WA 2HSMA 3GA4A 3TOUA 4IN0A 2X64A 4N10A 4TR3A 3WYWA 2PBJA 4YQVA 2ZNMA 4K2DA 3Q74A 2FCHA 4OO4A 4HUAA 5BRTA 3LYKA 1NHYA 4Z2TA 4WF5A 4WR4A 1YJ6A 1PQNA 4EC0A 3F6DA 3TRQA 3EC3A 2FLSA 1BX9A 2IN3A 4KCEA 4KCAA 1ZGNA 1U87A 4GQCA 3D21A 4A5PA 2H71A 1O8WA 1UVZA 1JZRA 3HHVA 3ZL5A 3ZMKA 1ZOFA 1EP7A 3VPQA 4IP1A 5F06A 2RM5A 3RHBA 2VL9A 2LTKA 2VLTA 1A0FA 2PGTA 5ECIB 1GLPA 2X49A 3FYGA 1SKRB 3LW9A 3HZ8A 2GLRA 1O81A 2OKAA 2VL2C 2F9SA 4CW9A 3TDGA 4O5RA 4ML1A 1ZZYA 4PNGA 2JSZA 3QMXA 1GTIA 2R0GA 3UIWA 3QR6A 4MDCA 5ECLB 2RUEA 1X5EA 1CQGA 1GUKA 1TU8A 5IMVA 3ZIJA 1J08A 2TIRA 2X8GA 3G9BA 3VK9A 4I2TA 1ABAA 1ZMAA 5JWOB 3FZ5A 4ZL9A 1M2BA 4HQZA 4F03A 5A5KA 2HSHA 22GSA 4AJ7A 1V9WA 1NW2A 5C04A 6GSTA 5HFGA 1U88A 4GRFA 4IHUA 2VM2A 4O5QA 3FR9A 4L0WA 3WT2A 2H0GA 1G6YA 1U3AA 3ERWA 3DGQA 5IMCA 2DBCA 2P5QA 2FNOA 1TU7A 2FUG2 1XOAA 3F6FA 4MZWA 4XTSA 4MJBA 1HNAA 3TUEA 2MMNA 3LEFA 3UBKA 5A4VA 2FY6A 4WXTA 3CYNA 4IELA 3UL3A 2NPBA 2REMA 4WBRD 2H75A 4KSMA 4XRDA 4ECCA 4HOJA 4X1UA 1EEMA 1XWKA 2CT6A 1B8XA 2A2PA 2ZCTA 1K3LA 5D9TA 2K9FA 14GSA 2C1YA 1G7OA 4J56E 2I81A 3CBUA 1XWAA 2Z9SA 2GS3A 5DBQA 2RM6A 1GSSA 5DALA 1Z7RA 3D0ZA 3FZ9A 3TJBA 3MSZA 3GV1A 2JADA 1B4QA 2DMMA 3IV4A 3EU3A 1GP1A 5IMZA 1EEJA 2LNTA 3F63A 4TXVA 2WGRA 2PMTA 3KH7A 3IDVA 1SD8A 4PGTA 5HR2A 3C73A 4XS6A 4NPBA 3RHCA 3HZ4A 3DIEA 1X0RA 4L5LA 1VF4A 3SWLA 3TJKA 4RI6A 1DBYA 1BAYA 3IR4A 1XWBA 2JZTA 3CSIA 4PTSA 1UA5A 1IYIA 2LRNA 4V2LA 1TKDB 1R5AA 3LYPA 5JWRB 4CHSA 5D8IA 2YNXA 3D22A 2YZHA 2C8UA 1ML6A 4F0CA 2DJ1A 2GT6A 5B6NA 2CZ3A 2I3YA 2P31A 4PUFC 2LJKA 1HQOA 3P2AA 2NDOA 2K18A 3I6AA 5D9VA 2OBKA 1SKSB 2V2GA 3ZRDA 5ID2B 3RDWA 4LLRA 3ERFA 3QPMA 2FHEA 4JBBA 3S9FA 4ID0A 4OCEA 3UBLA 4HS1A 2C4JA 3L9VA 2VAFA 1JHBA 2H6YA 3IAS2 1TXXA 4BVYB 2LKUA 2NBSA 4MJAA 1V2AA 5JWQB 5ECSA 5ECQB 1S3RA 1H4OA 2H73A 4GSSA 3L0HA 1G6WA 5A4UA 1EOGA 5LNKe 2CA8A 4CY8A 4MF7A 4BL7B 3IK7A 3M8NA 3E3EA 3QOUA 1HNBA 5IMDA 1XWGA 2L4QA 1XCCA 1YDKA 1UN2A 1A2LA 2N5FA 3DWVA 5IQYA 2RIIA 5IM9A
chains in the Genus database with same CATH topology
4EE0A 3GH6A 1B9XC 4J2FA 1B48A 1JLWA 1K0DA 4NHZA 1J0FA 4YQUA 3GNJA 3HVVA 5HQPA 1OKDA 3BOAA 1MD4A 2XPDA 2H76A 3KMOA 5IIZA 5EL8A 1FW1A 2PWJA 5ENUA 4KW6A 2RLIA 2YV7A 3L9UA 2YOIA 4V1Ap 1WRYA 4O7HA 1DE2A 1PX6A 2XHFA 1Y25A 5AN1A 1Z6NA 5GSSA 1BEDA 5GAPD 3HY2A 4ML6A 1F9MA 3UJ1A 2ALBA 1QFNA 1XFLA 6GSXA 4MLYA 2O89A 4NHWA 1SJZA 1UC7A 3ERGA 2CAQA 4MF6A 8GSSA 4OFTA 2O87A 3HVXA 1Z7PA 3Q19A 1FHEA 1XVWA 5IO2A 4YQMA 2B3SA 1SKWB 2BJXA 3TKSA 4KAEA 2A4VA 4ZB6A 3KGKA 5ECOB 1FO5A 3RPNA 1M99A 4HZ4A 4E8EA 1PN9A 3P90A 4K8MA 12GSA 3ZFBA 2OADA 3FR3A 4KF9A 1RQMA 3N5OA 3VLNA 2DC5A 4QL7A 2P0GA 2X8HA 5KN2A 1USBA 3CRUA 4I8BA 1M2AA 4KDXA 4XIHA 1TTZA 3FZ4A 2CZ2A 3IOSA 4DSQA 4EIQA 3MWHA 3DYRA 4HJ2A 4KDYA 2MBTA 4GWRA 4Q5FA 1V57A 4H86A 3A2WA 3DD3A 3PH9A 2AUVA 1A8LA 1A24A 1OVNA 2XC2A 1RW1A 4OFMA 5DQYA 3L4NA 4K7IA 4XCSA 2NVLA 5HR3A 5J9BA 3GHAA 3ZYWA 2I1UA 3M3MA 4XRAA 1R26A 4PUAA 1SENA 3GL3A 3QAGA 2HZEA 2AB6A 2M72A 3C1RA 4MZCA 3RBTA 3MIXA 1Q98A 5DJLA 2DJJA 5DJMA 4OFNA 4K7OA 3VWWA 1OE7A 4HI7A 3KMNA 2VD1A 2CVDA 2C3TA 3BCKA 2AJQB 4Q5RA 1K0BA 2C80A 1TDIA 5D9WA 4MK3A 4ZXGA 1VF2A 1K3YA 2ON5A 5B6MA 1XPVA 3JCML 2YWOA 3LXTA 2YWMA 3GRXA 3KP9A 1PN0A 1ZYNA 3U6VA 2YP6A 5LCZA 2WULA 1AQXA 4ZBAA 2K8VA 1TRUA 4IJ3A 19GSA 3A5WA 3ME7A 1U3IA 4PURA 5DALB 2CVBA 4PNFA 6GSUA 2N5BA 4ZILA 4DEJA 1QK8A 2H1AA 2J9HA 5IMFA 1A23A 2B1KA 3PINA 3ZLPA 3QAVA 3ZFLA 1G0TA 4I2UA 3W8SA 3N9JA 3VPTA 4TW5A 3US3A 3APSA 2HI7A 4EXJA 2BMXA 1FAAA 2TRCP 1LU4A 5EPFA 3O6TA 1ZCPA 1F37A 1RK4A 3L9SA 4YAPA 1C72A 2DMLA 1A2MA 1SD9A 4MNNA 4O5UA 3K8NA 2C3QA 4X4JA 4OCFA 5KEJA 1K0CA 2WB9A 3F8UA 3P7XA 1O6JA 3QD9A 1OC3A 2CVKA 4JU5A 3H79A 5D96A 2YN1A 2DJ2A 5J3RA 1M0UA 4KE3A 5DAKB 1ZL9A 1SK0A 3DRNA 1R4WA 1X5CA 4MMMA 2IMIA 1MDKA 2FWFA 3TGZA 3A2VA 4CY6A 1NM3A 1PL1A 5C00A 4ISDA 4NV2A 4ACSA 1BYEA 2YV9A 3ZREA 3GKKA 2EC4A 3HKRA 5DCHA 2HYXA 5G30A 3EURA 1PRXA 2A2RA 1KEBA 3CSHA 3H93A 1HNCA 4RI7A 1TI1A 1WOUA 1EP8A 2LRCA 3RAZA 2VUPA 1SK2A 3M0FA 4NXIA 5G5FA 1KBNA 3NOFA 3ZTLA 4K6XA 20GSA 2EIRA 4FO5A 4OD7A 2O7KA 1A0RP 9GSSA 4EL1A 1TRSA 4HJMA 2IJYA 1O7UA 3V1WA 2KP1A 3GL5A 4KX4A 5EVOA 1PSQA 1QXHA 1WMJA 1LBKA 3MDKA 1R7HA 5HFIA 4ZB8A 3F4SA 2DIZA 1OKTA 4FYBA 2QC7A 3UVHA 1B9YC 4MJCA 1GSQA 1Y6EA 1PKZA 3GKMA 1OE8A 2CX4A 4MPFA 2R3XA 2V41A 2H8LA 4TXOA 4K0NA 2C0GA 4HQSA 2QA1A 3ZVJD 1TRWA 4K2XA 2IMDA 18GSA 4AGSA 2YZUA 3NIVA 3KH9A 2AAWA 2PUKC 1ERTA 5GSTA 4YH2A 4YAVA 5AIVA 3MAKA 2GSQA 4TRXA 4WETA 3G7YA 2HE3A 3FK8A 4OWYA 1FOVA 5KOWA 4TR4A 2GQKA 3IHGA 4K5RA 2OE1A 5H5RA 3VFIA 2B5YA 1ZYPA 1FOHA 1TJDA 2B6MA 2LQQA 2H1GA 5F07A 2E2GA 2VO4A 5B8AA 3FR6A 3FY7A 5D93A 3DXBA 5DAKA 4EUYA 2H66A 1VGLA 4XHMA 4AF2A 4RQRA 1VRSD 1MD3A 4OMVA 2MMOA 1GTBA 5D9XA 3QFBC 3ZMLA 5CRHA 3TKQA 4L8EA 4EIPA 2MMAA 4USSA 3F9UA 5GAND 1V58A 4ZB9A 1T4YA 1TK0B 1N8JA 5FT3A 1SJIA 2C0FA 3IC8A 1Z9HA 3LFLA 1V98A 3H4KA 3UAPA 5CREA 1KTEA 5EY6A 3C1SA 1EV4A 2H6XA 1X9SB 4GF0A 5L71A 4MH2A 3EINA 4IJIA 3QFAC 3GUSA 3HA9A 3EYTA 2KHPA 1NSWA 1QGVA 3KJYA 5G1LA 3R2QA 1W4VA 1A2JA 4POLA 4KUNA 2FGXA 2GTUA 3D4MA 1XBSA 4TKYA 2PPTA 1AQVA 4X43A 2MZCA 2LSTA 4AJ8A 2GQMA 1T1VA 2ES7A 4Z7XA 4N30A 1T7PB 1ZYQB 2VL2A 5CRGA 2WJUA 3UOMA 4GSTA 4J57E 3KXOA 1ST9A 3EPTA 1I5GA 1SL0B 16GSA 4DSRA 1X5DA 3EU4A 5JCWA 2I4AA 2L57A 3IA1A 1QQ2A 1MEKA 2DIYA 3KM6A 2GVPA 3C8EA 2IPAA 3C7MA 11GSA 4JR6A 3TRXA 3PPUA 4KSOA 2QA2A 6GSVA 5KOXA 2HZEB 2A2SA 1H75A 3WGXA 2F8FA 4N11A 2JSYA 3DKSA 4ILFA 3VWVA 5B8BA 3A2XA 1OAZA 5GZZB 1GWCA 2M80A 1EWXA 1GUMA 4IQ1A 1FVJA 3QDNA 3LXZA 4KNDA 4ULXA 4GQFA 5G31A 4HDEA 4KGIA 5ECNB 2GSTA 4CDOA 1NHOA 2YCDA 1AAZA 2WRTA 3GN3A 4LL1B 2IMEA 1GNWA 4PQIA 3GSSA 1PL2A 5KN3A 4BVXA 1QUWA 1Z5YE 2DSAA 3M9KA 2VL3A 4F82A 3MYDA 2K6VA 5AISA 3A3TA 3WD6A 4G9HA 4EO3A 2HRAA 2R6KA 4POMA 2B7JA 2PVQA 4POKA 3G7IA 2X99A 4Q5QA 1URMA 1YZXA 3APOA 2IFQA 2FWHA 4JRRA 2EIOA 3GTUB 3HCZA 3IRAA 4LL4B 3E0UA 4BPYA 1BG5A 5B7CA 2MBSA 1XZOA 1M9AA 4V1Ag 4K7NA 4N0ZA 1XXUA 3ZITA 4L5OA 4ECBA 1PGTA 1GSUA 1T3BA 1YQ1A 2LJAA 1YF1A 1I9DA 5IPHA 4G0KA 4F2IA 2PVOC 3BD2A 3TRPA 1XWCA 1PKWA 2UZ8A 2WDUA 5H5QA 6GSYA 3H8QA 4MZBA 1WWJA 3G7JA 4HU7A 2DKIA 4GTUA 3GKXA 3LSZA 5HR0A 4WEYA 4FQUA 4I5QA 1QMVA 3GH9A 2QSIA 2L6CA 3VI5A 3C71A 2JU5A 2E0QA 1AC1A 2RUFA 4GLTA 5DVBA 4NV5A 4ZIJA 5E4WA 2DKHA 4XS4B 3F4TA 1GSYA 3LORA 1DE1A 1ZYEA 4MCUA 2YWNA 3U5RE 1E6BA 1YF0A 1GSDA 4JE1A 4FH8A 2OE3A 2HRKA 4LMWA 2XBIA 4MF5A 2IWTA 2B5XA 2HFDA 4G19A 2ON7A 3TKSE 2HRFA 4JEDA 4LA1A 1AQWA 2R2JA 1XVQA 1TRVA 3APQA 1THXA 3DVXA 2GZPA 1SL1B 3DMLA 2B1LA 3CSJA 2F3MA 4K0GA 4GCIA 4I97A 3FKFA 5FWGA 1TI3A 3VWXA 4ICYA 4DSSA 4G0IA 1YEXA 2A4HA 2PN8A 3NZNA 3L78A 3VI7A 2VCXA 4TN8A 1O85A 1YEPA 4I6XA 2CAIA 2V6KA 1AIUA 3BCIA 2VM1A 5F8BA 1HYUA 2CQ9A 3CTFA 1XW5A 1YKCA 4AJ6A 3LG6A 2H0HA 3HDCA 2IMFA 17GSA 4NWYA 2GSRA 3TCOA 4PX1A 5ABRA 5HFKA 4QL9A 2OACA 2FA8A 2AYTA 4FYCA 3Q6OA 4MJEA 3GTUA 3EMPA 1M2DA 1TOFA 2HNLA 3FMWA 1DUGA 1XOBA 5CYYA 2YJ7A 4TXOB 2WFCA 1T8EB 1THOA 3GX0A 2H1DA 2LUSA 3HVSA 3HJPA 1VF3A 3O3TA 3FRCA 2IIYA 5CNWA 1K0OA 4JZQA 5IMAA 3HJOA 4F0BA 4P3YB 1Q4JA 3EE2A 