2LTOA

Tdrd3 complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
58
structure length
58
Chain Sequence
MKMWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tudor domain-containing protein 3
publication title Recognition of asymmetrically dimethylated arginine by TDRD3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transferase
total genus 8
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2012-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ltoA00
3OYMA 3L2VA 5C6SA 4IUPA 5KE2A 1H3ZA 3OMCA 4QW2A 2LCCA 3LGLA 2M16A 2MWOA 3LLRA 3Q1JA 3OY9A 2BIVA 3S3MA 3S3NA 3NTKA 2E5QA 1RI0A 2L3RA 2LDMA 2PQWA 4IUVA 4Q5WA 2F5KA 5KH6A 2M1HA 3QJ6A 3NTIA 3O8VA 3H8ZA 3MP1A 3C4SA 3OA6A 2HQEA 2R58A 3DB3A 5KE3A 3QBYA 2LVMA 4OVAA 3OYBA 4B9WA 1G5VA 3DLMA 4N4GA 2CKKA 2RI2A 2RJEA 2R5MA 3META 1WJQA 2JZ2A 3OQ5A 2RJDA 3OYAA 3M9QA 1XNIA 2NLUA 3UWNA 4ZTFA 4E7KA 4L59A 4BD3A 2EQJA 2R57A 2RI5A 3GOXA 4QVZA 4HCZA 4N4HA 3P8HA 3NTHA 3DB4A 1WJRA 3L42A 3MP6A 3QIIA 4IUUA 3MEAA 4IUQA 2RJFA 5KCOA 3LX7A 3L2RA 1KHCA 2D9TA 3SD4A 3OYCA 5D6XA 4Z02A 4BE0A 1MHNA 4C5IA 2GF7A 3OYLA 4BDZA 2XK0A 1OYXA 2GFUA 3OYGA 4E7HA 3E9GA 1SSFA 3LH0A 2X4XA 3F70A 4RG2A 4C5GA 4E7JA 2EQMA 2XDPA 3PFSA 4A4EA 3LGFA 3OYJA 3OS2A 4FU6A 2B8AA 3LYIA 2JTFA 2P0KA 3MEUA 3MP8A 3OB9A 3OYIA 2L8DA 4A4FA 3MEWA 5D6YA 2EQUA 4A4GA 2RJCA 2WACA 4PLLA 4E7LA 4PLIA 5IN1A 2K3XA 1N27A 3BDLA 5IAYA 2BKDN 2M0OA 3P8DA 4CRIA 2RO0A 2RHUA 4N4IA 3S3OA 2RHXA 3OMGA 3MO8A 5FRNA 3OYFA 5CIUA 2RI3A 2EQKA 2MWPA 4QQGA 2GFAA 3OYEA 1WGSA 4A4HA 3OYHA 1OI1A 2FHDA 2L89A 5D6WA 3OYNA 5FRMA 2DIGA 2RHZA 1OZ3A 3H6ZA 4C5HA 3OYDA 4UC4A 3FC3A 5KCHA 4B9XA 2EFIA 3FEOA 2X35A 5FROA 4FL6A 3PMTA 2O4XB 3CEYA 2HQXA 1WJSA 2DIQA 3E9FA 4GY5A 4II1A 2EKOA 4IKFA 4LD6A 4IURA 3QKJA 3EAEA 1OZ2A 2LRQA 2IG0A 2YRVA 3ME9A 4IUTA 4QQ6A 3L2QA 4PL6A 4ZTJA 2QQRA 2X4WA 3S6WA 2QQSA 3ZEHA 4BDYA 3ASKA 2BUDA 2X4YA 5J26A 4NS5A 4BE1A 3FDRA 2K3YA 3UT1A 5C0MA 3L2UA 4BE2A 3MEVA 4QQDA 4C5EA 3OYKA 2G3RA 4E7IA 2LTOA 2R5AA 2RHIA 2DAQA 4EDUA 2O4XA 3KUFA 4X34A 3L2WA 2RHYA 2VYTA 5J39A 3PNWC 3OS0A 2E6NA 4BACA 3FLGA 3PMIA 3OS1A 5M9OA
chains in the Genus database with same CATH superfamily
1NPPA 2H3EB 4EMGA 2FZGB 2LT4A 5LJ5g 4RTYA 3GIBA 1IHWA 2ZAEA 2JTEA 4QVCA 2DM1A 1WLPB 5I11A 3OA6A 1M30A 1KG1A 1FYNA 5D7UA 2YWWA 2MK5A 4M77F 5GAN5 2YUNA 1JU5C 2KXCA 1WXTA 2KT1A 5AYFA 4ANJA 4ZGDB 2EYQA 3M0RA 3VJPA 1RADB 2ROLA 4JJDA 4N4HA 2SRCA 4C0ZA 3QIIA 1WHMA 2DL3A 2KRNA 4C8QG 1VQ4T 1VQPQ 2YSQA 5GMKl 2VXFA 2KXDA 2M9UA 1JB0E 3MEUA 4OB0B 4A4FA 1D0YA 2EJFA 2GTJA 2WACA 1GBRA 4PLIA 3A5ZB 4XU3A 1YIJT 1GXIE 2RO0A 1VQ9Q 4CC4B 1PKTA 1UHFA 3I55T 4XU1A 4JJCA 2F2WA 3OBYA 3I56A 1YWPA 5KCHA 1BI0A 2QEXT 1JJ2S 1RACB 2XI9A 4C8QB 3EFOB 3CC7Q 2DIQA 1YITT 1K8AC 2DZ9A 4M78F 2YRVA 3ME9A 3L2QA 3S6WA 2LJ0A 1T3SA 3UT1A 2JOYA 4M7DE 2K57A 4KRTA 5GMKj 5A0LA 3CCQQ 2OTLT 1TOVA 3L2WA 2PTKA 4PNOA 1NYFA 2ZGWA 4J6WA 5J39A 2E6NA 4WTOB 4D8KA 3RNJA 3G71T 1VQ5A 2BTTA 2MMPA 2FG0A 5GANh 4F7UG 2BIVA 1KSWA 1RI0A 3HRUA 2DBKA 1UGVA 4OMQA 4J9EA 3DB3A 5KE3A 1A0NB 1YHQA 5CR2A 1QCOA 1RLQC 3MPUB 2O01E 8AT1B 2JM8A 1IZ6A 2CP6A 4JJBA 3SEMA 3SWNB 2DTIA 1AWJA 5IT9E 4NOYA 3CC2A 4BD3A 4RTTA 4Z89A 2VUBA 4C92E 4F7UB 4BE0A 1MHNA 5GMKi 4Y91A 3JB9F 4RG2A 4OGEA 2VKNA 1SF9A 2EPDA 4C0DC 2DL5A 5DM7R 1PM3A 1GCQA 2E12A 5IAYA 4XTZA 5I2MA 1IXDA 1C0MA 3M57A 4RMOA 3GP8A 1X27A 1TTHB 4OMNA 2MI6A 3OYHA 