2LTLA

Solution nmr structure of nifu-like protein from saccharomyces cerevisiae, northeast structural genomics consortium (nesg) target yr313a
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
MGHHHHHHSHMNSQRLIHIKTLTTPNENALKFLSTDGEMLQTRGSKSIVIKNTDENLINHSKLAQQIFLQCPGVESLMIGDDFLTINKDRMVHWNSIKPEIIDLLTKQLAYGEDVISKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NifU-like protein, mitochondrial
publication title Solution NMR Structure of NifU-like protein from Saccharomyces cerevisiae, Northeast Structural Genomics Consortium (NESG) Target YR313A
rcsb
source organism Saccharomyces cerevisiae
molecule tags Electron transport
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08712 Nfu_N Scaffold protein Nfu/NifU N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Scaffold protein Nfu/NifU, N-terminal domain 2ltlA00
2FFMA 2LTLA 1PQXA 2M6QA 2K1HA 2LTMA 2M8WA
chains in the Genus database with same CATH superfamily
3V69A 1WVNA 3OSSD 1VIGA 4B3MH 1IBKH 1ZTGA 4DV5H 1XNQH 4OD6A 2HHHH 1N34H 4B3TH 1SEIA 4YY3H 4LF8H 1XNRH 1ODHA 3RF2A 1HNWH 1S03G 4JVHA 2Z0SA 4JI0H 1Z2IA 3KDKA 4DUYH 4LF6H 1I94H 1X0AA 4DR3H 4FJUA 4DR5H 1K1GA 4WANA 4B3SH 1WE8A 4OCHA 4NBQA 1ZZJA 4LF5H 4LFCH 4OO1G 4DV3H 4B8TA 2CTLA 2M8WA 2NN6G 2PQUA 2ZM6H 4DUZH 5FLXW 5JEAG 2UU9H 2ZQEA 4B8CD 4X64H 4JI4H 3OETA 4AM3A 3AEVB 4DR1H 2HH3A 4DR4H 4JYAH 1MSZA 5IT9W 1J5KA 2UXCH 4LF7H 4JI8H 2UUAH 4GKJH 4NZTM 5C0XG 4FJSA 2VKCA 1IBLH 1DTJA 2F4VH 2JEBI 4DR2H 2MJHA 3OTOH 1F0XA 4DR7H 1PQXA 1XRHA 4G08A 1X4NA 3J80W 2X06A 1I6UA 2O4CA 2LF0A 1KHMA 2CWHA 4LF4H 3GR5A 4BA2I 3UOEA 4WALA 1WTJA 2CPMA 2YQRA 3SB1A 1TUAA 5LL6b 1UG8A 4JV5H 3U1KA 2VQEH 2ANNA 2AXYA 2LRRA 2G8YA 2D9IA 4AIMA 4EC5A 1ZZIA 1N36H 4DR6H 1J5EH 4NZRM 4DV6H 4JI6H 2A1SA 2JVZA 5DT9A 1XMOH 1FJGH 2PY9A 1ZZKA 4GKKH 1AN7A 2M6QA 1NXUA 3JAMW 4X65H 4LF9H 3QD7X 4OX9H 4AQYH 2PT7G 5BR8H 1EC6A 4DV0H 1S20A 1V8CA 4PDBA 2E5LH 1X9ZA 3J7AK 5K36G 1WHRA 3GKUA 4NXMH 2UXDH 1VBIA 1J4WA 4K0KH 3T1HH 4LFAH 1N32H 1VIHA 2CWFA 4JI2H 3L7ZC 2VQFH 2JEAI 2CTEA 4JI3H 2JA9A 3KDGA 3VKEA 4NXNH 4IFDG 4B3RH 1FKAH 2FPHX 5LMNH 2LTMA 2DGRA 2CTJA 2Y3MA 1HR0H 1HNXH 4JI1H 2UXBH 2CTKA 2CTMA 2OPUA 2UUCH 2CTFA 4DV1H 3I0PA 4H8AA 1XMQH 4E9JA 2FMRA 4X66H 4X62H 4LFBH 5A2QW 4LIJA 3FAUA 4DV2H 5LMUH 2JE6I 2OPVA 2QNDA 3EZJA 1IBMH 4KHPH 2JZXA 2ANRA 1V9NA 5IWAH 4DV4H 2CPQA 1DT4A 1N33H 2UUBH 3J81W 4BA1I 2FFMA 2HH2A 3GABA 2E3UA 3NCVA 2P2RA 4QMFB 1HNZH 2BA0A 4JVYA 4YHHH 1X4MA 2BL5A 2LTLA 4JI7H 2K1HA 3T1YH 4DV7H 4JI5H
chains in the Genus database with same CATH topology