5F0GA 2VOCA 2O8VB 4TR0A 4V2NA 4MPGA 2K8SA 2H72A 1JZDA 4IQAA 2FA4A 2GQLA 4K9ZA 2H30A 3FZAA 3GSTA 4KDUA 3DVWA 5G2ZA 3J7Yk 5G1KA 2VCZA 3KZQA 2LEGA 1J9BA 3Q18A 5J9CA 1X9MB 2GGTA 4FYUA 2V32A 5AGYA 2B7KA 4XS4A 2FD3A 1IYHA 2L59A 3ME8A 2LS5A 1YY7A 2TRXA 3F0IA 3J7Yb 4ZBDA 2N5AA 2L5OA 2VCVA 3M9JA 4G2EA 5J5NA 2AV4A 1GSFA 4IGJA 4NAXA 2CX3A 3GMFA 1MTCA 1O8XA 2VLUA 2FWGA 4Q5NA 5J41A 5BMUA 1F3AA 1KNGA 1PA3A 5ECPB 3PGTA 1TK5B 2VIMA 4E8HA 2G2QA 1O73A 3QAWA 3TJGA 2YPMA 1Z6MA 1EV9A 3UMAA 3KD0A 1HD2A 1FG4A 1GUHA 2M46A 1G7EA 2LRTA 1OC9A 2HT9A 2PERA 3GURA 2G0FA 1ERWA 1EOHA 3WGDA 3BBYA 5KN0A 3KP8A 3RPPA 4G0LA 1S3AA 1ERUA 1B4PA 2LNSA 2GZYA 5H5SA 3WGEA 4EDYA 2R0CA 4OO5A 1JLVA 3TJFA 4V2MA 1JZWA 1FB0A 3KTLA 2IL3A 3TKSC 4LMVA 4N0VA 1VF1A 1T4ZA 2PU9C 5KN1A 2GDRA 4WBJA 3TOTA 4JR4A 1V40A 2P5RA 5ELAA 2VCTA 4ZL8A 3IE3A 2H6ZA 1K0AA 1GTAA 1OC8A 5DQSA 4IP6A 3F3RA 3I69A 4ECIA 4NMUA 4PQ1A 2WZ9A 3SBCA 3VURA 4WR5A 2JZSA 5DCGA 2IMKA 1GRXA 2H19A 1F6MC 1ILOA 4KA0A 1WE0A 2KOKA 3ZIVA 1BQ7A 2JACA 1YKAA 4TR1B 4O32A 6GSSA 3CTGA 1SL2B 3PR8A 5CRWA 3HXSA 2VD0A 3AY8A 1GSEA 3O76A 4BVXB 4PQHA 3KIJA 5LD0A 3IPZA 2J23A 2F8AA 5G5EA 1MDJA 3TKPA 2R37A 3I9V2 4HU9A 3IC4A 4KH7A 2LQOA 3LQ7A 2GT5A 4BWSA 2YJHA 3GFKA 2VCWA 4L0UA 2IFQB 1AXDA 3M1GA 1K3OA 3CMIA 4D73B 1JFUA 4ECJA 1S3DA 1SYXA 1X9WB 3GX8A 4FIWA 3TKRA 3MNGA 5IOWA 3CRTA 4BA7A 3LGCA 13GSA 5DDLA 5CAXA 5CRDA 1XW6A 5AIXA 2LV3A 4XS1A 1S3CA 4IW9A 5CP1A 3FHKA 3D4TA 1GTUA 1A8YA 1F3BA 1TP9A 3W8JA 5ECMB 4WKWA 5IOXA 2L5LA 5FHIA 1GULA 3HD5A 1CQHA 2DLXA 2MYGA 2ZUPA 4POBA 3IAM2 4ZBBA 5INYA 3W6GA 1F2EA 4TVEA 1GNEA 1FB6A 5IO0A 1ON4A 6GSWA 1E2YA 2QGVA 3ZVJA 2L4CA 1AW9A 2GSSA 2E2MA 5ELGA 1SK1A 2JL4A 3VWUA 5E59A 2F51A 2KP2A 1PMTA 3GIXA 5ECKB 5IPGA 4WF4A 5F05A 1WJKA 3HJMA 2HZFA 1WPIA 1EZKA 3FW2A 5ECHB 2C0EA 3HYPA 2X8CA 5HR1A 3ZZXA 4G10A 2XBQA 4TR1A 5CO3A 2OE0A 2O85A 1PX7A 1SYRA 2GZZA 3EMXA 4MABA 2CV4A 4DSSB 2QKEA 2YANA 5COHA 4EVMA 3D6IA 4EDZA 4ZL7A 4IVFA 4BWQA 3IBHA 1U6TA 2YWIA 4MA9A 4YKFA 2NTOA 2KLXA 2H1BA 2HSYA 3TB2A 2V1MA 3FEUA 3IHQA 2V6OA 3H1NA 3ISOA 4HEA2 4O92A 1LJRA 2I9HA 1TK8B 2C3NA 4IS0A 4Z2UA 4HZ2A 4K1FA 2DJ3A 4D73A 4EF0A 1OYJA 3I43A 1TW9A 2B5EA 3A5IA 2H0IA 2E7PA 3EWLA 4RQXA 1DSBA 5A4WA 3QCPA 4GSNA 3UARA 3F3QA 2OJLA 3KTBA 3TJJA 5J4UA 1JZOA 2H74A 3GKNA 1PD21 3E9JB 1WIKA 1K0MA 1WP0A 4F9ZA 5ID2A 4RUVA 3UEMA 2MMZA 3WT1A 2FWEA 4EKZA 3KCMA 3F4RA 1M7TA 4PXOA 5JCGA 1EGOA 2HXKA 1W89A 2VLVA 2R4VA 1XW9A 2R5GA 3ED3A 3UVTA 2AHEA 3LWAA 3R3EA 1EGRA 2C0DA 1N2AA 7GSSA 5ECRB 2R0PA 2JZRA 1XIYA 1T00A 3D5JA 3OR5A 4BVYA 4IKHA 2VCQA 3EVIA 1GL8A 3BJ5A 3KEBA 2KUCA 1K0NA 2WCIA 2L6DA 1AUCA 4MP4A 2XPEA 1ACVA 1Z3EA 2H70A 4DVCA 2DJ0A 4Z2RA 4BL7A 1SU9A 5JCUA 2OBIA 2DJKA 4IBPA 4QQ7A 2LJRA 1BJXA 1ERVA 1SJ6A 3DEXA 3GYKA 1R5PA 1FVKA 10GSA 4TOPA 4X0XA 4K5SA 1GLQA 5D73A 1M9BA 4GXZA 2OA7A 3CXGA 1OC9B 2EIQA 4KB3A 2BTOT 4MH3A 3IXRA 4YKGA 3IK9A 2D2ZA 1GH2A 3LJRA 2H01A 1MDIA 2WS2A 2HLSA 2X4AA 2HRNA 3P8WA 2HSMA 3GA4A 3TOUA 4IN0A 2X64A 4N10A 4TR3A 3WYWA 2PBJA 4YQVA 2ZNMA 4K2DA 3Q74A 2FCHA 4OO4A 4HUAA 5BRTA 3LYKA 1NHYA 4Z2TA 4WF5A 4WR4A 1YJ6A 1PQNA 4EC0A 3F6DA 3TRQA 3EC3A 2FLSA 1BX9A 2IN3A 4KCEA 4KCAA 1ZGNA 1U87A 4GQCA 3D21A 4A5PA 2H71A 1O8WA 1UVZA 1JZRA 3HHVA 3ZL5A 3ZMKA 1ZOFA 1EP7A 3VPQA 4IP1A 5F06A 2RM5A 3RHBA 2VL9A 2LTKA 2VLTA 1A0FA 2PGTA 5ECIB 1GLPA 2X49A 3FYGA 1SKRB 3LW9A 3HZ8A 2GLRA 1O81A 2OKAA 2VL2C 2F9SA 4CW9A 3TDGA 4O5RA 4ML1A 1ZZYA 4PNGA 2JSZA 3QMXA 1GTIA 2R0GA 3UIWA 3QR6A 4MDCA 5ECLB 2RUEA 1X5EA 1CQGA 1GUKA 1TU8A 5IMVA 3ZIJA 1J08A 2TIRA 2X8GA 3G9BA 3VK9A 4I2TA 1ABAA 1ZMAA 5JWOB 3FZ5A 4ZL9A 1M2BA 4HQZA 4F03A 5A5KA 2HSHA 22GSA 4AJ7A 1V9WA 1NW2A 5C04A 6GSTA 5HFGA 1U88A 4GRFA 4IHUA 2VM2A 4O5QA 3FR9A 4L0WA 3WT2A 2H0GA 1G6YA 1U3AA 3ERWA 3DGQA 5IMCA 2DBCA 2P5QA 2FNOA 1TU7A 2FUG2 1XOAA 3F6FA 4MZWA 4XTSA 4MJBA 1HNAA 3TUEA 2MMNA 3LEFA 3UBKA 5A4VA 2FY6A 4WXTA 3CYNA 4IELA 3UL3A 2NPBA 2REMA 4WBRD 2H75A 4KSMA 4XRDA 4ECCA 4HOJA 4X1UA 1EEMA 1XWKA 2CT6A 1B8XA 2A2PA 2ZCTA 1K3LA 5D9TA 2K9FA 14GSA 2C1YA 1G7OA 4J56E 2I81A 3CBUA 1XWAA 2Z9SA 2GS3A 5DBQA 2RM6A 1GSSA 5DALA 1Z7RA 3D0ZA 3FZ9A 3TJBA 3MSZA 3GV1A 2JADA 1B4QA 2DMMA 3IV4A 3EU3A 1GP1A 5IMZA 1EEJA 2LNTA 3F63A 4TXVA 2WGRA 2PMTA 3KH7A 3IDVA 1SD8A 4PGTA 5HR2A 3C73A 4XS6A 4NPBA 3RHCA 3HZ4A 3DIEA 1X0RA 4L5LA 1VF4A 3SWLA 3TJKA 4RI6A 1DBYA 1BAYA 3IR4A 1XWBA 2JZTA 3CSIA 4PTSA 1UA5A 1IYIA 2LRNA 4V2LA 1TKDB 1R5AA 3LYPA 5JWRB 4CHSA 5D8IA 2YNXA 3D22A 2YZHA 2C8UA 1ML6A 4F0CA 2DJ1A 2GT6A 5B6NA 2CZ3A 2I3YA 2P31A 4PUFC 2LJKA 1HQOA 3P2AA 2NDOA 2K18A 3I6AA 5D9VA 2OBKA 1SKSB 2V2GA 3ZRDA 5ID2B 3RDWA 4LLRA 3ERFA 3QPMA 2FHEA 4JBBA 3S9FA 4ID0A 4OCEA 3UBLA 4HS1A 2C4JA 3L9VA 2VAFA 1JHBA 2H6YA 3IAS2 1TXXA 4BVYB 2LKUA 2NBSA 4MJAA 1V2AA 5JWQB 5ECSA 5ECQB 1H4OA 2H73A 4GSSA 3L0HA 1G6WA 5A4UA 1EOGA 5LNKe 2CA8A 4CY8A 4MF7A 4BL7B 3IK7A 3M8NA 3E3EA 3QOUA 1HNBA 5IMDA 1XWGA 2L4QA 1XCCA 1YDKA 1UN2A 1A2LA 2N5FA 3DWVA 5IQYA 2RIIA 5IM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EE0 A;  3GH6 A;  1B9X C;  4J2F A;  1B48 A;  1JLW A;  1K0D A;  4NHZ A;  1J0F A;  4YQU A;  3GNJ A;  3HVV A;  5HQP A;  1OKD A;  3BOA A;  1MD4 A;  2XPD A;  2H76 A;  3KMO A;  5IIZ A;  5EL8 A;  1FW1 A;  2PWJ A;  5ENU A;  4KW6 A;  2RLI A;  2YV7 A;  3L9U A;  2YOI A;  4V1A p;  1WRY A;  4O7H A;  1DE2 A;  1PX6 A;  2XHF A;  1Y25 A;  5AN1 A;  1Z6N A;  5GSS A;  1BED A;  5GAP D;  3HY2 A;  4ML6 A;  1F9M A;  3UJ1 A;  2ALB A;  1QFN A;  1XFL A;  6GSX A;  4MLY A;  2O89 A;  4NHW A;  1SJZ A;  1UC7 A;  3ERG A;  2CAQ A;  4MF6 A;  8GSS A;  4OFT A;  2O87 A;  3HVX A;  1Z7P A;  3Q19 A;  1FHE A;  1XVW A;  5IO2 A;  4YQM A;  2B3S A;  1SKW B;  2BJX A;  3TKS A;  4KAE A;  2A4V A;  4ZB6 A;  3KGK A;  5ECO B;  1FO5 A;  3RPN A;  1M99 A;  4HZ4 A;  4E8E A;  1PN9 A;  3P90 A;  4K8M A;  12GS A;  3ZFB A;  2OAD A;  3FR3 A;  1RQM A;  3N5O A;  3VLN A;  2DC5 A;  4QL7 A;  2P0G A;  2X8H A;  5KN2 A;  1USB A;  3CRU A;  4I8B A;  1M2A A;  4KDX A;  4XIH A;  1TTZ A;  3FZ4 A;  2CZ2 A;  3IOS A;  4DSQ A;  3MWH A;  3DYR A;  4HJ2 A;  4KDY A;  2MBT A;  4GWR A;  4Q5F A;  1V57 A;  4H86 A;  3A2W A;  3DD3 A;  3PH9 A;  2AUV A;  1A8L A;  1A24 A;  1OVN A;  2XC2 A;  1RW1 A;  4OFM A;  5DQY A;  3L4N A;  4K7I A;  4XCS A;  2NVL A;  5HR3 A;  5J9B A;  3GHA A;  3ZYW A;  2I1U A;  3M3M A;  4XRA A;  1R26 A;  4PUA A;  1SEN A;  3GL3 A;  3QAG A;  2HZE A;  2AB6 A;  2M72 A;  3C1R A;  4MZC A;  3RBT A;  1Q98 A;  5DJL A;  2DJJ A;  5DJM A;  4OFN A;  4K7O A;  3VWW A;  1OE7 A;  4HI7 A;  3KMN A;  2VD1 A;  2CVD A;  2C3T A;  3BCK A;  2AJQ B;  4Q5R A;  1K0B A;  2C80 A;  1TDI A;  5D9W A;  4MK3 A;  4ZXG A;  1VF2 A;  1K3Y A;  2ON5 A;  5B6M A;  1XPV A;  3JCM L;  2YWO A;  3LXT A;  2YWM A;  3GRX A;  3KP9 A;  3U6V A;  2YP6 A;  5LCZ A;  2WUL A;  1AQX A;  4ZBA A;  2K8V A;  1TRU A;  4IJ3 A;  19GS A;  3A5W A;  3ME7 A;  1U3I A;  4PUR A;  5DAL B;  2CVB A;  4PNF A;  6GSU A;  2N5B A;  4ZIL A;  4DEJ A;  1QK8 A;  2H1A A;  2J9H A;  5IMF A;  1A23 A;  2B1K A;  3PIN A;  3ZLP A;  3QAV A;  3ZFL A;  1G0T A;  4I2U A;  3W8S A;  3N9J A;  3VPT A;  4TW5 