2VGMA 3JB9I 4RKUE 3CCVA 3CCMQ 4DBQA 4HVUA 5GAMh 2RNAA 2CSQA 3QYGB 5FROA 2XHCA 4PJOE 4XTUA 1WJSA 3GF5A 1VQ8A 4DBHA 2KMTA 2XKOC 3JB9D 1OZ2A 1RAEB 4QQ6A 1IHVA 4XTVA 1YCSB 4ZTJA 1M90R 3WVDB 3ASKA 2RM4A 4XAXB 3GPLA 3BE3A 2CREA 4M75F 1WIEA 1V76A 3VS1A 2DD4A 4AG1C 3QJYA 1VQ6A 3D7SB 3HTRA 5FWBA 1H92A 1S72T 2HD0A 3NFCA 1OOTA 3VUZA 2CP5A 1I4K1 3RKWA 2LMJA 1AWXA 4LDXA 4OB3B 2FZKB 3S3MA 3QDFA 3V7RA 4O5VA 2A08A 2K5LA 2F2XA 1OU8A 2MYSA 3SB2A 4RTUA 4HKEA 1VQ7T 4PFZA 2DXTA 1E6GA 1AD5A 4M75D 3C95A 4E47A 3CCET 2E4HA 1TUDA 2EJ9A 3TQ7P 1BYMA 3JAME 1LVKA 1QKXA 3G4SA 4EMHA 2YUPA 4HCCA 1VQNT 1B7TA 1YP5A 3SFMA 2MOXA 1W2BP 3EGDA 3MEAA 1Y57A 2KRSA 2RJFA 2EVRA 2DERA 2AZSA 1P92A 1O75A 1WI7A 1SPKA 1JJ2P 2X4XA 4GBQA 2EQMA 3JCMh 1JQQA 4FYVB 4M77G 1I5LA 3CD6A 3LWIA 1BK2A 3MEWA 1JO8A 4RUGA 4DEYA 4BY6C 1TG0A 4AMCA 2RI3A 3OYEA 2RMOA 2DD5A 2C06A 3CMAT 2QA4T 4RTXA 1Y7XA 1QQJA 1M2VA 2L2PA 3SHWA 2EYWA 3CXCA 4PK4A 2HQXA 2WSCE 3ZFJA 4OF1A 5FU7C 4B6MA 2J06A 2RQWA 5GAN6 4C0FA 4M77B 1WQ7A 5LJ5j 2J7IA 2X4YA 2A28A 3M54A 4C8QE 3CCRT 1UECA 1MMNA 3V8JA 2X4JA 3FRNA 4FSXA 4M7DA 1FMWA 4BACA 2YDLA 2KNBB 5LJ3h 3QYHB 5FW9A 1D1CA 1AEYA 3NPFA 4ZGJB 3QSUA 4HA8A 3M4YA 3OBWA 3LLRA 1YJWT 3I56Q 2C0OA 2L5QA 5KYUA 1QVFP 4M78G 3NTIA 2DRMA 1X6OA 4D6WA 1PSFA 1Y96B 1W2BA 4IIMA 2P0PA 2NWMA 4M7AF 1TU0B 1UGRB 2VC8A 4PJLA 3V7CA 2E65A 1CKBA 1DJ7B 2R5MA 3HRTA 1JJ2A 1WJQA 4LDUA 2PUKB 4EMKA 1M8MA 1ZA2B 4EPCA 1BBZA 1XJWB 1XQHA 1NLOC 1WPYA 1IO6A 1Y0MA 2BZXA 3MP6A 3L42A 3P8BB 1R0BG 1VQ5Q 1TH7A 1G83A 4M78B 4C92A 4KULA 2QGGA 4A4KA 3PFSA 4V2SA 2YUOA 3MP8A 1AHJB 1D3BA 4C92C 2ZPFB 4F7UE 1YHQQ 2K3XA 5DY9A 2XMFA 1ZQ1A 3MO8A 3X25B 2MWPA 3CC7A 3HL8A 1FWZA 3ER0A 3PVQA 1PD0A 3TVTA 1VQPT 1BIAA 2L89A 4LE9A 1BI3A 2K9GA 5KYNA 1ZSZA 2NUTA 1Q95G 4BI4A 3VS2A 3QZ5B 3C12A 2WSFE 3JB9G 1ZSZC 3CQTA 3VUBA 3JB9H 4PJOA 2EWNA 2Z0WA 1YJNT 2A36A 1NLPC 2X3WD 3PGGA 4DOWA 2LJ3A 1QVFA 4NS5A 5GANg 4PJOC 5CKFA 4J6YA 1SHFA 2G3RA 2I0NA 4DBFA 5IXBA 2Y90A 2QDYB 3GNGA 4HXJA 1V1CA 2LJ1A 5DLOA 2RF0A 3CCVQ 4FYYB 2L3RA 5CKBA 1EIFA 3MP1A 2XIDA 1MUZA 2PNIA 3FJPA 2IIMA 4HT9A 3PTAA 3CCQT 5GAMf 2AKKA 1YJ9A 4QKUA 2CKKA 1GBQA 2LCSA 1M90C 1ZUYA 2COYA 2K79A 2ZPHB 2RA2A 2EQJA 4QT7A 2Y4YA 3QWYA 1VQ6Q 3CMEA 2HL3A 2YHTA 2SEMA 1WHGA 5FLXE 2XICA 1VQMA 1W70A 2KROA 5KYYB 1M8VA 1R8OB 3N5BB 1H8KA 4E7JA 1CKAA 2FZCB 2CZ7B 2A3LA 2DL8A 1M5Q1 3LYIA 2E3HA 3CCMA 4M75B 4E7LA 5IN1A 3TU4K 2CSIA 5CIUA 1OEBA 3RERA 1NPRA 2BZYA 2VASA 2V8KA 2BE9B 2XD0A 2ECZA 4FM4B 3OYDA 3CPFA 5GAN2 3G4SQ 2HNIA 1E6HA 2FPFA 1PRLC 4M7AA 2O4XB 5GMKm 3UF4A 1UGQB 1YI2A 1PD1A 4LD6A 3EHQA 1T0HA 3AT1B 4BE1A 1D0ZA 2OTJA 4GLKA 3CD6Q 4OMFB 4E7IA 3JCMf 2R5AA 4C8QA 3EFOA 3UPUA 2M02A 2YT6A 1X01A 5L23A 2ATCB 2RQVA 2E5KA 4M77E 5CAIA 2QXFA 3A8OB 2E3IA 5C6SA 2LNVA 2XDDA 3OY9A 2OI3A 4XTWA 4E6RA 2K5FA 2F5KA 1Y07A 4X9DA 2EJGA 3C4SA 4HVVA 5LJ5f 2J05A 1M1FA 1M9SA 1I0CA 1RAHB 1JBMA 3T9NA 8ATCB 1VOMA 1NZ9A 1NJIR 1B3QA 3VS3A 2RN8A 1UFFA 4JZ3A 2RK1A 4KH1B 2F1LA 1PWTA 3DB4A 2KRMA 2DILA 4IUQA 3MHXA 5EG2A 3G6EA 4OMLA 3OYCA 1UEBA 3C0CA 4Z8AA 1OYXA 5LJ3f 4E7HA 3CXCS 3SWNA 3HFOA 4M7AG 2VVKA 2DKGA 3QDRB 2BE7D 1G3WA 2DBMA 1N27A 1VYTA 1OX8A 4M78E 4RTWA 3LW5E 4F7UA 3OYFA 5GJVB 5GANe 1N8RR 3L2ZA 1F1BB 3H6ZA 2MPXC 3L1AA 3PIOA 3HSBA 3FEOA 4EIKA 1ABQA 2CDTA 1VQLA 3E9FA 2HSEB 2ED1A 3R6NA 3PVLA 4IURA 1M27C 4M7AB 4FIBA 1X69A 4JRPA 2FVUA 4BE2A 1W2BS 4PJMA 2KR3A 3E19A 1I81A 2PVDB 2JJ9A 