2LTLA

Solution nmr structure of nifu-like protein from saccharomyces cerevisiae, northeast structural genomics consortium (nesg) target yr313a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
MGHHHHHHSHMNSQRLIHIKTLTTPNENALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVESLMIGDDFLTINKDRMVHWNSIKPEIIDLLTKQLAYGEDVISKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of NifU-like protein from Saccharomyces cerevisiae, Northeast Structural Genomics Consortium (NESG) Target YR313A
rcsb
source organism Saccharomyces cerevisiae
molecule tags Electron transport
molecule keywords NifU-like protein, mitochondrial
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 2ltlA00
2FFMA 2LTMA 2M8WA 1PQXA 2LTLA 2K1HA 2M6QA
chains in the Genus database with same CATH superfamily
4DR3H 4G08A 1TUAA 5K36G 2ANRA 3FAUA 2ZM6H 1J5EH 4K0KH 1WE8A 2FPHX 2UXDH 1DTJA 1XNQH 2Z0SA 3NCVA 4X62H 2CWFA 4DV5H 1ZZJA 1X0AA 2UU9H 4LF4H 2X06A 4NXNH 2OPUA 1MSZA 2K1HA 1XMQH 4QMFB 4NZTM 2JEBI 3KDGA 2E5LH 2ZQEA 4LFCH 4LF9H 4FJUA 3U1KA 2PQUA 3GABA 2VKCA 1J4WA 2PT7G 1IBKH 1V8CA 1I94H 1XMOH 2AXYA 4FJSA 5LL6b 1PQXA 1X4MA 3KDKA 2O4CA 1XRHA 2BL5A 1VIGA 4B3MH 1ZZKA 2LTMA 1IBMH 4H8AA 3J80W 4JV5H 2UUCH 2JEAI 4DV6H 2CTJA 4DV4H 4LFBH 1SEIA 1F0XA 4PDBA 2CPMA 1ZTGA 4JI0H 4IFDG 5LMUH 2G8YA 2HH2A 2QNDA 1V9NA 1FJGH 3AEVB 1N34H 2CTFA 2NN6G 5BR8H 2HH3A 3UOEA 4E9JA 3I0PA 4YY3H 1HR0H 1S20A 4JYAH 2JZXA 4OX9H 2JA9A 4JI2H 4LF7H 3J7AK 2A1SA 4JI4H 1WHRA 3L7ZC 4DV3H 4LFAH 4B3SH 2CWHA 2M8WA 1X9ZA 4OCHA 2ANNA 4YHHH 4B8CD 3SB1A 3T1YH 1ODHA 4LF6H 1VIHA 1EC6A 2UXBH 2E3UA 2BA0A 2HHHH 4JI3H 4DR7H 5IWAH 1I6UA 1N32H 5IT9W 4DR2H 4GKJH 1S03G 1AN7A 2JVZA 4DUZH 2CTMA 2F4VH 5A2QW 3OETA 1WTJA 4NXMH 5FLXW 2FMRA 3OTOH 1IBLH 2CPQA 2M6QA 5DT9A 2FFMA 3EZJA 1NXUA 4B3TH 1N33H 3QD7X 4EC5A 2DGRA 4NZRM 4B8TA 4JI5H 2UXCH 2CTLA 4JI1H 2D9IA 4AQYH 1KHMA 4DV1H 1ZZIA 2P2RA 4AIMA 2LF0A 4WANA 4DR6H 2CTKA 4DV0H 5LMNH 3T1HH 1WVNA 4KHPH 1DT4A 4BA1I 4DUYH 4DV7H 1XNRH 4JVHA 4LF8H 4OD6A 4JVYA 5C0XG 3OSSD 4LIJA 2PY9A 4X66H 4GKKH 3VKEA 1K1GA 4JI6H 1HNZH 2UUAH 4X65H 4DV2H 4B3RH 3J81W 3GR5A 3V69A 4WALA 4LF5H 3JAMW 1FKAH 2VQEH 4AM3A 2OPVA 2YQRA 3GKUA 4DR1H 1HNWH 4JI7H 1Z2IA 1HNXH 2UUBH 2LRRA 5JEAG 4OO1G 2CTEA 2LTLA 1N36H 2MJHA 2JE6I 4NBQA 1UG8A 2Y3MA 1VBIA 2VQFH 4DR5H 4DR4H 3RF2A 4JI8H 1J5KA 4BA2I 1X4NA 4X64H
chains in the Genus database with same CATH topology
2FFMA 2LTMA 2M8WA 1PQXA 2LTLA 2K1HA 2M6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFM A;  2LTM A;  2M8W A;  1PQX A;  2LTL A;  2K1H A;  2M6Q A; 