A;  3US3 A;  3APS A;  2HI7 A;  4EXJ A;  2BMX A;  1FAA A;  2TRC P;  1LU4 A;  5EPF A;  3O6T A;  1ZCP A;  1F37 A;  1RK4 A;  3L9S A;  4YAP A;  1C72 A;  2DML A;  1A2M A;  1SD9 A;  3K8N A;  2C3Q A;  4OCF A;  5KEJ A;  1K0C A;  2WB9 A;  3F8U A;  3P7X A;  1O6J A;  3QD9 A;  1OC3 A;  2CVK A;  4JU5 A;  3H79 A;  5D96 A;  2YN1 A;  2DJ2 A;  5J3R A;  1M0U A;  4KE3 A;  5DAK B;  1ZL9 A;  1SK0 A;  3DRN A;  1R4W A;  1X5C A;  4MMM A;  2IMI A;  1MDK A;  2FWF A;  3TGZ A;  3A2V A;  1NM3 A;  1PL1 A;  5C00 A;  4ISD A;  4NV2 A;  4ACS A;  1BYE A;  2YV9 A;  3ZRE A;  3GKK A;  2EC4 A;  3HKR A;  5DCH A;  2HYX A;  5G30 A;  3EUR A;  1PRX A;  2A2R A;  1KEB A;  3CSH A;  3H93 A;  1HNC A;  4RI7 A;  1TI1 A;  1WOU A;  1EP8 A;  2LRC A;  3RAZ A;  2VUP A;  1SK2 A;  3M0F A;  4NXI A;  5G5F A;  1KBN A;  3NOF A;  3ZTL A;  4K6X A;  20GS A;  2EIR A;  4FO5 A;  4OD7 A;  2O7K A;  1A0R P;  9GSS A;  4EL1 A;  1TRS A;  4HJM A;  2IJY A;  1O7U A;  3V1W A;  2KP1 A;  3GL5 A;  4KX4 A;  5EVO A;  1PSQ A;  1QXH A;  1WMJ A;  1LBK A;  3MDK A;  1R7H A;  5HFI A;  4ZB8 A;  3F4S A;  2DIZ A;  1OKT A;  4FYB A;  2QC7 A;  3UVH A;  1B9Y C;  4MJC A;  1GSQ A;  1Y6E A;  1PKZ A;  3GKM A;  1OE8 A;  2CX4 A;  4MPF A;  2R3X A;  2V41 A;  2H8L A;  4TXO A;  4K0N A;  2C0G A;  4HQS A;  3ZVJ D;  1TRW A;  2IMD A;  18GS A;  4AGS A;  2YZU A;  3NIV A;  3KH9 A;  2AAW A;  2PUK C;  1ERT A;  5GST A;  4YH2 A;  4YAV A;  5AIV A;  3MAK A;  2GSQ A;  4TRX A;  4WET A;  3G7Y A;  2HE3 A;  3FK8 A;  4OWY A;  1FOV A;  4TR4 A;  2GQK A;  2OE1 A;  5H5R A;  3VFI A;  2B5Y A;  1TJD A;  2B6M A;  2LQQ A;  2H1G A;  5F07 A;  2E2G A;  2VO4 A;  5B8A A;  3FR6 A;  3FY7 A;  5D93 A;  3DXB A;  5DAK A;  4EUY A;  2H66 A;  1VGL A;  4XHM A;  4AF2 A;  4RQR A;  1VRS D;  1MD3 A;  4OMV A;  2MMO A;  1GTB A;  5D9X A;  3QFB C;  3ZML A;  5CRH A;  3TKQ A;  4L8E A;  2MMA A;  3F9U A;  5GAN D;  1V58 A;  4ZB9 A;  1T4Y A;  1TK0 B;  1N8J A;  5FT3 A;  1SJI A;  2C0F A;  1Z9H A;  3LFL A;  1V98 A;  3H4K A;  3UAP A;  5CRE A;  1KTE A;  5EY6 A;  3C1S A;  1EV4 A;  2H6X A;  1X9S B;  4GF0 A;  5L71 A;  4MH2 A;  3EIN A;  4IJI A;  3QFA C;  3GUS A;  3HA9 A;  3EYT A;  2KHP A;  1NSW A;  1QGV A;  3KJY A;  5G1L A;  3R2Q A;  1W4V A;  1A2J A;  4POL A;  4KUN A;  2FGX A;  2GTU A;  3D4M A;  1XBS A;  4TKY A;  2PPT A;  1AQV A;  4X43 A;  2MZC A;  2LST A;  4AJ8 A;  2GQM A;  1T1V A;  2ES7 A;  4Z7X A;  4N30 A;  1T7P B;  1ZYQ B;  2VL2 A;  5CRG A;  2WJU A;  3UOM A;  4GST A;  4J57 E;  3KXO A;  1ST9 A;  1I5G A;  1SL0 B;  16GS A;  4DSR A;  1X5D A;  3EU4 A;  5JCW A;  2I4A A;  2L57 A;  3IA1 A;  1QQ2 A;  1MEK A;  2DIY A;  3KM6 A;  2GVP A;  3C8E A;  2IPA A;  3C7M A;  11GS A;  4JR6 A;  3TRX A;  4KSO A;  6GSV A;  2HZE B;  2A2S A;  1H75 A;  3WGX A;  2F8F A;  4N11 A;  2JSY A;  3DKS A;  4ILF A;  3VWV A;  5B8B A;  3A2X A;  1OAZ A;  5GZZ B;  1GWC A;  2M80 A;  1EWX A;  1GUM A;  4IQ1 A;  1FVJ A;  3QDN A;  3LXZ A;  4KND A;  4ULX A;  4GQF A;  5G31 A;  4HDE A;  4KGI A;  5ECN B;  2GST A;  4CDO A;  1NHO A;  2YCD A;  1AAZ A;  2WRT A;  3GN3 A;  4LL1 B;  2IME A;  1GNW A;  4PQI A;  3GSS A;  1PL2 A;  5KN3 A;  4BVX A;  1QUW A;  1Z5Y E;  2DSA A;  3M9K A;  2VL3 A;  4F82 A;  2K6V A;  5AIS A;  3A3T A;  3WD6 A;  4G9H A;  4EO3 A;  2R6K A;  4POM A;  2B7J A;  2PVQ A;  4POK A;  3G7I A;  2X99 A;  4Q5Q A;  1URM A;  1YZX A;  3APO A;  2IFQ A;  2FWH A;  4JRR A;  2EIO A;  3GTU B;  3HCZ A;  3IRA A;  4LL4 B;  3E0U A;  4BPY A;  1BG5 A;  5B7C A;  2MBS A;  1XZO A;  1M9A A;  4V1A g;  4K7N A;  4N0Z A;  1XXU A;  3ZIT A;  4L5O A;  4ECB A;  1PGT A;  1GSU A;  1T3B A;  1YQ1 A;  2LJA A;  1YF1 A;  1I9D A;  5IPH A;  4F2I A;  2PVO C;  3BD2 A;  3TRP A;  1XWC A;  1PKW A;  2WDU A;  5H5Q A;  6GSY A;  3H8Q A;  4MZB A;  1WWJ A;  3G7J A;  4HU7 A;  4GTU A;  3GKX A;  3LSZ A;  5HR0 A;  4WEY A;  4I5Q A;  1QMV A;  3GH9 A;  2QSI A;  2L6C A;  3VI5 A;  3C71 A;  2JU5 A;  2E0Q A;  1AC1 A;  2RUF A;  4GLT A;  5DVB A;  4NV5 A;  4ZIJ A;  5E4W A;  4XS4 B;  3F4T A;  1GSY A;  3LOR A;  1DE1 A;  1ZYE A;  4MCU A;  2YWN A;  3U5R E;  1E6B A;  1YF0 A;  1GSD A;  4JE1 A;  4FH8 A;  2OE3 A;  4LMW A;  2XBI A;  4MF5 A;  2IWT A;  2B5X A;  2HFD A;  4G19 A;  2ON7 A;  3TKS E;  2HRF A;  4JED A;  4LA1 A;  1AQW A;  2R2J A;  1XVQ A;  1TRV A;  3APQ A;  1THX A;  3DVX A;  2GZP A;  1SL1 B;  3DML A;  2B1L A;  3CSJ A;  2F3M A;  4K0G A;  4GCI A;  4I97 A;  3FKF A;  5FWG A;  1TI3 A;  3VWX A;  4DSS A;  1YEX A;  2PN8 A;  3NZN A;  3L78 A;  3VI7 A;  2VCX A;  4TN8 A;  1O85 A;  1YEP A;  4I6X A;  2CAI A;  2V6K A;  1AIU A;  3BCI A;  2VM1 A;  5F8B A;  1HYU A;  2CQ9 A;  3CTF A;  1XW5 A;  1YKC A;  4AJ6 A;  3LG6 A;  2H0H A;  3HDC A;  2IMF A;  17GS A;  4NWY A;  2GSR A;  3TCO A;  4PX1 A;  5ABR A;  5HFK A;  4QL9 A;  2OAC A;  2FA8 A;  2AYT A;  4FYC A;  3Q6O A;  4MJE A;  3GTU A;  3EMP A;  1M2D A;  1TOF A;  2HNL A;  1DUG A;  1XOB A;  5CYY A;  2YJ7 A;  4TXO B;  2WFC A;  1T8E B;  1THO A;  3GX0 A;  2H1D A;  2LUS A;  3HVS A;  3HJP A;  1VF3 A;  3O3T A;  3FRC A;  2IIY A;  5CNW A;  1K0O A;  4JZQ A;  5IMA A;  3HJO A;  4F0B A;  4P3Y B;  1Q4J A;  3EE2 A;  5F0G A;  2VOC A;  2O8V B;  4TR0 A;  4V2N A;  4MPG A;  2K8S A;  2H72 A;  1JZD A;  4IQA A;  2FA4 A;  2GQL A;  4K9Z A;  2H30 A;  3FZA A;  3GST A;  4KDU A;  3DVW A;  5G2Z A;  3J7Y k;  5G1K A;  2VCZ A;  3KZQ A;  2LEG A;  1J9B A;  3Q18 A;  5J9C A;  1X9M B;  2GGT A;  4FYU A;  2V32 A;  5AGY A;  2B7K A;  4XS4 A;  2FD3 A;  1IYH A;  2L59 A;  3ME8 A;  2LS5 A;  1YY7 A;  2TRX A;  3F0I A;  3J7Y b;  4ZBD A;  2N5A A;  2L5O A;  2VCV A;  3M9J A;  4G2E A;  5J5N A;  2AV4 A;  1GSF A;  4IGJ A;  4NAX A;  2CX3 A;  3GMF A;  1MTC A;  1O8X A;  2VLU A;  2FWG A;  4Q5N A;  5J41 A;  1F3A A;  1KNG A;  1PA3 A;  5ECP B;  3PGT A;  1TK5 B;  2VIM A;  4E8H A;  2G2Q A;  1O73 A;  3QAW A;  3TJG A;  2YPM A;  1Z6M A;  1EV9 A;  3UMA A;  3KD0 A;  1HD2 A;  1FG4 A;  1GUH A;  2M46 A;  1G7E A;  2LRT A;  1OC9 A;  2HT9 A;  2PER A;  3GUR A;  2G0F A;  1ERW A;  1EOH A;  3WGD A;  3BBY A;  5KN0 A;  3KP8 A;  3RPP A;  1S3A A;  1ERU A;  1B4P A;  2LNS A;  2GZY A;  5H5S A;  3WGE A;  4EDY A;  4OO5 A;  1JLV A;  3TJF A;  4V2M A;  1JZW A;  1FB0 A;  3KTL A;  2IL3 A;  3TKS C;  4LMV A;  4N0V A;  1VF1 A;  1T4Z A;  2PU9 C;  5KN1 A;  2GDR A;  4WBJ A;  3TOT A;  4JR4 A;  1V40 A;  2P5R A;  5ELA A;  2VCT A;  4ZL8 A;  3IE3 A;  2H6Z A;  1K0A A;  1GTA A;  1OC8 A;  5DQS A;  4IP6 A;  3F3R A;  3I69 A;  4ECI A;  4NMU A;  4PQ1 A;  2WZ9 A;  3SBC A;  3VUR A;  4WR5 A;  2JZS A;  5DCG A;  2IMK A;  1GRX A;  2H19 A;  1F6M C;  1ILO A;  4KA0 A;  1WE0 A;  2KOK A;  3ZIV A;  1BQ7 A;  2JAC A;  1YKA A;  4TR1 B;  4O32 A;  6GSS A;  3CTG A;  1SL2 B;  3PR8 A;  5CRW A;  3HXS A;  2VD0 A;  3AY8 A;  1GSE A;  3O76 A;  4PQH A;  3KIJ A;  5LD0 A;  3IPZ A;  2J23 A;  2F8A A;  5G5E A;  1MDJ A;  3TKP A;  2R37 A;  3I9V 2;  4HU9 A;  3IC4 A;  4KH7 A;  2LQO A;  3LQ7 A;  2GT5 A;  4BWS A;  2YJH A;  3GFK A;  2VCW A;  4L0U A;  2IFQ B;  1AXD A;  3M1G A;  1K3O A;  3CMI A;  4D73 B;  1JFU A;  4ECJ A;  1S3D A;  1SYX A;  1X9W B;  3GX8 A;  