4RG8A 4HT8A 1QLYA 2LX9A 4EDUA 5GAOp 1UGSB 1K9AA 5GMKh 1AWWA 3BFMA 2AHJB 4PJJA 2DPPB 4IUPA 2KGTA 3TREA 4QW2A 5CQXA 2X51A 2DL4A 2F5TX 4KT0E 1M3AA 4LXCA 4Z88A 3ZL7C 4A63B 4NL3A 3CCJA 3JCMc 2DYBA 2EGEA 1G5VA 1PNJA 1ZBXA 2VXEA 3CBOA 3RBBB 2JZ2A 4LDWA 3TSWA 4FCYA 1KD1U 3M5AA 3I56T 5GAMe 1YCYA 3I35A 2KYMA 2A0FB 1M90U 4HCZA 2VWFA 4JPBW 1MV0B 2JMCA 4PJNA 2RQRA 2EGCA 4XK8E 2GFUA 3CCSA 1AVZC 3X24B 2QAZA 2KQWA 5GANd 1KHIA 2QTVA 4E7SA 1YJ9Q 4X1VA 1H3HA 1VYVA 4XTYA 2FO0A 2RHUA 1QVFS 2DF6A 3RDVA 2E10A 2X3XD 1VQ5T 2RHZA 1XOVA 1LPLA 3A8LB 5L8RE 2EYZA 4MMKA 2E41A 4LUEA 3CMEQ 4R56A 2E70A 1PSEA 1GCPA 1ZBJA 2LCLA 1ZUKA 1VQMQ 1YHQT 3RKYA 1BIBA 3CBPA 2QQSA 2LZ6B 1KD1C 1GCQC 4ME7A 3EG0A 2FPDA 3CC2T 3I9QA 2VYTA 1G8XA 3EG3A 3SDZA 1VUBA 3BDUA 4FSSA 3EG9B 3PE0A 4M77A 1NJIU 4K11A 2M16A 3V7SA 3JCMe 2PQWA 2EAYA 4J9FA 3QJ6A 1U1SA 4M77C 2HQEA 4L5GA 4HCKA 4F04B 1QW1A 2JM9A 3M56A 2DFUA 1YI2Q 3QHSA 4JS4A 3CXCP 4M7DD 2QQAA 1M4ZA 3IQLA 2CP2A 3X28B 1N9SA 5LL6S 4XQ3A 2KE9A 2ROTA 2OTJQ 2QI2A 3CCVT 4F14A 1AOJA 2JN0A 2YXYA 5CO7A 4BUGA 1Y96A 3JRZA 3EGUA 2CP0A 2XG8D 3H0IA 2KSSA 1WZOA 4JLIA 3NTHA 4R55A 4J5YA 1OV3A 1VQ8T 1Q81R 1UJ0A 4MDXA 2QDLA 1JXMA 3OS5A 1N8RU 3LH0A 2FYKA 1QVPA 2QG9B 4X9CA 2B8AA 3OS2A 2FPEA 1WHLA 2RK2A 4A4GA 3QZ9B 4N0AA 1WHKA 2KVQG 4WCIA 5CKHA 1VQ6T 3MCAB 5LJ3e 4N4IA 2RQTA 5FRNA 4L6V5 5I22A 2V26A 4M78A 1NJIC 2DK3A 1BB9A 3KBGA 2CUDA 4C92D 1VQKA 4ZNXA 2K3BA 1QVGA 4M78C 3G6EQ 3JV3A 2HAXA 5IHNA 1QWEA 3JCMP 1T0JA 2DXUA 1EZZB 1KQSS 1K0XA 1IGUA 1T3LA 3CCLA 1UE9A 5C0MA 1NEGA 3L2UA 1KC8U 5A2QE 1BI2A 3RUXA 1GRIA 4C0DB 2DAQA 3G4ST 5LJ5h 4M7AE 2RB6A 3EH2A 1HXDA 4AFSC 1OU9A 1YBYA 5GAOl 3JSCA 2KBTA 2LQKA 1TSFA 4PJOD 2LCCA 3LGLA 1N8RC 3VU3C 4FT4A 4J7FA 4IUVA 2HCKA 2AK5A 4AFUC 5IH2A 3CD6T 1IGQA 1JRIA 1D09B 1VQLQ 3BY7A 5IHKA 2L3QA 2LVMA 1BCMA 4FW1A 1IREB 2HL5C 3DLMA 1ZA1B 4O6JA 2EW3A 3TEEA 1KFZA 1G2BA 4CI0C 1OPLA 1YITQ 2RJDA 2D0QB 2O9SA 5EC7A 1WX6A 1XNIA 3J80E 4M7DC 2ENMA 5HK3A 1NEBA 5IXFA 2AKLA 3M0SA 3M0TA 3L2RA 2XDBA 1LCKA 3OYLA 2EQIA 3DKMA 1SSFA 2O31A 3F70A 2DEQA 2PUOB 4TVRA 3OYJA 2P0KA 5CKDA 1AWOA 2L8DA 2EQUA 3CCJQ 2CS7A 3KXTA 2M0OA 3P8DA 1X43A 2CGHA 3OMGA 4JUVA 2JVVA 2QGFB 5KYYA 4EMKC 2P84A 2DIGA 3URGA 3FC3A 1GFDA 3HFNA 2DYIA 4M75A 1PG5B 1U1TA 1UJYA 2EKHA 3RMSA 4J9BA 3RIRA 3CCUA 1FMVA 2QQRA 4F17A 1X75C 3CCSQ 4MDWA 1K9MU 1BCOA 2K3YA 4QQDA 3OW2P 2YUQA 2DRKA 2LTOA 3G7ZA 2DJZA 2O4XA 2D6FA 1I1JA 2L3PA 1YFNA 4J83A 1W6XA 4J8OA 4BY6B 1U06A 2A7YA 1MGQA 2CH4A 2GTOA 3S3NA 3CC4A 1PKSA 1M3BA 2E5QA 1G3YA 1VQ9T 2M1HA 4ZN3A 3VYGA 2FB7A 2W0ZA 1D1BA 2K6DA 4AT1B 4C8QD 1UB4A 1Q81U 1WFWA 3M58A 2DJQA 1YWOA 5FU6B 4M4ZA 3CC7T 3OYAA 2ZCFB 4ZTFA 2CYZB 3THKA 1UHCA 4QVZA 3M0QA 1QP2A 1RAFB 3EFSA 3SD4A 4KGXB 1LNXA 3EG1A 1C6VX 1TUCA 2MF2A 1RAGB 3OSVA 4C5GA 3VV0A 4M75G 1K9MC 2COZA 2XDPA 3LGFA 2QTXA 3A8MB 2JTFA 1ZLMA 3OB9A 1B34B 3JCMW 3MJXA 1KQSP 3RR6A 2FRWA 4FYWB 2ABLA 1K1ZA 2DL7A 5D6WA 3QUIA 3OYNA 2KAFA 1M2OA 1HD3A 4MMLA 3OW2A 3VS6A 1LJOA 4OMPA 2J6FA 4B9XA 2X35A 3PMTA 4GY5A 1I8FA 4J9CA 1KD1R 1Q86R 1X6BA 2EKOA 1OQKA 2LC4A 2L0AA 3ZBDA 1JEGA 4OP0A 1N5ZA 1Q81C 2LRQA 4IUTA 3VS7A 1YJ9T 5GAMg 2M0YA 4VUBA 2O9VA 2J6KA 5AT1B 3CMET 3V8LA 3OS1A 3OYMA 1VQMT 2CH4W 2WSEE 3REAB 1VQOA 3Q1JA 2VB6A 4Q5WA 2M51A 1VQKQ 4E7ZA 1Q7YR 4M7AC 4FT2A 3I5SA 2PZ1A 1RI9A 2QA4Q 3CCMT 2QK0A 1UTIA 2P4RA 3E1SA 2D0NA 2RJEA 1MMGA 3CCLQ 1BU1A 4C0GA 4RTVA 1S1NA 4C8QC 2LX7A 