2LTLA

Solution nmr structure of nifu-like protein from saccharomyces cerevisiae, northeast structural genomics consortium (nesg) target yr313a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
b'MGHHHHHHSHMNSQRLIHIKTLTTPNENALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVESLMIGDDFLTINKDRMVHWNSIKPEIIDLLTKQLAYGEDVISKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NifU-like protein, mitochondrial
publication title Solution NMR Structure of NifU-like protein from Saccharomyces cerevisiae, Northeast Structural Genomics Consortium (NESG) Target YR313A
rcsb
source organism Saccharomyces cerevisiae
molecule tags Electron transport
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 2ltlA00
2K1HA 2LTMA 2M8WA 2M6QA 2FFMA 1PQXA 2LTLA
chains in the Genus database with same CATH superfamily
4YY3H 4LF7H 4B8CD 4KHPH 2MJHA 2CTKA 5LL6b 1XNQH 1UG8A 4BA1I 2K1HA 1FJGH 2PY9A 2LTMA 1XMOH 2E3UA 1DT4A 2CTJA 1VBIA 2FPHX 2PT7G 2UXCH 3J81W 4DV4H 4B3TH 1HR0H 4JI3H 1MSZA 2UXDH 2Y3MA 4JVYA 4QMFB 3AEVB 3J7AK 1V9NA 1I94H 5IT9W 2M8WA 5IWAH 2OPUA 4B3RH 2LTLA 3QD7X 4DUZH 4AM3A 4JI1H 3NCVA 1XRHA 1N32H 2E5LH 1TUAA 4OO1G 4FJUA 4JI0H 3EZJA 2CTLA 1NXUA 2HH2A 4X66H 4B8TA 3UOEA 2OPVA 5DT9A 4K0KH 2UUCH 4JI4H 2CTFA 4AIMA 2D9IA 1N34H 4LF8H 2JVZA 4JI7H 2PQUA 5LMUH 4LFCH 5BR8H 2JA9A 2VQEH 2AXYA 1VIHA 2LF0A 2JEBI 3FAUA 2FFMA 1XMQH 1PQXA 4X65H 4JI6H 3V69A 3OSSD 1X4NA 4G08A 4BA2I 4B3SH 4OX9H 2BL5A 4LIJA 3KDGA 2VQFH 4DV7H 2P2RA 4LFBH 3SB1A 2CPQA 5LMNH 1K1GA 1KHMA 4EC5A 2CWFA 4JI5H 1V8CA 4LF5H 2CTEA 4GKJH 4DV5H 4DV2H 4LF6H 1XNRH 4DV3H 2UUAH 1J5KA 2CPMA 4NZTM 4LFAH 2NN6G 4IFDG 3U1KA 1S03G 4DR3H 4YHHH 4DR4H 2G8YA 2UU9H 4OD6A 1S20A 2Z0SA 4AQYH 4DV1H 1IBMH 3T1HH 2ANRA 3J80W 2DGRA 1WE8A 1SEIA 3RF2A 1IBLH 4LF9H 1X4MA 2O4CA 1J4WA 4NBQA 4PDBA 2CTMA 2QNDA 1WVNA 3T1YH 1IBKH 4NXMH 4JV5H 1EC6A 1X9ZA 1ZZIA 1I6UA 4X62H 4X64H 4JI8H 4LF4H 4DV0H 1WTJA 3L7ZC 4DUYH 3OETA 3GR5A 5A2QW 1HNZH 4JVHA 4GKKH 2JEAI 1DTJA 4WANA 5C0XG 2ZM6H 2LRRA 4NZRM 4DR1H 4DR5H 4DV6H 1ZZJA 1VIGA 4JYAH 5JEAG 2UXBH 4E9JA 4WALA 4B3MH 1N36H 1ZZKA 2ZQEA 3VKEA 3OTOH 4OCHA 1HNWH 2HHHH 3KDKA 1N33H 1WHRA 2UUBH 2M6QA 4DR2H 5K36G 2A1SA 1AN7A 2HH3A 2JZXA 4JI2H 1Z2IA 2F4VH 4DR7H 3JAMW 3GKUA 2ANNA 5FLXW 2FMRA 1J5EH 1HNXH 2JE6I 1ZTGA 2CWHA 2VKCA 1X0AA 2YQRA 1ODHA 1FKAH 3I0PA 2BA0A 4FJSA 2X06A 4DR6H 4H8AA 4NXNH 1F0XA 3GABA
chains in the Genus database with same CATH topology
2K1HA 2LTMA 2M8WA 2M6QA 2FFMA 1PQXA 2LTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1H A;  2LTM A;  2M8W A;  2M6Q A;  2FFM A;  1PQX A;  2LTL A; 