2FFMA 2LTLA 1PQXA 2M6QA 2K1HA 2LTMA 2M8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFM A;  2LTL A;  1PQX A;  2M6Q A;  2K1H A;  2LTM A;  2M8W A; 
#chains in the Genus database with same CATH topology
 3V69 A;  1WVN A;  3OSS D;  1VIG A;  4B3M H;  1IBK H;  1ZTG A;  4DV5 H;  1XNQ H;  4OD6 A;  2HHH H;  1N34 H;  4B3T H;  1SEI A;  4YY3 H;  4LF8 H;  1XNR H;  1ODH A;  3RF2 A;  1HNW H;  1S03 G;  4JVH A;  2Z0S A;  4JI0 H;  1Z2I A;  3KDK A;  4DUY H;  4LF6 H;  1I94 H;  1X0A A;  4DR3 H;  4FJU A;  4DR5 H;  1K1G A;  4WAN A;  4B3S H;  1WE8 A;  4OCH A;  4NBQ A;  1ZZJ A;  4LF5 H;  4LFC H;  4OO1 G;  4DV3 H;  4B8T A;  2CTL A;  2M8W A;  2NN6 G;  2PQU A;  2ZM6 H;  4DUZ H;  5FLX W;  5JEA G;  2UU9 H;  2ZQE A;  4B8C D;  4X64 H;  4JI4 H;  3OET A;  4AM3 A;  3AEV B;  4DR1 H;  2HH3 A;  4DR4 H;  4JYA H;  1MSZ A;  5IT9 W;  1J5K A;  2UXC H;  4LF7 H;  4JI8 H;  2UUA H;  4GKJ H;  4NZT M;  5C0X G;  4FJS A;  2VKC A;  1IBL H;  1DTJ A;  2F4V H;  2JEB I;  4DR2 H;  2MJH A;  3OTO H;  1F0X A;  4DR7 H;  1PQX A;  1XRH A;  4G08 A;  1X4N A;  3J80 W;  2X06 A;  1I6U A;  2O4C A;  2LF0 A;  1KHM A;  2CWH A;  4LF4 H;  3GR5 A;  4BA2 I;  3UOE A;  4WAL A;  1WTJ A;  2CPM A;  2YQR A;  3SB1 A;  1TUA A;  5LL6 b;  1UG8 A;  4JV5 H;  3U1K A;  2VQE H;  2ANN A;  2AXY A;  2LRR A;  2G8Y A;  2D9I A;  4AIM A;  4EC5 A;  1ZZI A;  1N36 H;  4DR6 H;  1J5E H;  4NZR M;  4DV6 H;  4JI6 H;  2A1S A;  2JVZ A;  5DT9 A;  1XMO H;  1FJG H;  2PY9 A;  1ZZK A;  4GKK H;  1AN7 A;  2M6Q A;  1NXU A;  3JAM W;  4X65 H;  4LF9 H;  3QD7 X;  4OX9 H;  4AQY H;  2PT7 G;  5BR8 H;  1EC6 A;  4DV0 H;  1S20 A;  1V8C A;  4PDB A;  2E5L H;  1X9Z A;  3J7A K;  5K36 G;  1WHR A;  3GKU A;  4NXM H;  2UXD H;  1VBI A;  1J4W A;  4K0K H;  3T1H H;  4LFA H;  1N32 H;  1VIH A;  2CWF A;  4JI2 H;  3L7Z C;  2VQF H;  2JEA I;  2CTE A;  4JI3 H;  2JA9 A;  3KDG A;  3VKE A;  4NXN H;  4IFD G;  4B3R H;  1FKA H;  2FPH X;  5LMN H;  2LTM A;  2DGR A;  2CTJ A;  2Y3M A;  1HR0 H;  1HNX H;  4JI1 H;  2UXB H;  2CTK A;  2CTM A;  2OPU A;  2UUC H;  2CTF A;  4DV1 H;  3I0P A;  4H8A A;  1XMQ H;  4E9J A;  2FMR A;  4X66 H;  4X62 H;  4LFB H;  5A2Q W;  4LIJ A;  3FAU A;  4DV2 H;  5LMU H;  2JE6 I;  2OPV A;  2QND A;  3EZJ A;  1IBM H;  4KHP H;  2JZX A;  2ANR A;  1V9N A;  5IWA H;  4DV4 H;  2CPQ A;  1DT4 A;  1N33 H;  2UUB H;  3J81 W;  4BA1 I;  2FFM A;  2HH2 A;  3GAB A;  2E3U A;  3NCV A;  2P2R A;  4QMF B;  1HNZ H;  2BA0 A;  4JVY A;  4YHH H;  1X4M A;  2BL5 A;  2LTL A;  4JI7 H;  2K1H A;  3T1Y H;  4DV7 H;  4JI5 H; 
#chains in the Genus database with same CATH homology
 2FFM A;  2LTL A;  1PQX A;  2M6Q A;  2K1H A;  2LTM A;  2M8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...