2ZPBB 1J3TA 3OYYA 2DA9A 2R57A 3EGXB 5HKCA 3P8HA 1WJRA 1KQSA 2VV5A 5KCOA 1TWBA 2RPNA 1YI2T 4A53A 1NM7A 1ACMB 4OMMA 1QVGS 2XU8A 6AT1B 2LQ8A 4FU6A 2GNCA 2KYBA 4JRQA 3OYIA 5GAN7 3JCMg 2QYZA 3CPWP 2CP7A 4CRIA 3A8HB 5GAOr 5GMKe 1ABOA 2EQKA 3JCMX 2GQVA 4A4HA 2DO3A 2FEIA 3M53A 1NBEB 5FRMA 4C5HA 4UC4A 1HYOA 2F2VA 3UATA 4FL6A 3EFRA 2K7AA 4YTLA 1VQ4A 1KIKA 4JRIA 4JS5A 4PFOA 3SWNC 4PL6A 2HSPA 2X4WA 1SRMA 5GAOn 3ZEHA 4BDYA 2ED0A 3QWXX 3FB9A 2ESWA 1SSHA 3MEVA 3OYKA 1K8AU 2AT1B 1UUEA 1WHJA 1YIJA 1PRMC 2RHYA 3I55A 2LT1A 3JCMQ 1QP3A 3G6ET 1WDXA 2KY9A 1H3ZA 3OMCA 1ZX6A 3VRZA 1AZGB 2DETA 2KDSA 4CC7A 3O5ZA 2QEXA 5LJ3g 5KH6A 4ORZA 5KYWB 1TXQA 2F69A 1YITA 3EH1A 4J9HA 1K76A 2X9HA 3HP9A 3CCUQ 3OYBA 1V29B 1M1KU 1NYGA 5DLQE 1N6AA 3EG9A 1ZHIA 3J7AF 1WQWA 3JCMb 2ZPIB 4M77D 2DTOA 2OTLA 4LNPA 2JNGA 1AT1B 1YJNQ 1G3TA 3NHNA 5I21A 4MZMA 1QKWA 3CPWA 4HVWA 3JB9J 2YRCA 4Y28E 3V8KA 1NG2A 1QMCA 1VQLT 2D9TA 3G71A 1KC8R 2DXBA 5CKEA 3M59A 3M4GA 2NUPB 3LWHA 1LOJA 2DE0X 3OYGA 3E9GA 1M3CA 3CC4Q 4DEXA 4A4EA 3I5RA 3HPWA 4FW2A 2CZ0B 2B86A 5ECAA 2RJCA 5GAOq 1Q86U 3VS0A 4PFPA 4DOVA 5KYXA 3JCMJ 2MIOA 4KH0B 3JCMV 1PHTA 3FIFA 3PT9A 2K2VA 1FX7A 2A37A 4II1A 2CT3A 4ZGEB 2CP3A 3CCJT 3VS5A 2MAMA 1M1KC 3EHRA 1KQ1A 4ELZC 3BW1A 5J26A 3LH5A 3TCJA 3FDRA 4M78D 1Q7YU 1B07A 3RKXA 1K0SA 1M1GA 1BKBA 5GAN4 1WNLA 4M75E 5GANj 2JMAA 3OS0A 3PNWC 2DVEA 2NUZA 2COWA 2DTHA 5A0DA 4ESRA 4ZN1A 1WXUA 2GQIA 5HY6A 3REBB 2LNHB 3HHTB 3NTKA 2YLBA 2LDMA 4OMOA 3CCST 4M7DF 3H8ZA 3RESA 2HDAA 1UDLA 1N9RA 1GL5A 1UG1A 2FL7A 1Q86C 2KI7A 2EGAA 5I2SA 1QVGP 1VYUA 1EX4A 5CQYA 4FYXB 2K4YA 2DXCA 4LUDA 1RUWA 3QXEB 2OX7A 5GAOm 2P0QA 3GOXA 1K9MR 1S72A 1MNEA 1CSKA 2D1XA 3AHUA 5CVIA 4DA4A 1VQOQ 2MCNA 3UA6A 3OW2S 2HBWA 2RD1A 1FXXA 5GAMd 1Q7YC 2E6ZA 1VQ7A 4QVDA 5LJ5e 4F16A 2RH2A 4CC2A 4C92F 4ELYC 4JJNK 5GAMj 2H3JA 1OI1A 3CCEA 1VA7A 2PU9B 1K73R 1VQNA 1W1FA 2PVOB 5KYXB 2ZPGB 4J7IA 2W10A 1IRXA 2JS2A 5FWCA 4IKFA 4JRKA 3QKJA 4E2FB 1RAIB 1WXBA 4AFQC 2JXBA 2YLCA 3QO3A 3RMQA 4C5EA 4N0AC 3INZA 4PJOF 3C94A 9ATCB 1BI1A 1MNDA 3QG1A 3M0UA 3CMAA 2DX1A 2QA4A 3TSZA 3WVEB 2EYXA 1K4US 1D1AA 5CCAA 4LDYA 1VIEA 1RABB 1JXOA 3O8VA 4BI3A 4MZPA 3KFVA 2KT8A 1VQ4Q 1MMDA 3NGPA 4N4GA 1O9SA 3META 1MV3A 3JCMd 1IB8A 4JLGA 3OQ5A 3CCRA 4KUIA 3M9QA 1KK7A 3UWNA 1Z9QA 4E7KA 2RI5A 1VQKT 1YIJQ 1I07A 4JDSA 4IUUA 1Y71A 3I55Q 1R77A 3LX7A 1Q82R 2LQNA 4LN2A 4Z02A 4C5IA 4BDZA 1YJWA 3NMZC 5LJ5d 4RCBA 2QEXQ 3A1PA 3CCLT 4LDVA 2FRYA 1MMAA 5FU6C 2V8IA 2LQWA 3H0FA 2BKDN 2I2LA 2K2MA 1RAAB 1ZSGA 2GFAA 3M0PA 2D8HA 2CT4A 5GAN8 2OTLQ 2V1QA 1UGPB 2EFIA 1OPKA 1B34A 5LJ3d 4RTZA 3CBMA 2AZVA 3G71Q 1KC8C 2IG0A 4KGVB 1ARKA 1HJDA 2JW4A 2V1RA 1GFCA 2CUBA 5LJ3j 4OB2B 5HCKA 1TS9A 2O88A 1G3SA 2OAUA 1EFNA 1YN8A 2JS0A 3G1JA 3GBQA 3FLGA 2C0IA 3UA7A 1YNZA 1E7OA 3HKSA 1VQPA 3L2VA 5J3BA 2MWOA 3J81E 4IIOA 4C8QF 4M75C 3CPWS 2IVWA 3EGDB 1XTDA 1U3OA 5GAN3 1W4SA 1VQ9A 1YJNA 4DQ2A 2RI2A 5GANf 2GCXA 4M7AD 3X26B 1U8RA 2DNUA 3DLLA 1SG5A 1AZEA 1Z9ZA 4NL2A 2RQUA 5A0GA 2CZ1B 1K8AR 1KHCA 4R0KA 4M7DG 3CCUT 3CC2Q 2BZ8A 1M2VB 4AFZC 1K73U 3HRSA 3U23A 2C0TA 5FU7B 1SKUB 3CCQA 3EGXA 1ZUUA 4HCBA 5D6YA 2OAWA 2AIRB 1H641 2H8HA 1PCXA 2EIFA 3S3OA 2JUFA 1QCNA 1FMKA 1RL2A 1WGSA 1WHHA 2FHDA 4KUDK 2IPOB 2JT4A 2JTMA 2HEQA 1M1KR 2D8JA 1SHGA 4LD9K 1C1AA 4KBMB 3CC4T 3ULRB 2HBPA 1S72Q 4F7UF 2HQHA 4M7DB 4OGCA 2YRDA 4XU2A 3EAEA 4BB7A 3GNFB 2E64A 3R6OA 2HKQB 2E1HA 1X6GA 5KYUB 