#chains in the Genus database with same CATH topology
 4DR3 H;  4G08 A;  1TUA A;  5K36 G;  2ANR A;  3FAU A;  2ZM6 H;  1J5E H;  4K0K H;  1WE8 A;  2FPH X;  2UXD H;  1DTJ A;  1XNQ H;  2Z0S A;  3NCV A;  4X62 H;  2CWF A;  4DV5 H;  1ZZJ A;  1X0A A;  2UU9 H;  4LF4 H;  2X06 A;  4NXN H;  2OPU A;  1MSZ A;  2K1H A;  1XMQ H;  4QMF B;  4NZT M;  2JEB I;  3KDG A;  2E5L H;  2ZQE A;  4LFC H;  4LF9 H;  4FJU A;  3U1K A;  2PQU A;  3GAB A;  2VKC A;  1J4W A;  2PT7 G;  1IBK H;  1V8C A;  1I94 H;  1XMO H;  2AXY A;  4FJS A;  5LL6 b;  1PQX A;  1X4M A;  3KDK A;  2O4C A;  1XRH A;  2BL5 A;  1VIG A;  4B3M H;  1ZZK A;  2LTM A;  1IBM H;  4H8A A;  3J80 W;  4JV5 H;  2UUC H;  2JEA I;  4DV6 H;  2CTJ A;  4DV4 H;  4LFB H;  1SEI A;  1F0X A;  4PDB A;  2CPM A;  1ZTG A;  4JI0 H;  4IFD G;  5LMU H;  2G8Y A;  2HH2 A;  2QND A;  1V9N A;  1FJG H;  3AEV B;  1N34 H;  2CTF A;  2NN6 G;  5BR8 H;  2HH3 A;  3UOE A;  4E9J A;  3I0P A;  4YY3 H;  1HR0 H;  1S20 A;  4JYA H;  2JZX A;  4OX9 H;  2JA9 A;  4JI2 H;  4LF7 H;  3J7A K;  2A1S A;  4JI4 H;  1WHR A;  3L7Z C;  4DV3 H;  4LFA H;  4B3S H;  2CWH A;  2M8W A;  1X9Z A;  4OCH A;  2ANN A;  4YHH H;  4B8C D;  3SB1 A;  3T1Y H;  1ODH A;  4LF6 H;  1VIH A;  1EC6 A;  2UXB H;  2E3U A;  2BA0 A;  2HHH H;  4JI3 H;  4DR7 H;  5IWA H;  1I6U A;  1N32 H;  5IT9 W;  4DR2 H;  4GKJ H;  1S03 G;  1AN7 A;  2JVZ A;  4DUZ H;  2CTM A;  2F4V H;  5A2Q W;  3OET A;  1WTJ A;  4NXM H;  5FLX W;  2FMR A;  3OTO H;  1IBL H;  2CPQ A;  2M6Q A;  5DT9 A;  2FFM A;  3EZJ A;  1NXU A;  4B3T H;  1N33 H;  3QD7 X;  4EC5 A;  2DGR A;  4NZR M;  4B8T A;  4JI5 H;  2UXC H;  2CTL A;  4JI1 H;  2D9I A;  4AQY H;  1KHM A;  4DV1 H;  1ZZI A;  2P2R A;  4AIM A;  2LF0 A;  4WAN A;  4DR6 H;  2CTK A;  4DV0 H;  5LMN H;  3T1H H;  1WVN A;  4KHP H;  1DT4 A;  4BA1 I;  4DUY H;  4DV7 H;  1XNR H;  4JVH A;  4LF8 H;  4OD6 A;  4JVY A;  5C0X G;  3OSS D;  4LIJ A;  2PY9 A;  4X66 H;  4GKK H;  3VKE A;  1K1G A;  4JI6 H;  1HNZ H;  2UUA H;  4X65 H;  4DV2 H;  4B3R H;  3J81 W;  3GR5 A;  3V69 A;  4WAL A;  4LF5 H;  3JAM W;  1FKA H;  2VQE H;  4AM3 A;  2OPV A;  2YQR A;  3GKU A;  4DR1 H;  1HNW H;  4JI7 H;  1Z2I A;  1HNX H;  2UUB H;  2LRR A;  5JEA G;  4OO1 G;  2CTE A;  2LTL A;  1N36 H;  2MJH A;  2JE6 I;  4NBQ A;  1UG8 A;  2Y3M A;  1VBI A;  2VQF H;  4DR5 H;  4DR4 H;  3RF2 A;  4JI8 H;  1J5K A;  4BA2 I;  1X4N A;  4X64 H; 
#chains in the Genus database with same CATH homology
 2FFM A;  2LTM A;  2M8W A;  1PQX A;  2LTL A;  2K1H A;  2M6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...