4FIW A;  3TKR A;  3MNG A;  5IOW A;  3CRT A;  4BA7 A;  3LGC A;  13GS A;  5DDL A;  5CAX A;  5CRD A;  1XW6 A;  5AIX A;  2LV3 A;  4XS1 A;  1S3C A;  4IW9 A;  5CP1 A;  3FHK A;  3D4T A;  1GTU A;  1A8Y A;  1F3B A;  1TP9 A;  3W8J A;  5ECM B;  4WKW A;  5IOX A;  2L5L A;  5FHI A;  1GUL A;  3HD5 A;  1CQH A;  2DLX A;  2MYG A;  2ZUP A;  4POB A;  3IAM 2;  4ZBB A;  5INY A;  3W6G A;  1F2E A;  4TVE A;  1GNE A;  1FB6 A;  5IO0 A;  1ON4 A;  6GSW A;  1E2Y A;  2QGV A;  3ZVJ A;  2L4C A;  1AW9 A;  2GSS A;  2E2M A;  5ELG A;  1SK1 A;  2JL4 A;  3VWU A;  5E59 A;  2F51 A;  2KP2 A;  1PMT A;  3GIX A;  5ECK B;  5IPG A;  4WF4 A;  5F05 A;  1WJK A;  3HJM A;  2HZF A;  1WPI A;  1EZK A;  3FW2 A;  5ECH B;  2C0E A;  3HYP A;  2X8C A;  5HR1 A;  3ZZX A;  4G10 A;  2XBQ A;  4TR1 A;  5CO3 A;  2OE0 A;  2O85 A;  1PX7 A;  1SYR A;  2GZZ A;  3EMX A;  4MAB A;  2CV4 A;  4DSS B;  2QKE A;  2YAN A;  5COH A;  4EVM A;  3D6I A;  4EDZ A;  4ZL7 A;  4IVF A;  4BWQ A;  3IBH A;  1U6T A;  2YWI A;  4MA9 A;  2NTO A;  2KLX A;  2H1B A;  2HSY A;  3TB2 A;  2V1M A;  3FEU A;  3IHQ A;  2V6O A;  3H1N A;  3ISO A;  4HEA 2;  4O92 A;  1LJR A;  2I9H A;  1TK8 B;  2C3N A;  4IS0 A;  4HZ2 A;  4K1F A;  2DJ3 A;  4D73 A;  4EF0 A;  1OYJ A;  3I43 A;  1TW9 A;  2B5E A;  2H0I A;  2E7P A;  3EWL A;  4RQX A;  1DSB A;  5A4W A;  3QCP A;  4GSN A;  3UAR A;  3F3Q A;  2OJL A;  3KTB A;  3TJJ A;  5J4U A;  1JZO A;  2H74 A;  3GKN A;  1PD2 1;  3E9J B;  1WIK A;  1K0M A;  1WP0 A;  4F9Z A;  5ID2 A;  4RUV A;  3UEM A;  2MMZ A;  3WT1 A;  2FWE A;  4EKZ A;  3KCM A;  3F4R A;  1M7T A;  4PXO A;  5JCG A;  1EGO A;  2HXK A;  1W89 A;  2VLV A;  2R4V A;  1XW9 A;  2R5G A;  3ED3 A;  3UVT A;  2AHE A;  3LWA A;  1EGR A;  2C0D A;  1N2A A;  7GSS A;  5ECR B;  2JZR A;  1XIY A;  1T00 A;  3D5J A;  3OR5 A;  4BVY A;  4IKH A;  2VCQ A;  3EVI A;  1GL8 A;  3BJ5 A;  3KEB A;  2KUC A;  1K0N A;  2WCI A;  2L6D A;  1AUC A;  4MP4 A;  2XPE A;  1ACV A;  1Z3E A;  2H70 A;  4DVC A;  2DJ0 A;  4BL7 A;  1SU9 A;  5JCU A;  2OBI A;  2DJK A;  4IBP A;  4QQ7 A;  2LJR A;  1BJX A;  1ERV A;  1SJ6 A;  3DEX A;  3GYK A;  1R5P A;  1FVK A;  10GS A;  4TOP A;  4X0X A;  1GLQ A;  5D73 A;  1M9B A;  4GXZ A;  2OA7 A;  3CXG A;  1OC9 B;  2EIQ A;  4KB3 A;  2BTO T;  4MH3 A;  3IXR A;  3IK9 A;  2D2Z A;  1GH2 A;  3LJR A;  2H01 A;  1MDI A;  2WS2 A;  2HLS A;  2HRN A;  3P8W A;  3GA4 A;  3TOU A;  4IN0 A;  2X64 A;  4N10 A;  4TR3 A;  3WYW A;  2PBJ A;  4YQV A;  2ZNM A;  4K2D A;  3Q74 A;  2FCH A;  4OO4 A;  4HUA A;  3LYK A;  1NHY A;  4WF5 A;  4WR4 A;  1YJ6 A;  1PQN A;  4EC0 A;  3F6D A;  3TRQ A;  3EC3 A;  2FLS A;  1BX9 A;  2IN3 A;  4KCE A;  4KCA A;  1ZGN A;  1U87 A;  4GQC A;  3D21 A;  2H71 A;  1O8W A;  1UVZ A;  1JZR A;  3HHV A;  3ZL5 A;  3ZMK A;  1ZOF A;  1EP7 A;  3VPQ A;  4IP1 A;  5F06 A;  2RM5 A;  3RHB A;  2VL9 A;  2LTK A;  2VLT A;  1A0F A;  2PGT A;  5ECI B;  1GLP A;  3FYG A;  1SKR B;  3HZ8 A;  2GLR A;  1O81 A;  2OKA A;  2VL2 C;  2F9S A;  4CW9 A;  3TDG A;  4O5R A;  4ML1 A;  1ZZY A;  4PNG A;  2JSZ A;  3QMX A;  1GTI A;  3UIW A;  3QR6 A;  4MDC A;  5ECL B;  2RUE A;  1X5E A;  1CQG A;  1GUK A;  1TU8 A;  5IMV A;  3ZIJ A;  1J08 A;  2TIR A;  2X8G A;  3G9B A;  3VK9 A;  4I2T A;  1ABA A;  1ZMA A;  5JWO B;  3FZ5 A;  4ZL9 A;  1M2B A;  4HQZ A;  4F03 A;  5A5K A;  2HSH A;  22GS A;  4AJ7 A;  1V9W A;  1NW2 A;  5C04 A;  6GST A;  5HFG A;  1U88 A;  4GRF A;  4IHU A;  2VM2 A;  3FR9 A;  4L0W A;  3WT2 A;  2H0G A;  1G6Y A;  1U3A A;  3ERW A;  3DGQ A;  5IMC A;  2DBC A;  2P5Q A;  2FNO A;  1TU7 A;  2FUG 2;  1XOA A;  3F6F A;  4MZW A;  4XTS A;  4MJB A;  1HNA A;  3TUE A;  2MMN A;  3LEF A;  3UBK A;  5A4V A;  2FY6 A;  4WXT A;  3CYN A;  4IEL A;  3UL3 A;  2NPB A;  2REM A;  4WBR D;  2H75 A;  4KSM A;  4XRD A;  4ECC A;  4HOJ A;  4X1U A;  1EEM A;  1XWK A;  2CT6 A;  1B8X A;  2ZCT A;  1K3L A;  5D9T A;  2K9F A;  14GS A;  2C1Y A;  1G7O A;  4J56 E;  2I81 A;  3CBU A;  1XWA A;  2Z9S A;  2GS3 A;  5DBQ A;  2RM6 A;  1GSS A;  5DAL A;  1Z7R A;  3D0Z A;  3FZ9 A;  3TJB A;  3MSZ A;  3GV1 A;  2JAD A;  1B4Q A;  2DMM A;  3IV4 A;  3EU3 A;  1GP1 A;  5IMZ A;  1EEJ A;  2LNT A;  3F63 A;  4TXV A;  2WGR A;  2PMT A;  3KH7 A;  3IDV A;  1SD8 A;  4PGT A;  5HR2 A;  3C73 A;  4XS6 A;  4NPB A;  3RHC A;  3HZ4 A;  3DIE A;  1X0R A;  4L5L A;  1VF4 A;  3SWL A;  3TJK A;  4RI6 A;  1DBY A;  1BAY A;  3IR4 A;  1XWB A;  2JZT A;  3CSI A;  1UA5 A;  1IYI A;  2LRN A;  4V2L A;  1TKD B;  1R5A A;  3LYP A;  5JWR B;  4CHS A;  5D8I A;  2YNX A;  3D22 A;  2YZH A;  2C8U A;  1ML6 A;  4F0C A;  2DJ1 A;  2GT6 A;  5B6N A;  2CZ3 A;  2I3Y A;  2P31 A;  4PUF C;  2LJK A;  1HQO A;  3P2A A;  2NDO A;  2K18 A;  3I6A A;  5D9V A;  2OBK A;  1SKS B;  2V2G A;  3ZRD A;  5ID2 B;  3RDW A;  4LLR A;  3ERF A;  3QPM A;  2FHE A;  4JBB A;  3S9F A;  4ID0 A;  4OCE A;  3UBL A;  4HS1 A;  2C4J A;  3L9V A;  2VAF A;  1JHB A;  2H6Y A;  3IAS 2;  1TXX A;  2LKU A;  2NBS A;  4MJA A;  1V2A A;  5JWQ B;  5ECS A;  5ECQ B;  1H4O A;  2H73 A;  4GSS A;  3L0H A;  1G6W A;  5A4U A;  1EOG A;  5LNK e;  2CA8 A;  4MF7 A;  3IK7 A;  3M8N A;  3E3E A;  3QOU A;  1HNB A;  5IMD A;  1XWG A;  2L4Q A;  1XCC A;  1YDK A;  1UN2 A;  1A2L A;  2N5F A;  3DWV A;  5IQY A;  2RII A;  5IM9 A; 
#chains in the Genus database with same CATH topology
 4EE0 A;  3GH6 A;  1B9X C;  4J2F A;  1B48 A;  1JLW A;  1K0D A;  4NHZ A;  1J0F A;  4YQU A;  3GNJ A;  3HVV A;  5HQP A;  1OKD A;  3BOA A;  1MD4 A;  2XPD A;  2H76 A;  3KMO A;  5IIZ A;  5EL8 A;  1FW1 A;  2PWJ A;  5ENU A;  4KW6 A;  2RLI A;  2YV7 A;  3L9U A;  2YOI A;  4V1A p;  1WRY A;  4O7H A;  1DE2 A;  1PX6 A;  2XHF A;  1Y25 A;  5AN1 A;  1Z6N A;  5GSS A;  1BED A;  5GAP D;  3HY2 A;  4ML6 A;  1F9M A;  3UJ1 A;  2ALB A;  1QFN A;  1XFL A;  6GSX A;  4MLY A;  2O89 A;  4NHW A;  1SJZ A;  1UC7 A;  3ERG A;  2CAQ A;  4MF6 A;  8GSS A;  4OFT A;  2O87 A;  3HVX A;  1Z7P A;  3Q19 A;  1FHE A;  1XVW A;  5IO2 A;  4YQM A;  2B3S A;  1SKW B;  2BJX A;  3TKS A;  4KAE A;  2A4V A;  4ZB6 A;  3KGK A;  5ECO B;  1FO5 A;  3RPN A;  1M99 A;  4HZ4 A;  4E8E A;  1PN9 A;  3P90 A;  4K8M A;  12GS A;  3ZFB A;  2OAD A;  3FR3 A;  4KF9 A;  1RQM A;  3N5O A;  3VLN A;  2DC5 A;  4QL7 A;  2P0G A;  2X8H A;  5KN2 A;  1USB A;  3CRU A;  4I8B A;  1M2A A;  4KDX A;  4XIH A;  1TTZ A;  3FZ4 A;  2CZ2 A;  3IOS A;  4DSQ A;  4EIQ A;  3MWH A;  3DYR A;  4HJ2 A;  4KDY A;  2MBT A;  4GWR A;  4Q5F A;  1V57 A;  4H86 A;  3A2W A;  3DD3 A;  3PH9 A;  2AUV A;  1A8L A;  1A24 A;  1OVN A;  2XC2 A;  1RW1 A;  4OFM A;  5DQY A;  3L4N A;  4K7I A;  4XCS A;  2NVL A;  5HR3 A;  5J9B A;  3GHA A;  3ZYW A;  2I1U A;  3M3M A;  4XRA A;  1R26 A;  4PUA A;  1SEN A;  3GL3 A;  3QAG A;  2HZE A;  2AB6 A;  2M72 A;  3C1R A;  4MZC A;  3RBT A;  3MIX A;  1Q98 A;  5DJL A;  2DJJ A;  5DJM A;  4OFN A;  4K7O A;  3VWW A;  1OE7 A;  4HI7 A;  3KMN A;  2VD1 A;  2CVD A;  2C3T A;  3BCK A;  2AJQ B;  4Q5R A;  1K0B A;  2C80 A;  1TDI A;  5D9W A;  4MK3 A;  4ZXG A;  1VF2 A;  1K3Y A;  2ON5 A;  5B6M A;  1XPV A;  3JCM L;  2YWO A;  3LXT A;  2YWM A;  3GRX A;  3KP9 A;  1PN0 A;  1ZYN A;  3U6V A;  2YP6 A;  