1VQ8Q 1KQ2A 1VQ7Q 1OULA 4C92G 1KJWA 2P4TA 2RHIA 5GJWB 2LP5A 3KUFA 5HK0A 2DMOA 2EBPA 3PMIA 4AG2C 3FJ5A 2QQ9A 1TUGB 1WYXA 5IHIA 2DZCA 2ZZDA 4JZ4A 4WF2A 5KE2A 1SEMA 3CCEQ 2V8JA 1X2KA 2QASA 2DLPA 2KK4A 3VKIA 1K73C 4EMKB 1VQNQ 3EG2A 2GGRA 1D0XA 1HSQA 2R58A 3QBYA 2G6FX 4OVAA 1SRLA 3PIPA 2PVGB 1Q82U 7AT1B 4B9WA 3VRYA 4ATOA 4BI8B 2DEUA 2VGNA 3OSSC 2HMAA 2CZ6B 4PJOG 4C92B 1X2QA 2NLUA 4J6XA 4L59A 1D3BB 5KYWA 2K5IA 2Y4XA 1U5SA 3CMAQ 5D6XA 3H41A 2ZPEB 1WA7A 2GF7A 4A54A 2XK0A 2L3SA 4GLMA 3H0HA 1ZSZB 2NUTB 4J9IA 4DBRA 2QQBA 3A8GB 3A98A 3UDCA 1PC0A 3WXMB 4P5NA 4PLLA 3BDLA 1QWFA 2RHXA 4PJOB 4QQGA 4OB1B 2NUPA 4KGZB 3X20B 1HK9A 3CCRQ 3E2UA 3VS4A 1VQOT 1OZ3A 1I5OB 2NYSA 3H9NA 3MKDA 4RCCA 1QCFA 3CEYA 3VYHB 2OJ2A 4J9DA 1R0CB 4CC3A 3QPHA 2OTJT 4XU0A 1Q82C 4Y92A 2GBQA 1YJWQ 4D8DA 4XTXA 4J9GA 1NE8A 2O2OA 2HZYA 2BUDA 2J6OA 3GLXA 2EYYA 2DVJA 2HKNA 1RLPC 4MZTA 1OX9A 4PKCC 4X34A 5CK9A 1VIFA 2KEAA 3M55A 5M9OA
chains in the Genus database with same CATH topology
1YBYA 1NPPA 5GAOl 2DTHA 5A0DA 4ZN1A 4EMGA 3JSCA 3GNGA 5HY6A 2LQKA 2LT4A 5LJ5g 4PJOD 2LCCA 3LGLA 3HHTB 5DLOA 1N8RC 3VU3C 3NTKA 4FT4A 2YLBA 4IUVA 2L3RA 2LDMA 4J7FA 3GIBA 5CKBA 3CCST 1EIFA 4QVCA 4M7DF 3H8ZA 3RESA 3MP1A 2XIDA 3OA6A 1N9RA 3CD6T 3FJPA 1JRIA 3CPWA 4HT9A 1KG1A 3PTAA 2FL7A 3CCQT 3BY7A 5GAMf 2LVMA 1Q86C 1YJ9A 4M77F 5GAN5 1IREB 5I2SA 3DLMA 2CKKA 4O6JA 5CQYA 3TEEA 4M7DD 1M90C 5AYFA 4ZGDB 2EYQA 4CI0C 2K4YA 2RJDA 2DXCA 2D0QB 3VJPA 1XNIA 3QXEB 2ZPHB 2RA2A 3J80E 4M7DC 5GAOm 2EQJA 2P0QA 2Y4YA 5HK3A 3GOXA 3CMEA 4N4HA 1S72A 4C0ZA 3QIIA 2YHTA 5FLXE 3L2RA 2XICA 1VQMA 2XDBA 4C8QG 1VQ4T 3AHUA 1M8VA 5CVIA 4DA4A 1R8OB 3OYLA 3N5BB 5GMKl 3DKMA 3OW2S 1SSFA 3F70A 4E7JA 2RD1A 2VXFA 1FXXA 2DEQA 2PUOB 4TVRA 5GAMd 2CZ7B 1JB0E 2M9UA 1Q7YC 3OYJA 2A3LA 2E6ZA 1M5Q1 3LYIA 2P0KA 3MEUA 5CKDA 1VQ7A 4OB0B 2L8DA 4A4FA 2EJFA 2EQUA 2WACA 4QVDA 5LJ5e 2CS7A 4M75B 3KXTA 3CCMA 4PLIA 5IN1A 3A5ZB 4XU3A 4E7LA 3TU4K 1YIJT 2RH2A 2M0OA 3P8DA 1GXIE 2RO0A 2CGHA 3OMGA 4C92F 4JUVA 2JVVA 3I55T 4ELYC 4XU1A 5CIUA 4JJNK 5GAMj 3RERA 4EMKC 2H3JA 1NPRA 1OI1A 3CCEA 2V8KA 2DIGA 2XD0A 3OBYA 3I56A 4FM4B 2PU9B 3URGA 3OYDA 3FC3A 3CPFA 1VQNA 5KCHA 5GAN2 1BI0A 2PVOB 2QEXT 1JJ2S 2XI9A 2HNIA 2ZPGB 3HFNA 4J7IA 4C8QB 4M7AA 2O4XB 4M75A 5GMKm 1U1TA 2DIQA 3RMSA 1YITT 4IKFA 1UGQB 1YI2A 1K8AC 4JRKA 2DZ9A 4LD6A 3QKJA 4M78F 3RIRA 3CCUA 2YRVA 3ME9A 3L2QA 2QQRA 3S6WA 1X75C 4MDWA 1K9MU 4BE1A 2YLCA 3UT1A 2K3YA 2OTJA 2JOYA 4GLKA 3QO3A 4M7DE 2K57A 4QQDA 3RMQA 4OMFB 4C5EA 5A0LA 5GMKj 3JCMf 4N0AC 4E7IA 2OTLT 2LTOA 2R5AA 3INZA 3G7ZA 4C8QA 2DJZA 2O4XA 4PJOF 3UPUA 1X01A 3L2WA 2D6FA 4PNOA 3C94A 2ZGWA 4J6WA 5J39A 2E6NA 4J83A 4M77E 5CAIA 2QXFA 3A8OB 1BI1A 3QG1A 4J8OA 3CMAA 2QA4A 3G71T 1VQ5A 3WVEB 5C6SA 4BY6B 2LNVA 2XDDA 2A7YA 2MMPA 5CCAA 4LDYA 5GANh 1MGQA 4F7UG 2BIVA 3OY9A 1VIEA 3S3NA 3CC4A 2E5QA 1RI0A 4XTWA 2K5FA 2F5KA 1G3YA 1VQ9T 1Y07A 2M1HA 3HRUA 4X9DA 3O8VA 4ZN3A 2EJGA 4BI3A 3VYGA 3C4SA 4MZPA 5LJ5f 2FB7A 3DB3A 5KE3A 1M1FA 1YHQA 5CR2A 1M9SA 4C8QD 1JBMA 1UB4A 1Q81U 3T9NA 4N4GA 1O9SA 3M58A 2O01E 3META 5FU6B 3JCMd 1NZ9A 1IZ6A 4JLGA 3SWNB 3CC7T 3OQ5A 3OYAA 3CCRA 2DTIA 4KUIA 3M9QA 5IT9E 2ZCFB 3UWNA 4ZTFA 2CYZB 4NOYA 4E7KA 3CC2A 2RK1A 4BD3A 2RI5A 1VQKT 4QVZA 4JDSA 3DB4A 1QP2A 4IUUA 1Y71A 4IUQA 3MHXA 5EG2A 3G6EA 3LX7A 2VUBA 3EFSA 3SD4A 3OYCA 4C92E 4F7UB 1UEBA 4Z02A 1LNXA 1MHNA 4C5IA 5GMKi 4BE0A 4BDZA 4Y91A 1YJWA 1OYXA 