#chains in the Genus database with same CATH topology
 4YY3 H;  4LF7 H;  4B8C D;  4KHP H;  2MJH A;  2CTK A;  5LL6 b;  1XNQ H;  1UG8 A;  4BA1 I;  2K1H A;  1FJG H;  2PY9 A;  2LTM A;  1XMO H;  2E3U A;  1DT4 A;  2CTJ A;  1VBI A;  2FPH X;  2PT7 G;  2UXC H;  3J81 W;  4DV4 H;  4B3T H;  1HR0 H;  4JI3 H;  1MSZ A;  2UXD H;  2Y3M A;  4JVY A;  4QMF B;  3AEV B;  3J7A K;  1V9N A;  1I94 H;  5IT9 W;  2M8W A;  5IWA H;  2OPU A;  4B3R H;  2LTL A;  3QD7 X;  4DUZ H;  4AM3 A;  4JI1 H;  3NCV A;  1XRH A;  1N32 H;  2E5L H;  1TUA A;  4OO1 G;  4FJU A;  4JI0 H;  3EZJ A;  2CTL A;  1NXU A;  2HH2 A;  4X66 H;  4B8T A;  3UOE A;  2OPV A;  5DT9 A;  4K0K H;  2UUC H;  4JI4 H;  2CTF A;  4AIM A;  2D9I A;  1N34 H;  4LF8 H;  2JVZ A;  4JI7 H;  2PQU A;  5LMU H;  4LFC H;  5BR8 H;  2JA9 A;  2VQE H;  2AXY A;  1VIH A;  2LF0 A;  2JEB I;  3FAU A;  2FFM A;  1XMQ H;  1PQX A;  4X65 H;  4JI6 H;  3V69 A;  3OSS D;  1X4N A;  4G08 A;  4BA2 I;  4B3S H;  4OX9 H;  2BL5 A;  4LIJ A;  3KDG A;  2VQF H;  4DV7 H;  2P2R A;  4LFB H;  3SB1 A;  2CPQ A;  5LMN H;  1K1G A;  1KHM A;  4EC5 A;  2CWF A;  4JI5 H;  1V8C A;  4LF5 H;  2CTE A;  4GKJ H;  4DV5 H;  4DV2 H;  4LF6 H;  1XNR H;  4DV3 H;  2UUA H;  1J5K A;  2CPM A;  4NZT M;  4LFA H;  2NN6 G;  4IFD G;  3U1K A;  1S03 G;  4DR3 H;  4YHH H;  4DR4 H;  2G8Y A;  2UU9 H;  4OD6 A;  1S20 A;  2Z0S A;  4AQY H;  4DV1 H;  1IBM H;  3T1H H;  2ANR A;  3J80 W;  2DGR A;  1WE8 A;  1SEI A;  3RF2 A;  1IBL H;  4LF9 H;  1X4M A;  2O4C A;  1J4W A;  4NBQ A;  4PDB A;  2CTM A;  2QND A;  1WVN A;  3T1Y H;  1IBK H;  4NXM H;  4JV5 H;  1EC6 A;  1X9Z A;  1ZZI A;  1I6U A;  4X62 H;  4X64 H;  4JI8 H;  4LF4 H;  4DV0 H;  1WTJ A;  3L7Z C;  4DUY H;  3OET A;  3GR5 A;  5A2Q W;  1HNZ H;  4JVH A;  4GKK H;  2JEA I;  1DTJ A;  4WAN A;  5C0X G;  2ZM6 H;  2LRR A;  4NZR M;  4DR1 H;  4DR5 H;  4DV6 H;  1ZZJ A;  1VIG A;  4JYA H;  5JEA G;  2UXB H;  4E9J A;  4WAL A;  4B3M H;  1N36 H;  1ZZK A;  2ZQE A;  3VKE A;  3OTO H;  4OCH A;  1HNW H;  2HHH H;  3KDK A;  1N33 H;  1WHR A;  2UUB H;  2M6Q A;  4DR2 H;  5K36 G;  2A1S A;  1AN7 A;  2HH3 A;  2JZX A;  4JI2 H;  1Z2I A;  2F4V H;  4DR7 H;  3JAM W;  3GKU A;  2ANN A;  5FLX W;  2FMR A;  1J5E H;  1HNX H;  2JE6 I;  1ZTG A;  2CWH A;  2VKC A;  1X0A A;  2YQR A;  1ODH A;  1FKA H;  3I0P A;  2BA0 A;  4FJS A;  2X06 A;  4DR6 H;  4H8A A;  4NXN H;  1F0X A;  3GAB A; 
#chains in the Genus database with same CATH homology
 2K1H A;  2LTM A;  2M8W A;  2M6Q A;  2FFM A;  1PQX A;  2LTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...