5LCZ A;  2WUL A;  1AQX A;  4ZBA A;  2K8V A;  1TRU A;  4IJ3 A;  19GS A;  3A5W A;  3ME7 A;  1U3I A;  4PUR A;  5DAL B;  2CVB A;  4PNF A;  6GSU A;  2N5B A;  4ZIL A;  4DEJ A;  1QK8 A;  2H1A A;  2J9H A;  5IMF A;  1A23 A;  2B1K A;  3PIN A;  3ZLP A;  3QAV A;  3ZFL A;  1G0T A;  4I2U A;  3W8S A;  3N9J A;  3VPT A;  4TW5 A;  3US3 A;  3APS A;  2HI7 A;  4EXJ A;  2BMX A;  1FAA A;  2TRC P;  1LU4 A;  5EPF A;  3O6T A;  1ZCP A;  1F37 A;  1RK4 A;  3L9S A;  4YAP A;  1C72 A;  2DML A;  1A2M A;  1SD9 A;  4MNN A;  4O5U A;  3K8N A;  2C3Q A;  4X4J A;  4OCF A;  5KEJ A;  1K0C A;  2WB9 A;  3F8U A;  3P7X A;  1O6J A;  3QD9 A;  1OC3 A;  2CVK A;  4JU5 A;  3H79 A;  5D96 A;  2YN1 A;  2DJ2 A;  5J3R A;  1M0U A;  4KE3 A;  5DAK B;  1ZL9 A;  1SK0 A;  3DRN A;  1R4W A;  1X5C A;  4MMM A;  2IMI A;  1MDK A;  2FWF A;  3TGZ A;  3A2V A;  4CY6 A;  1NM3 A;  1PL1 A;  5C00 A;  4ISD A;  4NV2 A;  4ACS A;  1BYE A;  2YV9 A;  3ZRE A;  3GKK A;  2EC4 A;  3HKR A;  5DCH A;  2HYX A;  5G30 A;  3EUR A;  1PRX A;  2A2R A;  1KEB A;  3CSH A;  3H93 A;  1HNC A;  4RI7 A;  1TI1 A;  1WOU A;  1EP8 A;  2LRC A;  3RAZ A;  2VUP A;  1SK2 A;  3M0F A;  4NXI A;  5G5F A;  1KBN A;  3NOF A;  3ZTL A;  4K6X A;  20GS A;  2EIR A;  4FO5 A;  4OD7 A;  2O7K A;  1A0R P;  9GSS A;  4EL1 A;  1TRS A;  4HJM A;  2IJY A;  1O7U A;  3V1W A;  2KP1 A;  3GL5 A;  4KX4 A;  5EVO A;  1PSQ A;  1QXH A;  1WMJ A;  1LBK A;  3MDK A;  1R7H A;  5HFI A;  4ZB8 A;  3F4S A;  2DIZ A;  1OKT A;  4FYB A;  2QC7 A;  3UVH A;  1B9Y C;  4MJC A;  1GSQ A;  1Y6E A;  1PKZ A;  3GKM A;  1OE8 A;  2CX4 A;  4MPF A;  2R3X A;  2V41 A;  2H8L A;  4TXO A;  4K0N A;  2C0G A;  4HQS A;  2QA1 A;  3ZVJ D;  1TRW A;  4K2X A;  2IMD A;  18GS A;  4AGS A;  2YZU A;  3NIV A;  3KH9 A;  2AAW A;  1XG8 A;  2PUK C;  1ERT A;  5GST A;  4YH2 A;  4YAV A;  5AIV A;  3MAK A;  2GSQ A;  4TRX A;  4WET A;  3G7Y A;  2HE3 A;  3FK8 A;  4OWY A;  1FOV A;  5KOW A;  4TR4 A;  2GQK A;  3IHG A;  4K5R A;  2OE1 A;  5H5R A;  3VFI A;  2B5Y A;  1ZYP A;  1FOH A;  1TJD A;  2B6M A;  2LQQ A;  2H1G A;  5F07 A;  2E2G A;  2VO4 A;  5B8A A;  3FR6 A;  3FY7 A;  5D93 A;  3DXB A;  5DAK A;  4EUY A;  2H66 A;  1VGL A;  4XHM A;  4AF2 A;  4RQR A;  1VRS D;  1MD3 A;  4OMV A;  2MMO A;  1GTB A;  5D9X A;  3QFB C;  3ZML A;  5CRH A;  3TKQ A;  4L8E A;  4EIP A;  2MMA A;  4USS A;  3F9U A;  5GAN D;  1V58 A;  4ZB9 A;  3CQF A;  1T4Y A;  1TK0 B;  1N8J A;  5FT3 A;  1SJI A;  2C0F A;  3IC8 A;  1Z9H A;  3LFL A;  1V98 A;  3H4K A;  3UAP A;  5CRE A;  1KTE A;  5EY6 A;  3C1S A;  1EV4 A;  2H6X A;  1X9S B;  4GF0 A;  5L71 A;  4MH2 A;  3EIN A;  4IJI A;  3QFA C;  3GUS A;  3HA9 A;  3EYT A;  2KHP A;  1NSW A;  1QGV A;  3KJY A;  5G1L A;  3R2Q A;  1W4V A;  1A2J A;  4POL A;  4KUN A;  2FGX A;  2GTU A;  3D4M A;  1XBS A;  4TKY A;  2PPT A;  1AQV A;  4X43 A;  2MZC A;  2LST A;  1M3J A;  4AJ8 A;  2GQM A;  1T1V A;  2ES7 A;  4Z7X A;  4N30 A;  1T7P B;  1ZYQ B;  2VL2 A;  5CRG A;  2WJU A;  3UOM A;  4GST A;  4J57 E;  3KXO A;  1ST9 A;  3EPT A;  1I5G A;  1SL0 B;  16GS A;  4DSR A;  1X5D A;  3EU4 A;  5JCW A;  2I4A A;  2L57 A;  3IA1 A;  1QQ2 A;  1MEK A;  2DIY A;  3KM6 A;  2GVP A;  3C8E A;  2IPA A;  3C7M A;  11GS A;  4JR6 A;  3TRX A;  3PPU A;  4KSO A;  2QA2 A;  6GSV A;  5KOX A;  2HZE B;  2A2S A;  1H75 A;  3WGX A;  2F8F A;  4N11 A;  2JSY A;  3DKS A;  4ILF A;  3VWV A;  5B8B A;  3A2X A;  1OAZ A;  5GZZ B;  1GWC A;  2M80 A;  1EWX A;  1GUM A;  4IQ1 A;  1FVJ A;  3QDN A;  3LXZ A;  4KND A;  4ULX A;  4GQF A;  5G31 A;  4HDE A;  4KGI A;  5ECN B;  2GST A;  4CDO A;  1NHO A;  2YCD A;  1AAZ A;  2WRT A;  3GN3 A;  4LL1 B;  2IME A;  1GNW A;  4PQI A;  3GSS A;  1PL2 A;  5KN3 A;  4BVX A;  1QUW A;  1Z5Y E;  2DSA A;  3M9K A;  2VL3 A;  4F82 A;  3MYD A;  2K6V A;  5AIS A;  3A3T A;  3WD6 A;  4G9H A;  4EO3 A;  2HRA A;  2R6K A;  4POM A;  2B7J A;  2PVQ A;  4POK A;  3G7I A;  2X99 A;  4Q5Q A;  1URM A;  1YZX A;  3APO A;  2IFQ A;  2FWH A;  4JRR A;  2EIO A;  3GTU B;  3HCZ A;  3IRA A;  4LL4 B;  3E0U A;  4BPY A;  1BG5 A;  5B7C A;  2MBS A;  1XZO A;  1M9A A;  4V1A g;  4K7N A;  4N0Z A;  1XXU A;  3ZIT A;  4L5O A;  4ECB A;  1PGT A;  1GSU A;  1T3B A;  1YQ1 A;  2LJA A;  1YF1 A;  1I9D A;  5IPH A;  4G0K A;  4F2I A;  2PVO C;  3BD2 A;  3TRP A;  1XWC A;  1PKW A;  2UZ8 A;  2WDU A;  5H5Q A;  6GSY A;  3H8Q A;  4MZB A;  1WWJ A;  3G7J A;  4HU7 A;  2DKI A;  4GTU A;  3GKX A;  3LSZ A;  5HR0 A;  4WEY A;  4FQU A;  4I5Q A;  1QMV A;  3GH9 A;  2QSI A;  2L6C A;  3VI5 A;  3C71 A;  2JU5 A;  2E0Q A;  1AC1 A;  2RUF A;  4GLT A;  5DVB A;  4NV5 A;  4ZIJ A;  5E4W A;  2DKH A;  4XS4 B;  3F4T A;  1GSY A;  3LOR A;  1DE1 A;  1ZYE A;  4MCU A;  2YWN A;  3U5R E;  1E6B A;  1YF0 A;  1GSD A;  4JE1 A;  4FH8 A;  2OE3 A;  2HRK A;  4LMW A;  2XBI A;  4MF5 A;  2IWT A;  2B5X A;  2HFD A;  4G19 A;  2ON7 A;  3TKS E;  2HRF A;  4JED A;  4LA1 A;  1AQW A;  2R2J A;  1XVQ A;  1TRV A;  3APQ A;  1THX A;  3DVX A;  2GZP A;  1SL1 B;  3DML A;  2B1L A;  3CSJ A;  2F3M A;  4K0G A;  4GCI A;  4I97 A;  4HSC X;  3FKF A;  5FWG A;  1TI3 A;  3VWX A;  4ICY A;  4DSS A;  4G0I A;  1YEX A;  2A4H A;  2PN8 A;  3NZN A;  3L78 A;  3VI7 A;  2VCX A;  4TN8 A;  1O85 A;  1YEP A;  4I6X A;  2CAI A;  2V6K A;  1AIU A;  3BCI A;  2VM1 A;  5F8B A;  1HYU A;  2CQ9 A;  3CTF A;  1XW5 A;  1YKC A;  4AJ6 A;  3LG6 A;  2H0H A;  3HDC A;  2IMF A;  17GS A;  4NWY A;  2GSR A;  3TCO A;  4PX1 A;  5ABR A;  5HFK A;  4QL9 A;  2OAC A;  2FA8 A;  2AYT A;  4FYC A;  3Q6O A;  4MJE A;  3GTU A;  3EMP A;  1M2D A;  1TOF A;  2HNL A;  3FMW A;  1DUG A;  1XOB A;  5CYY A;  2YJ7 A;  4TXO B;  2WFC A;  1T8E B;  1THO A;  3GX0 A;  2H1D A;  2LUS A;  3HVS A;  3HJP A;  1VF3 A;  3O3T A;  3FRC A;  2IIY A;  5CNW A;  1K0O A;  4JZQ A;  5IMA A;  3HJO A;  4F0B A;  4P3Y B;  1Q4J A;  3EE2 A;  5F0G A;  2VOC A;  2O8V B;  4TR0 A;  4V2N A;  4MPG A;  3HVN A;  2K8S A;  2H72 A;  1JZD A;  4IQA A;  2FA4 A;  2GQL A;  4K9Z A;  2H30 A;  3FZA A;  3GST A;  4KDU A;  3DVW A;  5G2Z A;  3J7Y k;  5G1K A;  2VCZ A;  3KZQ A;  2LEG A;  1J9B A;  3Q18 A;  5J9C A;  1X9M B;  2GGT A;  4FYU A;  2V32 A;  5AGY A;  2B7K A;  4XS4 A;  2FD3 A;  1IYH A;  2L59 A;  3ME8 A;  2LS5 A;  1YY7 A;  2TRX A;  3F0I A;  3J7Y b;  4ZBD A;  2N5A A;  2L5O A;  2VCV A;  3M9J A;  4G2E A;  5J5N A;  2AV4 A;  1GSF A;  4IGJ A;  4NAX A;  2CX3 A;  3GMF A;  1MTC A;  1O8X A;  2VLU A;  2FWG A;  4Q5N A;  5J41 A;  5BMU A;  1F3A A;  1KNG A;  1PA3 A;  5ECP B;  3PGT A;  1TK5 B;  1M3I A;  2VIM A;  4E8H A;  2G2Q A;  1O73 A;  3QAW A;  3TJG A;  2YPM A;  1Z6M A;  1EV9 A;  3UMA A;  3KD0 A;  1HD2 A;  1FG4 A;  1GUH A;  2M46 A;  1G7E A;  2LRT A;  1OC9 A;  2HT9 A;  2PER A;  3GUR A;  2G0F A;  1ERW A;  1EOH A;  3WGD A;  3BBY A;  5KN0 A;  3KP8 A;  3RPP A;  4G0L A;  1S3A A;  1ERU A;  1B4P A;  2LNS A;  2GZY A;  5H5S A;  3WGE A;  4EDY A;  2R0C A;  4OO5 A;  1JLV A;  3TJF A;  4V2M A;  1JZW A;  1FB0 A;  3KTL A;  2IL3 A;  3TKS C;  4LMV A;  4N0V A;  1VF1 A;  1T4Z A;  2PU9 C;  5KN1 A;  2GDR A;  4WBJ A;  3TOT A;  4JR4 A;  1V40 A;  2P5R A;  5ELA A;  2VCT A;  4ZL8 A;  3IE3 A;  2H6Z A;  1K0A