5LJ3f 3JB9F 2MF2A 4E7HA 3OSVA 5LJ5d 4RG2A 3CXCS 4C5GA 3SWNA 3HFOA 4RCBA 4OGEA 4M75G 3VV0A 1K9MC 4M7AG 2XDPA 2DKGA 3LGFA 4C0DC 3QDRB 2QTXA 3CCLT 3A8MB 2JTFA 4LDVA 5DM7R 3OB9A 5FU6C 1B34B 3JCMW 1G3WA 2V8IA 2E12A 1N27A 5IAYA 2BKDN 4XTZA 5I2MA 2I2LA 4M78E 3M57A 4RMOA 3LW5E 2Y90A 4F7UA 3GP8A 3OYFA 2MI6A 2GFAA 5I21A 3OYHA 2VGMA 5GANe 3JB9I 5D6WA 3QUIA 4RKUE 3OYNA 3L2ZA 2KAFA 3CCVA 5GAN8 3H6ZA 4MMLA 3OW2A 3L1AA 1LJOA 1UGPB 3PIOA 5GAMh 4B9XA 3HSBA 2EFIA 3FEOA 1B34A 2X35A 3QYGB 5FROA 2XHCA 3PMTA 4PJOE 4XTUA 5LJ3d 1VQLA 1WJSA 3CBMA 1I8FA 3E9FA 3GF5A 4GY5A 1VQ8A 2EKOA 2LC4A 3ZBDA 2KMTA 4IURA 2XKOC 4OP0A 3JB9D 1Q81C 1OZ2A 2LRQA 2IG0A 4IUTA 4QQ6A 4M7AB 5GAMg 4XTVA 1YJ9T 4ZTJA 4FIBA 4VUBA 3WVDB 3ASKA 2RM4A 4XAXB 3GPLA 2FVUA 4JRPA 4BE2A 1W2BS 4M75F 5LJ3j 4OB2B 3E19A 1I81A 2PVDB 1G3SA 4RG8A 4HT8A 2DD4A 2OAUA 2LX9A 3QJYA 4EDUA 1VQ6A 5GAOp 3CMET 1S72T 2HD0A 3FLGA 3NFCA 3V8LA 1UGSB 3OS1A 3VUZA 5GMKh 3HKSA 3OYMA 1I4K1 2AHJB 3BFMA 1VQMT 2DPPB 3RKWA 3L2VA 1VQPA 4IUPA 2WSEE 4LDXA 5J3BA 4OB3B 3TREA 1VQOA 4QW2A 3Q1JA 2MWOA 5CQXA 3V7RA 3S3MA 4O5VA 3J81E 4Q5WA 4C8QF 2K5LA 4M7AC 4M75C 3CPWS 2F5TX 4FT2A 4KT0E 3SB2A 4HKEA 2IVWA 1VQ7T 3CCJA 4NL3A 3JCMc 2DXTA 3CCMT 1XTDA 5GAN3 1W4SA 1VQ9A 1G5VA 3E1SA 1YJNA 4DQ2A 2RI2A 1ZBXA 2RJEA 5GANf 2VXEA 3CBOA 2GCXA 4M7AD 2JZ2A 4M75D 4LDWA 3X26B 4C0GA 3C95A 1U8RA 4C8QC 4E47A 3DLLA 1KD1U 2EJ9A 3CCET 2ZPBB 1BYMA 3M5AA 3JAME 3I56T 3G4SA 5GAMe 1YCYA 4EMHA 3OYYA 2R57A 4HCCA 1VQNT 5HKCA 4HCZA 3SFMA 3P8HA 4NL2A 1WJRA 1KQSA 5A0GA 3MEAA 2CZ1B 2RJFA 2VV5A 5KCOA 1KHCA 1YI2T 4A53A 4M7DG 1P92A 3CCUT 1O75A 4XK8E 2GFUA 2X4XA 3CCSA 2EQMA 1QVGS 3JCMh 2XU8A 1K73U 3HRSA 2LQ8A 4M77G 1I5LA 4FU6A 5FU7B 3CD6A 3LWIA 3X24B 4JRQA 3OYIA 2KQWA 3CCQA 4HCBA 3MEWA 5D6YA 5GANd 1KHIA 5GAN7 1H641 3JCMg 4BY6C 4CRIA 2EIFA 3A8HB 4XTYA 5GAOr 2RHUA 3S3OA 2JUFA 5GMKe 2RI3A 2EQKA 3JCMX 3OYEA 2DD5A 1RL2A 2C06A 2GQVA 3CMAT 1QVFS 1WGSA 4A4HA 2DO3A 2E10A 1Y7XA 3M53A 2QA4T 2FHDA 1VQ5T 4KUDK 5FRMA 2JTMA 2RHZA 1XOVA 4C5HA 4LD9K 4UC4A 4KBMB 3CC4T 3A8LB 5L8RE 3CXCA 2HBPA 4MMKA 2E41A 4R56A 4FL6A 2E70A 3EFRA 1PSEA 2HQXA 2LCLA 2WSCE 4OGCA 4OF1A 3ZFJA 4YTLA 4F7UF 1VQ4A 4M7DB 4XU2A 4JRIA 5FU7C 3EAEA 4BB7A 4JS5A 1YHQT 3RKYA 3SWNC 1BIBA 3GNFB 2E64A 3CBPA 4PL6A 5GAN6 2X4WA 4C0FA 3R6OA 4M77B 5GAOn 1WQ7A 2QQSA 2E1HA 3ZEHA 5LJ5j 4BDYA 2X4YA 3FB9A 3M54A 4C8QE 1KD1C 3CCRT 1KQ2A 3MEVA 3OYKA 4ME7A 4C92G 1K8AU 3V8JA 2X4JA 2P4TA 2RHIA 3CC2T 1YIJA 3KUFA 5HK0A 3FRNA 4FSXA 4M7DA 2RHYA 2VYTA 4BACA 3I55A 2LT1A 3JCMQ 3PMIA 2QQ9A 5LJ3h 1QP3A 3QYHB 3SDZA 4R55A 1VUBA 3G6ET 2DZCA 2KY9A 2ZZDA 3BDUA 4WF2A 4ZGJB 5KE2A 3QSUA 4M77A 3OMCA 1NJIU 1H3ZA 3OBWA 3M4YA 2M16A 2V8JA 3LLRA 2KDSA 4HA8A 3V7SA 1YJWT 2KK4A 3VKIA 3JCMe 2PQWA 2QEXA 1K73C 2L5QA 5LJ3g 4EMKB 2EAYA 4M78G 5KH6A 3QJ6A 3NTIA 1X6OA 4D6WA 1PSFA 1U1SA 4M77C 2HQEA 2F69A 4L5GA 1YITA 1Y96B 1W2BA 2P0PA 2R58A 4M7AF 1QW1A 3QBYA 3M56A 1UGRB 4OVAA 3PIPA 2VC8A 3QHSA 4JS4A 2PVGB 3HP9A 1Q82U 3OYBA 4B9WA 3V7CA 4ATOA 1V29B 4BI8B 1M1KU 2E65A 2QQAA 1M4ZA 5DLQE 1N6AA 2VGNA 1DJ7B 2R5MA 3HRTA 1JJ2A 1ZHIA 1WJQA 3J7AF 3X28B 3OSSC 1WQWA 1N9SA 2CZ6B 4PJOG 5LL6S 4C92B 3JCMb 4XQ3A 2ZPIB 4LDUA 2PUKB 2QI2A 4M77D 4EMKA 2DTOA 4EPCA 2OTLA 2NLUA 3CCVT 2JNGA 4J6XA 4L59A 1D3BB 2JN0A 1XQHA 5CO7A 4BUGA 1Y96A 1G3TA 1WPYA 2XG8D 3JRZA 2K5IA 2KSSA 2Y4XA 3NTHA 3MP6A 3L42A 4J5YA 4JLIA 4MZMA 3P8BB 4Y28E 3V8KA 3JB9J 1KC8C 