A;  1GTA A;  1OC8 A;  5DQS A;  4IP6 A;  3F3R A;  3I69 A;  4ECI A;  4NMU A;  4PQ1 A;  2WZ9 A;  3SBC A;  3VUR A;  4WR5 A;  2JZS A;  5DCG A;  2IMK A;  1GRX A;  2H19 A;  1F6M C;  1ILO A;  4KA0 A;  1WE0 A;  2KOK A;  3ZIV A;  1BQ7 A;  2JAC A;  1YKA A;  4TR1 B;  4O32 A;  6GSS A;  3CTG A;  1SL2 B;  3PR8 A;  5CRW A;  3HXS A;  2VD0 A;  3AY8 A;  1GSE A;  3O76 A;  4BVX B;  4PQH A;  3KIJ A;  5LD0 A;  3IPZ A;  2J23 A;  2F8A A;  5G5E A;  1MDJ A;  3TKP A;  2R37 A;  3I9V 2;  4HU9 A;  3IC4 A;  4KH7 A;  2LQO A;  3LQ7 A;  2GT5 A;  4BWS A;  2YJH A;  3GFK A;  2VCW A;  4L0U A;  2IFQ B;  1AXD A;  3M1G A;  1K3O A;  3CMI A;  4D73 B;  1JFU A;  4ECJ A;  1S3D A;  1SYX A;  1X9W B;  3GX8 A;  4FIW A;  3TKR A;  3MNG A;  5IOW A;  3CRT A;  4BA7 A;  3LGC A;  13GS A;  5DDL A;  5CAX A;  5CRD A;  1XW6 A;  5AIX A;  2LV3 A;  4XS1 A;  1S3C A;  4IW9 A;  5CP1 A;  3FHK A;  3D4T A;  1GTU A;  1A8Y A;  1F3B A;  1TP9 A;  3W8J A;  5ECM B;  4WKW A;  5IOX A;  2L5L A;  5FHI A;  1GUL A;  3HD5 A;  1CQH A;  4BIK A;  2DLX A;  2MYG A;  2ZUP A;  4POB A;  3IAM 2;  4ZBB A;  5INY A;  3W6G A;  1F2E A;  4TVE A;  1GNE A;  1FB6 A;  5IO0 A;  1ON4 A;  6GSW A;  1E2Y A;  2QGV A;  3ZVJ A;  2L4C A;  1AW9 A;  2GSS A;  2E2M A;  5ELG A;  1SK1 A;  2JL4 A;  3VWU A;  5E59 A;  2F51 A;  2KP2 A;  1PMT A;  3GIX A;  5ECK B;  5IPG A;  4WF4 A;  5F05 A;  1WJK A;  3HJM A;  2HZF A;  1WPI A;  1EZK A;  3FW2 A;  5ECH B;  2C0E A;  3HYP A;  2X8C A;  5HR1 A;  3ZZX A;  4G10 A;  2XBQ A;  4TR1 A;  5CO3 A;  2OE0 A;  2O85 A;  1PX7 A;  1SYR A;  2GZZ A;  3EMX A;  4MAB A;  2CV4 A;  4DSS B;  2QKE A;  2YAN A;  5COH A;  4EVM A;  3D6I A;  4EDZ A;  4ZL7 A;  4IVF A;  4BWQ A;  3IBH A;  1U6T A;  2YWI A;  4MA9 A;  4YKF A;  2NTO A;  2KLX A;  2H1B A;  2HSY A;  3TB2 A;  2V1M A;  3FEU A;  3IHQ A;  2V6O A;  3H1N A;  3ISO A;  4HEA 2;  4O92 A;  1LJR A;  2I9H A;  1TK8 B;  2C3N A;  4IS0 A;  4Z2U A;  4HZ2 A;  4K1F A;  2DJ3 A;  4D73 A;  4EF0 A;  1OYJ A;  3I43 A;  1TW9 A;  2B5E A;  3A5I A;  2H0I A;  1PFO A;  2E7P A;  3EWL A;  4RQX A;  1DSB A;  5A4W A;  3QCP A;  4GSN A;  3UAR A;  3F3Q A;  2OJL A;  3KTB A;  3TJJ A;  5J4U A;  1JZO A;  2H74 A;  3GKN A;  1PD2 1;  3E9J B;  1WIK A;  1K0M A;  1WP0 A;  4F9Z A;  5ID2 A;  4RUV A;  3UEM A;  2MMZ A;  3WT1 A;  2FWE A;  4EKZ A;  3KCM A;  3F4R A;  1M7T A;  4PXO A;  5JCG A;  1EGO A;  2HXK A;  1W89 A;  2VLV A;  2R4V A;  1XW9 A;  2R5G A;  3ED3 A;  3UVT A;  2AHE A;  3LWA A;  3R3E A;  1EGR A;  2C0D A;  1N2A A;  7GSS A;  5ECR B;  2R0P A;  2JZR A;  1XIY A;  1T00 A;  3D5J A;  3OR5 A;  4BVY A;  4IKH A;  2VCQ A;  3EVI A;  1GL8 A;  3BJ5 A;  3KEB A;  2KUC A;  1K0N A;  2WCI A;  2L6D A;  1AUC A;  4MP4 A;  2XPE A;  1ACV A;  1Z3E A;  2H70 A;  4DVC A;  2DJ0 A;  4Z2R A;  4BL7 A;  1SU9 A;  5JCU A;  2OBI A;  2DJK A;  4IBP A;  4QQ7 A;  2LJR A;  1BJX A;  1ERV A;  1SJ6 A;  3DEX A;  3GYK A;  1R5P A;  1FVK A;  10GS A;  4TOP A;  4X0X A;  4K5S A;  1GLQ A;  5D73 A;  1M9B A;  4GXZ A;  2OA7 A;  3CXG A;  1OC9 B;  2EIQ A;  4KB3 A;  2BTO T;  4MH3 A;  3IXR A;  4YKG A;  3IK9 A;  2D2Z A;  1GH2 A;  3LJR A;  2H01 A;  1MDI A;  2WS2 A;  2HLS A;  2X4A A;  2HRN A;  3P8W A;  2HSM A;  3GA4 A;  3TOU A;  4IN0 A;  2X64 A;  4N10 A;  4TR3 A;  3WYW A;  2PBJ A;  4YQV A;  2ZNM A;  4K2D A;  3Q74 A;  2FCH A;  4OO4 A;  4HUA A;  5BRT A;  3LYK A;  1NHY A;  4Z2T A;  4WF5 A;  4WR4 A;  1YJ6 A;  1PQN A;  4EC0 A;  3F6D A;  3TRQ A;  3EC3 A;  2FLS A;  1BX9 A;  2IN3 A;  4KCE A;  4KCA A;  1ZGN A;  1U87 A;  4GQC A;  3D21 A;  4A5P A;  2H71 A;  1O8W A;  1UVZ A;  1JZR A;  3HHV A;  3ZL5 A;  3ZMK A;  1ZOF A;  1EP7 A;  3VPQ A;  4IP1 A;  5F06 A;  2RM5 A;  3RHB A;  2VL9 A;  2LTK A;  2VLT A;  1A0F A;  2PGT A;  5ECI B;  1GLP A;  2X49 A;  3FYG A;  1SKR B;  3LW9 A;  3HZ8 A;  2GLR A;  1O81 A;  2OKA A;  2VL2 C;  2F9S A;  4CW9 A;  3TDG A;  4O5R A;  4ML1 A;  1ZZY A;  4PNG A;  2JSZ A;  3QMX A;  1GTI A;  2R0G A;  3UIW A;  3QR6 A;  4MDC A;  5ECL B;  2RUE A;  1X5E A;  1CQG A;  1GUK A;  1TU8 A;  5IMV A;  3ZIJ A;  1J08 A;  2TIR A;  2X8G A;  3G9B A;  3VK9 A;  4I2T A;  1ABA A;  1ZMA A;  5JWO B;  3FZ5 A;  4ZL9 A;  1M2B A;  4HQZ A;  4F03 A;  5A5K A;  2HSH A;  22GS A;  4AJ7 A;  1V9W A;  1NW2 A;  5C04 A;  6GST A;  5HFG A;  1U88 A;  4GRF A;  4IHU A;  2VM2 A;  4O5Q A;  3FR9 A;  4L0W A;  3WT2 A;  2H0G A;  1G6Y A;  1U3A A;  3ERW A;  3DGQ A;  5IMC A;  2DBC A;  2P5Q A;  2FNO A;  1TU7 A;  2FUG 2;  1XOA A;  3F6F A;  4MZW A;  4XTS A;  4MJB A;  1HNA A;  3TUE A;  2MMN A;  3LEF A;  3UBK A;  5A4V A;  2FY6 A;  4WXT A;  3CYN A;  4IEL A;  3UL3 A;  2NPB A;  2REM A;  4WBR D;  2H75 A;  4KSM A;  4XRD A;  4ECC A;  4HOJ A;  4X1U A;  1EEM A;  1XWK A;  2CT6 A;  1B8X A;  2A2P A;  2ZCT A;  1K3L A;  5D9T A;  2K9F A;  14GS A;  2C1Y A;  1G7O A;  4J56 E;  2I81 A;  3CBU A;  1XWA A;  2Z9S A;  2GS3 A;  5DBQ A;  2RM6 A;  1GSS A;  5DAL A;  1Z7R A;  3D0Z A;  3FZ9 A;  3TJB A;  3MSZ A;  3GV1 A;  2JAD A;  1B4Q A;  2DMM A;  3IV4 A;  3EU3 A;  1GP1 A;  5IMZ A;  1EEJ A;  2LNT A;  3F63 A;  4TXV A;  2WGR A;  2PMT A;  3KH7 A;  3IDV A;  1SD8 A;  4PGT A;  5HR2 A;  3C73 A;  4XS6 A;  4NPB A;  3RHC A;  3HZ4 A;  3DIE A;  1X0R A;  4L5L A;  1VF4 A;  3SWL A;  3TJK A;  4RI6 A;  1DBY A;  1BAY A;  3IR4 A;  1XWB A;  2JZT A;  3CSI A;  4PTS A;  1UA5 A;  1IYI A;  2LRN A;  4V2L A;  1TKD B;  1R5A A;  3LYP A;  5JWR B;  4CHS A;  5D8I A;  2YNX A;  3D22 A;  2YZH A;  2C8U A;  1ML6 A;  4F0C A;  2DJ1 A;  2GT6 A;  5B6N A;  2CZ3 A;  2I3Y A;  2P31 A;  4PUF C;  2LJK A;  1HQO A;  3P2A A;  2NDO A;  2K18 A;  3I6A A;  5D9V A;  2OBK A;  1SKS B;  2V2G A;  3ZRD A;  5ID2 B;  3RDW A;  4LLR A;  3ERF A;  3QPM A;  2FHE A;  4JBB A;  3S9F A;  4ID0 A;  4OCE A;  3UBL A;  4HS1 A;  2C4J A;  3L9V A;  2VAF A;  1JHB A;  2H6Y A;  3IAS 2;  1TXX A;  4BVY B;  2LKU A;  2NBS A;  4MJA A;  1V2A A;  5JWQ B;  5ECS A;  5ECQ B;  1S3R A;  1H4O A;  2H73 A;  4GSS A;  3L0H A;  1G6W A;  5A4U A;  1EOG A;  5LNK e;  2CA8 A;  4CY8 A;  4MF7 A;  4BL7 B;  3IK7 A;  3M8N A;  3E3E A;  3QOU A;  1HNB A;  5IMD A;  1XWG A;  2L4Q A;  1XCC A;  1YDK A;  1UN2 A;  1A2L A;  2N5F A;  3DWV A;  5IQY A;  2RII A;  5IM9 A; 
#chains in the Genus database with same CATH homology
 4EE0 A;  3GH6 A;  1B9X C;  4J2F A;  1B48 A;  1JLW A;  1K0D A;  4NHZ A;  1J0F A;  4YQU A;  3GNJ A;  3HVV A;  5HQP A;  1OKD A;  3BOA A;  1MD4 A;  2XPD A;  2H76 A;  3KMO A;  5IIZ A;  5EL8 A;  1FW1 A;  2PWJ A;  5ENU A;  4KW6 A;  2RLI A;  2YV7 A;  3L9U A;  2YOI A;  4V1A p;  1WRY A;  4O7H A;  1DE2 A;  1PX6 A;  2XHF A;  1Y25 A;  5AN1 A;  1Z6N A;  5GSS A;  1BED A;  5GAP D;  3HY2 A;  4ML6 A;  1F9M A;  3UJ1 A;  2ALB A;  1QFN A;  1XFL A;  6GSX A;  4MLY A;  2O89 A;  4NHW A;  1SJZ A;  1UC7 A;  3ERG A;  2CAQ A;  4MF6 A;  8GSS A;  4OFT A;  2O87 A;  3HVX A;  1Z7P A;  3Q19 A;  1FHE A;  1XVW A;  5IO2 A;  4YQM A;  2B3S A;  1SKW B;  2BJX A;  3TKS A;  4KAE A;  2A4V A;  4ZB6 A;  3KGK A;  5ECO B;  1FO5 A;  3RPN A;  1M99 A;  4HZ4 A;  4E8E A;  1PN9 A;  3P90 A;  4K8M A;  12GS A;  3ZFB A;  2OAD A;  3FR3 A;  4KF9 A;  1RQM A;  3N5O A;  3VLN A;  2DC5 A;  4QL7 A;  2P0G A;  2X8H A;  5KN2 A;  1USB A;  3CRU A;  4I8B A;  1M2A A;  4KDX A;  4XIH A;  1TTZ A;  3FZ4 A;  2CZ2 A;  3IOS A;  4DSQ A;  4EIQ A;  3MWH A;  3DYR A;  4HJ2 A;  4KDY A;  2MBT A;  4GWR A;  4Q5F A;  1V57 A;  4H86 A;  3A2W A;  3DD3 A;  3PH9 A;  2AUV A;  1A8L A;  1A24 A;  1OVN A;  2XC2 A;  1RW1 A;  4OFM A;  5DQY A;  3L4N A;  4K7I A;  4XCS A;  2NVL A;  5HR3 A;  5J9B A;  3GHA A;  3ZYW A;  2I1U A;  3M3M A;  4XRA A;  1R26 A;  4PUA A;  1SEN A;  3GL3 A;  3QAG A;  2HZE A;  2AB6 A;  2M72 A;  3C1R A;  4MZC A;  3RBT A;  3MIX A;  1Q98 A;  5DJL A;  2DJJ A;  5DJM A;  4OFN A;  4K7O A;  3VWW A;  1OE7 A;  4HI7 A;  3KMN A;  2VD1 A;  2CVD A;  2C3T A;  3BCK A;  2AJQ B;  4Q5R A;  1K0B A;  2C80 A;  1TDI A;  5D9W A;  4MK3 A;  4ZXG A;  1VF2 A;  1K3Y A;  2ON5 A;  5B6M A;  1XPV A;  3JCM L;  2YWO A;  3LXT A;  2YWM A;  3GRX A;  3KP9 A;  1PN0 A;  1ZYN A;  3U6V A;  2YP6 A;  5LCZ A;  2WUL A;  1AQX A;  4ZBA A;  2K8V A;  1TRU A;  4IJ3 A;  19GS A;  3A5W A;  3ME7 A;  1U3I A;  4PUR A;  5DAL B;  2CVB A;  4PNF A;  6GSU A;  2N5B A;  4ZIL A;  4DEJ A;  1QK8 A;  2H1A A;  2J9H A;  5IMF A;  1A23 A;  2B1K A;  3PIN A;  3ZLP A;  3QAV A;  3ZFL A;  1G0T A;  4I2U A;  3W8S A;  3N9J A;  3VPT A;  4TW5 A;  3US3 A;  3APS A;  2HI7 A;  4EXJ A;  2BMX A;  1FAA A;  2TRC P;  1LU4 A;  5EPF A;  3O6T A;  1ZCP A;  1F37 A;  1RK4 A;  3L9S A;  4YAP A;  1C72 A;  2DML A;  1A2M A;  1SD9 A;  4MNN A;  4O5U A;  3K8N A;  2C3Q A;  4X4J A;  4OCF A;  5KEJ A;  1K0C A;  2WB9 A;  3F8U A;  3P7X A;  1O6J A;  3QD9 A;  1OC3 A;  2CVK A;  4JU5 A;  3H79 A;  5D96 A;  2YN1 A;  2DJ2 A;  5J3R A;  1M0U A;  4KE3 A;  5DAK B;  1ZL9 A;  1SK0 A;  3DRN A;  1R4W A;  1X5C A;  4MMM A;  2IMI A;  1MDK A;  2FWF A;  3TGZ A;  3A2V A;  4CY6 A;  1NM3 A;  1PL1 A;  5C00 A;  4ISD A;  4NV2 A;  4ACS A;  1BYE A;  2YV9 A;  3ZRE A;  3GKK A;  2EC4 A;  3HKR A;  5DCH A;  2HYX A;  5G30 A;  3EUR A;  1PRX A;  2A2R A;  1KEB A;  3CSH A;  3H93 A;  1HNC A;  4RI7 A;  1TI1 A;  1WOU A;  1EP8 A;  2LRC A;  3RAZ A;  2VUP A;  1SK2 A;  3M0F A;  4NXI A;  5G5F A;  1KBN A;  3NOF A;  3ZTL A;  4K6X A;  20GS A;  2EIR A;  4FO5 A;  4OD7 A;  2O7K A;  1A0R P;  9GSS A;  4EL1 A;  1TRS A;  4HJM A;  2IJY A;  1O7U A;  3V1W A;  2KP1 A;  3GL5 A;  4KX4 A;  5EVO A;  1PSQ A;  1QXH A;  1WMJ A;  1LBK A;  3MDK A;  1R7H A;  5HFI A;  4ZB8 A;  3F4S A;  2DIZ A;  1OKT A;  4FYB A;  2QC7 A;  3UVH A;  1B9Y C;  4MJC A;  1GSQ A;  1Y6E A;  1PKZ A;  3GKM A;  1OE8 A;  2CX4 A;  4MPF A;  2R3X A;  2V41 A;  2H8L A;  4TXO A;  4K0N A;  2C0G A;  4HQS A;  2QA1 A;  3ZVJ D;  1TRW A;  4K2X A;  2IMD A;  18GS A;  4AGS A;  2YZU A;  3NIV A;  3KH9 A;  2AAW A;  2PUK C;  1ERT A;  5GST A;  4YH2 A;  4YAV A;  5AIV A;  3MAK A;  2GSQ A;  4TRX A;  4WET A;  3G7Y A;  2HE3 A;  3FK8 A;  4OWY A;  1FOV A;  5KOW A;  4TR4 A;  2GQK A;  3IHG A;  4K5R A;  2OE1 A;  5H5R A;  3VFI A;  2B5Y A;  1ZYP A;  1FOH A;  1TJD A;  2B6M A;  2LQQ A;  2H1G A;  5F07 A;  2E2G A;  2VO4 A;  5B8A A;  3FR6 A;  3FY7 A;  5D93 A;  3DXB A;  5DAK A;  4EUY A;  2H66 A;  1VGL A;  4XHM A;  4AF2 A;  4RQR A;  1VRS D;  1MD3 A;  4OMV A;  2MMO A;  1GTB A;  5D9X A;  3QFB C;  3ZML A;  5CRH A;  3TKQ A;  4L8E A;  4EIP A;  2MMA A;  4USS A;  3F9U A;  5GAN D;  1V58 A;  4ZB9 A;  1T4Y A;  1TK0 B;  1N8J A;  5FT3 A;  1SJI A;  2C0F A;  3IC8 A;  1Z9H A;  3LFL A;  1V98 A;  3H4K A;  3UAP A;  5CRE A;  1KTE A;  5EY6 A;  3C1S A;  1EV4 A;  2H6X A;  1X9S B;  4GF0 A;  5L71 A;  4MH2 A;  3EIN A;  4IJI A;  3QFA C;  3GUS A;  3HA9 A;  3EYT A;  2KHP A;  1NSW A;  1QGV A;  3KJY A;  5G1L A;  3R2Q A;  1W4V A;  1A2J A;  4POL A;  4KUN A;  2FGX A;  2GTU A;  3D4M A;  1XBS A;  4TKY A;  2PPT A;  1AQV A;  4X43 A;  2MZC A;  2LST A;  4AJ8 A;  2GQM A;  1T1V A;  2ES7 A;  4Z7X A;  4N30 A;  1T7P B;  1ZYQ B;  2VL2 A;  5CRG A;  2WJU A;  3UOM A;  4GST A;  4J57 E;  3KXO A;  1ST9 A;  3EPT A;  1I5G A;  1SL0 B;  16GS A;  4DSR A;  1X5D A;  3EU4 A;  5JCW A;  2I4A A;  2L57 A;  3IA1 A;  1QQ2 A;  1MEK A;  2DIY A;  3KM6 A;  2GVP A;  3C8E A;  2IPA A;  3C7M A;  11GS A;  4JR6 A;  3TRX A;  3PPU A;  4KSO A;  2QA2 A;  6GSV A;  5KOX A;  2HZE B;  2A2S A;  1H75 A;  3WGX A;  2F8F A;  4N11 A;  2JSY A;  3DKS A;  4ILF A;  3VWV A;  5B8B A;  3A2X A;  1OAZ A;  5GZZ B;  1GWC A;  2M80 A;  1EWX A;  1GUM A;  4IQ1 A;  1FVJ A;  3QDN A;  3LXZ A;  4KND A;  4ULX A;  4GQF A;  5G31 A;  4HDE A;  4KGI A;  5ECN B;  2GST A;  4CDO A;  1NHO A;  2YCD A;  1AAZ A;  2WRT A;  3GN3 A;  4LL1 B;  2IME A;  1GNW A;  4PQI A;  3GSS A;  1PL2 A;  5KN3 A;  4BVX A;  1QUW A;  1Z5Y E;  2DSA A;  3M9K A;  2VL3 A;  4F82 A;  3MYD A;  2K6V A;  5AIS A;  3A3T A;  3WD6 A;  4G9H A;  4EO3 A;  2HRA A;  2R6K A;  4POM A;  2B7J A;  2PVQ A;  4POK A;  3G7I A;  2X99 A;  4Q5Q A;  1URM A;  1YZX A;  3APO A;  2IFQ A;  2FWH A;  4JRR A;  2EIO A;  3GTU B;  3HCZ A;  3IRA A;  4LL4 B;  3E0U A;  4BPY A;  1BG5 A;  5B7C A;  2MBS A;  1XZO A;  1M9A A;  4V1A g;  4K7N A;  4N0Z A;  1XXU A;  3ZIT A;  4L5O A;  4ECB A;  1PGT A;  1GSU A;  1T3B A;  1YQ1 A;  2LJA A;  1YF1 A;  1I9D A;  5IPH A;  4G0K A;  4F2I A;  2PVO C;  3BD2 A;  3TRP A;  1XWC A;  1PKW A;  2UZ8 A;  2WDU A;  5H5Q A;  6GSY A;  3H8Q A;  4MZB A;  1WWJ A;  3G7J A;  4HU7 A;  2DKI A;  4GTU A;  3GKX A;  3LSZ A;  5HR0 A;  4WEY A;  4FQU A;  4I5Q A;  1QMV A;  3GH9 A;  2QSI A;  2L6C A;  3VI5 A;  3C71 A;  2JU5 A;  2E0Q A;  1AC1 A;  2RUF A;  4GLT A;  5DVB A;  4NV5 A;  4ZIJ A;  5E4W A;  2DKH A;  4XS4 B;  3F4T A;  1GSY A;  3LOR A;  1DE1 A;  1ZYE A;  4MCU A;  2YWN A;  3U5R E;  1E6B A;  1YF0 A;  1GSD A;  4JE1 A;  4FH8 A;  2OE3 A;  2HRK A;  4LMW A;  2XBI A;  4MF5 A;  2IWT A;  2B5X A;  2HFD A;  4G19 A;  2ON7 A;  3TKS E;  2HRF A;  4JED A;  4LA1 A;  1AQW A;  2R2J A;  1XVQ A;  1TRV A;  3APQ A;  1THX A;  3DVX A;  2GZP A;  1SL1 B;  3DML A;  2B1L A;  3CSJ A;  2F3M A;  4K0G A;  4GCI A;  4I97 A;  3FKF A;  5FWG A;  1TI3 A;  3VWX A;  4ICY A;  4DSS A;  4G0I A;  1YEX A;  2A4H A;  2PN8 A;  3NZN A;  3L78 A;  3VI7 A;  2VCX A;  4TN8 A;  1O85 A;  1YEP A;  4I6X A;  2CAI A;  2V6K A;  1AIU A;  3BCI A;  2VM1 A;  5F8B A;  1HYU A;  2CQ9 A;  3CTF A;  1XW5 A;  1YKC A;  4AJ6 A;  3LG6 A;  2H0H A;  3HDC A;  2IMF A;  17GS A;  4NWY A;  2GSR A;  3TCO A;  4PX1 A;  5ABR A;  5HFK A;  4QL9 A;  2OAC A;  2FA8 A;  2AYT A;  4FYC A;  3Q6O A;  4MJE A;  3GTU A;  3EMP A;  1M2D A;  1TOF A;  2HNL A;  3FMW A;  1DUG A;  1XOB A;  5CYY A;  2YJ7 A;  4TXO B;  2WFC A;  1T8E B;  1THO A;  3GX0 A;  2H1D A;  2LUS A;  3HVS A;  3HJP A;  1VF3 A;  3O3T A;  3FRC A;  2IIY A;  5CNW A;  1K0O A;  4JZQ A;  5IMA A;  3HJO A;  4F0B A;  4P3Y B;  1Q4J A;  3EE2 A;  5F0G A;  2VOC A;  2O8V B;  4TR0 A;  4V2N A;  4MPG A;  2K8S A;  2H72 A;  1JZD A;  4IQA A;  2FA4 A;  2GQL A;  4K9Z A;  2H30 A;  3FZA A;  3GST A;  4KDU A;  3DVW A;  5G2Z A;  3J7Y k;  5G1K A;  2VCZ A;  3KZQ A;  2LEG A;  1J9B A;  3Q18 A;  5J9C A;  1X9M B;  2GGT A;  4FYU A;  2V32 A;  5AGY A;  2B7K A;  4XS4 A;  2FD3 A;  1IYH A;  2L59 A;  3ME8 A;  2LS5 A;  1YY7 A;  2TRX A;  