1VQLT 2D9TA 3G71A 2DXBA 5CKEA 1VQ8T 5D6XA 2ZPEB 4MDXA 3M59A 2GF7A 1TH7A 3M4GA 4A54A 2XK0A 3LWHA 1LOJA 3OS5A 4M78B 3OYGA 3E9GA 3LH0A 1N8RU 2FYKA 4C92A 4KULA 4A4KA 3PFSA 4A4EA 1QVPA 3HPWA 4V2SA 2QQBA 3A8GB 2B8AA 4X9CA 3OS2A 3MP8A 1AHJB 1D3BA 2RK2A 3UDCA 2CZ0B 3WXMB 4A4GA 3QZ9B 4P5NA 2RJCA 4PLLA 4C92C 5GAOq 2ZPFB 4F7UE 2K3XA 3BDLA 5DY9A 1Q86U 4N0AA 2KVQG 5CKHA 1VQ6T 3MCAB 5LJ3e 1ZQ1A 4N4IA 2RHXA 3MO8A 5FRNA 4L6V5 4PJOB 3X25B 2MWPA 4QQGA 4OB1B 3CC7A 3HL8A 4M78A 1FWZA 3ER0A 4DOVA 1NJIC 1VQPT 1M90U 1BIAA 1HK9A 2DK3A 1BI3A 2L89A 3X20B 3JCMJ 3JCMV 1VQOT 1OZ3A 3FIFA 3PT9A 4BI4A 2K2VA 3KBGA 4C92D 1VQKA 1FX7A 4RCCA 1QVGA 4M78C 3QZ5B 3C12A 2WSFE 3JB9G 3CEYA 3VYHB 3VUBA 4II1A 4ZGEB 3QPHA 2OTJT 4XU0A 1Q82C 3CCJT 2HAXA 2MAMA 3JB9H 4PJOA 3JCMP 1M1KC 2EWNA 2DXUA 4XTXA 1YJNT 1NE8A 1KQSS 1KQ1A 3PGGA 4DOWA 4ELZC 3BW1A 2BUDA 3CCLA 5J26A 4NS5A 3TCJA 5GANg 1QVFA 3FDRA 4M78D 3GLXA 5C0MA 3L2UA 1Q7YU 5CKFA 3RKXA 4PJOC 4J6YA 2G3RA 1KC8U 1M1GA 5A2QE 1BKBA 1BI2A 3RUXA 1WNLA 4MZTA 2DAQA 4C0DB 5GAN4 3G4ST 4PKCC 4X34A 5LJ5h 4M7AE 2RB6A 4M75E 5GANj 5CK9A 3OS0A 1HXDA 1VIFA 2DVEA 3PNWC 3M55A 2QDYB 5M9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYM A;  3L2V A;  5C6S A;  4IUP A;  5KE2 A;  1H3Z A;  3OMC A;  4QW2 A;  2LCC A;  3LGL A;  2M16 A;  2MWO A;  3LLR A;  3Q1J A;  3OY9 A;  2BIV A;  3S3M A;  3S3N A;  3NTK A;  2E5Q A;  1RI0 A;  2L3R A;  2LDM A;  2PQW A;  4IUV A;  4Q5W A;  2F5K A;  5KH6 A;  2M1H A;  3QJ6 A;  3NTI A;  3O8V A;  3H8Z A;  3MP1 A;  3C4S A;  3OA6 A;  2HQE A;  2R58 A;  3DB3 A;  5KE3 A;  3QBY A;  2LVM A;  4OVA A;  3OYB A;  4B9W A;  1G5V A;  3DLM A;  4N4G A;  2CKK A;  2RI2 A;  2RJE A;  2R5M A;  3MET A;  1WJQ A;  2JZ2 A;  3OQ5 A;  2RJD A;  3OYA A;  3M9Q A;  1XNI A;  2NLU A;  3UWN A;  4ZTF A;  4E7K A;  4L59 A;  4BD3 A;  2EQJ A;  2R57 A;  2RI5 A;  3GOX A;  4QVZ A;  4HCZ A;  4N4H A;  3P8H A;  3NTH A;  3DB4 A;  1WJR A;  3L42 A;  3MP6 A;  3QII A;  4IUU A;  3MEA A;  4IUQ A;  2RJF A;  5KCO A;  3LX7 A;  3L2R A;  1KHC A;  2D9T A;  3SD4 A;  3OYC A;  5D6X A;  4Z02 A;  4BE0 A;  1MHN A;  4C5I A;  2GF7 A;  3OYL A;  4BDZ A;  2XK0 A;  1OYX A;  2GFU A;  3OYG A;  4E7H A;  3E9G A;  1SSF A;  3LH0 A;  2X4X A;  3F70 A;  4RG2 A;  4C5G A;  4E7J A;  2EQM A;  2XDP A;  3PFS A;  4A4E A;  3LGF A;  3OYJ A;  3OS2 A;  4FU6 A;  2B8A A;  3LYI A;  2JTF A;  2P0K A;  3MEU A;  3MP8 A;  3OB9 A;  3OYI A;  2L8D A;  4A4F A;  3MEW A;  5D6Y A;  2EQU A;  4A4G A;  2RJC A;  2WAC A;  4PLL A;  4E7L A;  4PLI A;  5IN1 A;  2K3X A;  1N27 A;  3BDL A;  5IAY A;  2BKD N;  2M0O A;  3P8D A;  4CRI A;  2RO0 A;  2RHU A;  4N4I A;  3S3O A;  2RHX A;  3OMG A;  3MO8 A;  5FRN A;  3OYF A;  5CIU A;  2RI3 A;  2EQK A;  2MWP A;  4QQG A;  2GFA A;  3OYE A;  1WGS A;  4A4H A;  3OYH A;  1OI1 A;  2FHD A;  2L89 A;  5D6W A;  3OYN A;  5FRM A;  2DIG A;  2RHZ A;  1OZ3 A;  3H6Z A;  4C5H A;  3OYD A;  4UC4 A;  3FC3 A;  5KCH A;  4B9X A;  2EFI A;  3FEO A;  2X35 A;  5FRO A;  4FL6 A;  3PMT A;  2O4X B;  3CEY A;  2HQX A;  1WJS A;  2DIQ A;  3E9F A;  4GY5 A;  4II1 A;  2EKO A;  4IKF A;  4LD6 A;  4IUR A;  3QKJ A;  3EAE A;  1OZ2 A;  2LRQ A;  2IG0 A;  2YRV A;  3ME9 A;  4IUT A;  4QQ6 A;  3L2Q A;  4PL6 A;  4ZTJ A;  2QQR A;  2X4W A;  3S6W A;  2QQS A;  3ZEH A;  4BDY A;  3ASK A;  2BUD A;  2X4Y A;  5J26 A;  4NS5 A;  4BE1 A;  3FDR A;  2K3Y A;  3UT1 A;  5C0M A;  3L2U A;  4BE2 A;  3MEV A;  4QQD A;  4C5E A;  3OYK A;  2G3R A;  4E7I A;  2LTO A;  2R5A A;  2RHI A;  2DAQ A;  4EDU A;  2O4X A;  3KUF A;  4X34 A;  3L2W A;  2RHY A;  2VYT A;  5J39 A;  3PNW C;  3OS0 A;  2E6N A;  4BAC A;  3FLG A;  3PMI A;  3OS1 A;  5M9O A; 