3F0I A;  3J7Y b;  4ZBD A;  2N5A A;  2L5O A;  2VCV A;  3M9J A;  4G2E A;  5J5N A;  2AV4 A;  1GSF A;  4IGJ A;  4NAX A;  2CX3 A;  3GMF A;  1MTC A;  1O8X A;  2VLU A;  2FWG A;  4Q5N A;  5J41 A;  5BMU A;  1F3A A;  1KNG A;  1PA3 A;  5ECP B;  3PGT A;  1TK5 B;  2VIM A;  4E8H A;  2G2Q A;  1O73 A;  3QAW A;  3TJG A;  2YPM A;  1Z6M A;  1EV9 A;  3UMA A;  3KD0 A;  1HD2 A;  1FG4 A;  1GUH A;  2M46 A;  1G7E A;  2LRT A;  1OC9 A;  2HT9 A;  2PER A;  3GUR A;  2G0F A;  1ERW A;  1EOH A;  3WGD A;  3BBY A;  5KN0 A;  3KP8 A;  3RPP A;  4G0L A;  1S3A A;  1ERU A;  1B4P A;  2LNS A;  2GZY A;  5H5S A;  3WGE A;  4EDY A;  2R0C A;  4OO5 A;  1JLV A;  3TJF A;  4V2M A;  1JZW A;  1FB0 A;  3KTL A;  2IL3 A;  3TKS C;  4LMV A;  4N0V A;  1VF1 A;  1T4Z A;  2PU9 C;  5KN1 A;  2GDR A;  4WBJ A;  3TOT A;  4JR4 A;  1V40 A;  2P5R A;  5ELA A;  2VCT A;  4ZL8 A;  3IE3 A;  2H6Z A;  1K0A A;  1GTA A;  1OC8 A;  5DQS A;  4IP6 A;  3F3R A;  3I69 A;  4ECI A;  4NMU A;  4PQ1 A;  2WZ9 A;  3SBC A;  3VUR A;  4WR5 A;  2JZS A;  5DCG A;  2IMK A;  1GRX A;  2H19 A;  1F6M C;  1ILO A;  4KA0 A;  1WE0 A;  2KOK A;  3ZIV A;  1BQ7 A;  2JAC A;  1YKA A;  4TR1 B;  4O32 A;  6GSS A;  3CTG A;  1SL2 B;  3PR8 A;  5CRW A;  3HXS A;  2VD0 A;  3AY8 A;  1GSE A;  3O76 A;  4BVX B;  4PQH A;  3KIJ A;  5LD0 A;  3IPZ A;  2J23 A;  2F8A A;  5G5E A;  1MDJ A;  3TKP A;  2R37 A;  3I9V 2;  4HU9 A;  3IC4 A;  4KH7 A;  2LQO A;  3LQ7 A;  2GT5 A;  4BWS A;  2YJH A;  3GFK A;  2VCW A;  4L0U A;  2IFQ B;  1AXD A;  3M1G A;  1K3O A;  3CMI A;  4D73 B;  1JFU A;  4ECJ A;  1S3D A;  1SYX A;  1X9W B;  3GX8 A;  4FIW A;  3TKR A;  3MNG A;  5IOW A;  3CRT A;  4BA7 A;  3LGC A;  13GS A;  5DDL A;  5CAX A;  5CRD A;  1XW6 A;  5AIX A;  2LV3 A;  4XS1 A;  1S3C A;  4IW9 A;  5CP1 A;  3FHK A;  3D4T A;  1GTU A;  1A8Y A;  1F3B A;  1TP9 A;  3W8J A;  5ECM B;  4WKW A;  5IOX A;  2L5L A;  5FHI A;  1GUL A;  3HD5 A;  1CQH A;  2DLX A;  2MYG A;  2ZUP A;  4POB A;  3IAM 2;  4ZBB A;  5INY A;  3W6G A;  1F2E A;  4TVE A;  1GNE A;  1FB6 A;  5IO0 A;  1ON4 A;  6GSW A;  1E2Y A;  2QGV A;  3ZVJ A;  2L4C A;  1AW9 A;  2GSS A;  2E2M A;  5ELG A;  1SK1 A;  2JL4 A;  3VWU A;  5E59 A;  2F51 A;  2KP2 A;  1PMT A;  3GIX A;  5ECK B;  5IPG A;  4WF4 A;  5F05 A;  1WJK A;  3HJM A;  2HZF A;  1WPI A;  1EZK A;  3FW2 A;  5ECH B;  2C0E A;  3HYP A;  2X8C A;  5HR1 A;  3ZZX A;  4G10 A;  2XBQ A;  4TR1 A;  5CO3 A;  2OE0 A;  2O85 A;  1PX7 A;  1SYR A;  2GZZ A;  3EMX A;  4MAB A;  2CV4 A;  4DSS B;  2QKE A;  2YAN A;  5COH A;  4EVM A;  3D6I A;  4EDZ A;  4ZL7 A;  4IVF A;  4BWQ A;  3IBH A;  1U6T A;  2YWI A;  4MA9 A;  4YKF A;  2NTO A;  2KLX A;  2H1B A;  2HSY A;  3TB2 A;  2V1M A;  3FEU A;  3IHQ A;  2V6O A;  3H1N A;  3ISO A;  4HEA 2;  4O92 A;  1LJR A;  2I9H A;  1TK8 B;  2C3N A;  4IS0 A;  4Z2U A;  4HZ2 A;  4K1F A;  2DJ3 A;  4D73 A;  4EF0 A;  1OYJ A;  3I43 A;  1TW9 A;  2B5E A;  3A5I A;  2H0I A;  2E7P A;  3EWL A;  4RQX A;  1DSB A;  5A4W A;  3QCP A;  4GSN A;  3UAR A;  3F3Q A;  2OJL A;  3KTB A;  3TJJ A;  5J4U A;  1JZO A;  2H74 A;  3GKN A;  1PD2 1;  3E9J B;  1WIK A;  1K0M A;  1WP0 A;  4F9Z A;  5ID2 A;  4RUV A;  3UEM A;  2MMZ A;  3WT1 A;  2FWE A;  4EKZ A;  3KCM A;  3F4R A;  1M7T A;  4PXO A;  5JCG A;  1EGO A;  2HXK A;  1W89 A;  2VLV A;  2R4V A;  1XW9 A;  2R5G A;  3ED3 A;  3UVT A;  2AHE A;  3LWA A;  3R3E A;  1EGR A;  2C0D A;  1N2A A;  7GSS A;  5ECR B;  2R0P A;  2JZR A;  1XIY A;  1T00 A;  3D5J A;  3OR5 A;  4BVY A;  4IKH A;  2VCQ A;  3EVI A;  1GL8 A;  3BJ5 A;  3KEB A;  2KUC A;  1K0N A;  2WCI A;  2L6D A;  1AUC A;  4MP4 A;  2XPE A;  1ACV A;  1Z3E A;  2H70 A;  4DVC A;  2DJ0 A;  4Z2R A;  4BL7 A;  1SU9 A;  5JCU A;  2OBI A;  2DJK A;  4IBP A;  4QQ7 A;  2LJR A;  1BJX A;  1ERV A;  1SJ6 A;  3DEX A;  3GYK A;  1R5P A;  1FVK A;  10GS A;  4TOP A;  4X0X A;  4K5S A;  1GLQ A;  5D73 A;  1M9B A;  4GXZ A;  2OA7 A;  3CXG A;  1OC9 B;  2EIQ A;  4KB3 A;  2BTO T;  4MH3 A;  3IXR A;  4YKG A;  3IK9 A;  2D2Z A;  1GH2 A;  3LJR A;  2H01 A;  1MDI A;  2WS2 A;  2HLS A;  2X4A A;  2HRN A;  3P8W A;  2HSM A;  3GA4 A;  3TOU A;  4IN0 A;  2X64 A;  4N10 A;  4TR3 A;  3WYW A;  2PBJ A;  4YQV A;  2ZNM A;  4K2D A;  3Q74 A;  2FCH A;  4OO4 A;  4HUA A;  5BRT A;  3LYK A;  1NHY A;  4Z2T A;  4WF5 A;  4WR4 A;  1YJ6 A;  1PQN A;  4EC0 A;  3F6D A;  3TRQ A;  3EC3 A;  2FLS A;  1BX9 A;  2IN3 A;  4KCE A;  4KCA A;  1ZGN A;  1U87 A;  4GQC A;  3D21 A;  4A5P A;  2H71 A;  1O8W A;  1UVZ A;  1JZR A;  3HHV A;  3ZL5 A;  3ZMK A;  1ZOF A;  1EP7 A;  3VPQ A;  4IP1 A;  5F06 A;  2RM5 A;  3RHB A;  2VL9 A;  2LTK A;  2VLT A;  1A0F A;  2PGT A;  5ECI B;  1GLP A;  2X49 A;  3FYG A;  1SKR B;  3LW9 A;  3HZ8 A;  2GLR A;  1O81 A;  2OKA A;  2VL2 C;  2F9S A;  4CW9 A;  3TDG A;  4O5R A;  4ML1 A;  1ZZY A;  4PNG A;  2JSZ A;  3QMX A;  1GTI A;  2R0G A;  3UIW A;  3QR6 A;  4MDC A;  5ECL B;  2RUE A;  1X5E A;  1CQG A;  1GUK A;  1TU8 A;  5IMV A;  3ZIJ A;  1J08 A;  2TIR A;  2X8G A;  3G9B A;  3VK9 A;  4I2T A;  1ABA A;  1ZMA A;  5JWO B;  3FZ5 A;  4ZL9 A;  1M2B A;  4HQZ A;  4F03 A;  5A5K A;  2HSH A;  22GS A;  4AJ7 A;  1V9W A;  1NW2 A;  5C04 A;  6GST A;  5HFG A;  1U88 A;  4GRF A;  4IHU A;  2VM2 A;  4O5Q A;  3FR9 A;  4L0W A;  3WT2 A;  2H0G A;  1G6Y A;  1U3A A;  3ERW A;  3DGQ A;  5IMC A;  2DBC A;  2P5Q A;  2FNO A;  1TU7 A;  2FUG 2;  1XOA A;  3F6F A;  4MZW A;  4XTS A;  4MJB A;  1HNA A;  3TUE A;  2MMN A;  3LEF A;  3UBK A;  5A4V A;  2FY6 A;  4WXT A;  3CYN A;  4IEL A;  3UL3 A;  2NPB A;  2REM A;  4WBR D;  2H75 A;  4KSM A;  4XRD A;  4ECC A;  4HOJ A;  4X1U A;  1EEM A;  1XWK A;  2CT6 A;  1B8X A;  2A2P A;  2ZCT A;  1K3L A;  5D9T A;  2K9F A;  14GS A;  2C1Y A;  1G7O A;  4J56 E;  2I81 A;  3CBU A;  1XWA A;  2Z9S A;  2GS3 A;  5DBQ A;  2RM6 A;  1GSS A;  5DAL A;  1Z7R A;  3D0Z A;  3FZ9 A;  3TJB A;  3MSZ A;  3GV1 A;  2JAD A;  1B4Q A;  2DMM A;  3IV4 A;  3EU3 A;  1GP1 A;  5IMZ A;  1EEJ A;  2LNT A;  3F63 A;  4TXV A;  2WGR A;  2PMT A;  3KH7 A;  3IDV A;  1SD8 A;  4PGT A;  5HR2 A;  3C73 A;  4XS6 A;  4NPB A;  3RHC A;  3HZ4 A;  3DIE A;  1X0R A;  4L5L A;  1VF4 A;  3SWL A;  3TJK A;  4RI6 A;  1DBY A;  1BAY A;  3IR4 A;  1XWB A;  2JZT A;  3CSI A;  4PTS A;  1UA5 A;  1IYI A;  2LRN A;  4V2L A;  1TKD B;  1R5A A;  3LYP A;  5JWR B;  4CHS A;  5D8I A;  2YNX A;  3D22 A;  2YZH A;  2C8U A;  1ML6 A;  4F0C A;  2DJ1 A;  2GT6 A;  5B6N A;  2CZ3 A;  2I3Y A;  2P31 A;  4PUF C;  2LJK A;  1HQO A;  3P2A A;  2NDO A;  2K18 A;  3I6A A;  5D9V A;  2OBK A;  1SKS B;  2V2G A;  3ZRD A;  5ID2 B;  3RDW A;  4LLR A;  3ERF A;  3QPM A;  2FHE A;  4JBB A;  3S9F A;  4ID0 A;  4OCE A;  3UBL A;  4HS1 A;  2C4J A;  3L9V A;  2VAF A;  1JHB A;  2H6Y A;  3IAS 2;  1TXX A;  4BVY B;  2LKU A;  2NBS A;  4MJA A;  1V2A A;  5JWQ B;  5ECS A;  5ECQ B;  1H4O A;  2H73 A;  4GSS A;  3L0H A;  1G6W A;  5A4U A;  1EOG A;  5LNK e;  2CA8 A;  4CY8 A;  4MF7 A;  4BL7 B;  3IK7 A;  3M8N A;  3E3E A;  3QOU A;  1HNB A;  5IMD A;  1XWG A;  2L4Q A;  1XCC A;  1YDK A;  1UN2 A;  1A2L A;  2N5F A;  3DWV A;  5IQY A;  2RII A;  5IM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...