#chains in the Genus database with same CATH topology
 1NPP A;  2H3E B;  4EMG A;  2FZG B;  2LT4 A;  5LJ5 g;  4RTY A;  3GIB A;  1IHW A;  2ZAE A;  2JTE A;  4QVC A;  2DM1 A;  1WLP B;  5I11 A;  3OA6 A;  1M30 A;  1KG1 A;  1FYN A;  5D7U A;  2YWW A;  2MK5 A;  4M77 F;  5GAN 5;  2YUN A;  1JU5 C;  2KXC A;  1WXT A;  2KT1 A;  5AYF A;  4ANJ A;  4ZGD B;  2EYQ A;  3M0R A;  3VJP A;  1RAD B;  2ROL A;  4JJD A;  4N4H A;  2SRC A;  4C0Z A;  3QII A;  1WHM A;  2DL3 A;  2KRN A;  4C8Q G;  1VQ4 T;  1VQP Q;  2YSQ A;  5GMK l;  2VXF A;  2KXD A;  2M9U A;  1JB0 E;  3MEU A;  4OB0 B;  4A4F A;  1D0Y A;  2EJF A;  2GTJ A;  2WAC A;  1GBR A;  4PLI A;  3A5Z B;  4XU3 A;  1YIJ T;  1GXI E;  2RO0 A;  1VQ9 Q;  4CC4 B;  1PKT A;  1UHF A;  3I55 T;  4XU1 A;  4JJC A;  2F2W A;  3OBY A;  3I56 A;  1YWP A;  5KCH A;  1BI0 A;  2QEX T;  1JJ2 S;  1RAC B;  2XI9 A;  4C8Q B;  3EFO B;  3CC7 Q;  2DIQ A;  1YIT T;  1K8A C;  2DZ9 A;  4M78 F;  2YRV A;  3ME9 A;  3L2Q A;  3S6W A;  2LJ0 A;  1T3S A;  3UT1 A;  2JOY A;  4M7D E;  2K57 A;  4KRT A;  5GMK j;  5A0L A;  3CCQ Q;  2OTL T;  1TOV A;  3L2W A;  2PTK A;  4PNO A;  1NYF A;  2ZGW A;  4J6W A;  5J39 A;  2E6N A;  4WTO B;  4D8K A;  3RNJ A;  3G71 T;  1VQ5 A;  2BTT A;  2MMP A;  2FG0 A;  5GAN h;  4F7U G;  2BIV A;  1KSW A;  1RI0 A;  3HRU A;  2DBK A;  1UGV A;  4OMQ A;  4J9E A;  3DB3 A;  5KE3 A;  1A0N B;  1YHQ A;  5CR2 A;  1QCO A;  1RLQ C;  3MPU B;  2O01 E;  8AT1 B;  2JM8 A;  1IZ6 A;  2CP6 A;  4JJB A;  3SEM A;  3SWN B;  2DTI A;  1AWJ A;  5IT9 E;  4NOY A;  3CC2 A;  4BD3 A;  4RTT A;  4Z89 A;  2VUB A;  4C92 E;  4F7U B;  4BE0 A;  1MHN A;  5GMK i;  4Y91 A;  3JB9 F;  4RG2 A;  4OGE A;  2VKN A;  1SF9 A;  2EPD A;  4C0D C;  2DL5 A;  5DM7 R;  1PM3 A;  1GCQ A;  2E12 A;  5IAY A;  4XTZ A;  5I2M A;  1IXD A;  1C0M A;  3M57 A;  4RMO A;  3GP8 A;  1X27 A;  1TTH B;  4OMN A;  2MI6 A;  3OYH A;  2VGM A;  3JB9 I;  4RKU E;  3CCV A;  3CCM Q;  4DBQ A;  4HVU A;  5GAM h;  2RNA A;  2CSQ A;  3QYG B;  5FRO A;  2XHC A;  4PJO E;  4XTU A;  1WJS A;  3GF5 A;  1VQ8 A;  4DBH A;  2KMT A;  2XKO C;  3JB9 D;  1OZ2 A;  1RAE B;  4QQ6 A;  1IHV A;  4XTV A;  1YCS B;  4ZTJ A;  1M90 R;  3WVD B;  3ASK A;  2RM4 A;  4XAX B;  3GPL A;  3BE3 A;  2CRE A;  4M75 F;  1WIE A;  1V76 A;  3VS1 A;  2DD4 A;  4AG1 C;  3QJY A;  1VQ6 A;  3D7S B;  3HTR A;  5FWB A;  1H92 A;  1S72 T;  2HD0 A;  3NFC A;  1OOT A;  3VUZ A;  2CP5 A;  1I4K 1;  3RKW A;  2LMJ A;  1AWX A;  4LDX A;  4OB3 B;  2FZK B;  3S3M A;  3QDF A;  3V7R A;  4O5V A;  2A08 A;  2K5L A;  2F2X A;  1OU8 A;  2MYS A;  3SB2 A;  4RTU A;  4HKE A;  1VQ7 T;  4PFZ A;  2DXT A;  1E6G A;  1AD5 A;  4M75 D;  3C95 A;  4E47 A;  3CCE T;  2E4H A;  1TUD A;  2EJ9 A;  3TQ7 P;  1BYM A;  3JAM E;  1LVK A;  1QKX A;  3G4S A;  4EMH A;  2YUP A;  4HCC A;  1VQN T;  1B7T A;  1YP5 A;  3SFM A;  2MOX A;  1W2B P;  3EGD A;  3MEA A;  1Y57 A;  2KRS A;  2RJF A;  2EVR A;  2DER A;  2AZS A;  1P92 A;  1O75 A;  1WI7 A;  1SPK A;  1JJ2 P;  2X4X A;  4GBQ A;  2EQM A;  3JCM h;  1JQQ A;  4FYV B;  4M77 G;  1I5L A;  3CD6 A;  3LWI A;  1BK2 A;  3MEW A;  1JO8 A;  4RUG A;  4DEY A;  4BY6 C;  1TG0 A;  4AMC A;  2RI3 A;  3OYE A;  2RMO A;  2DD5 A;  2C06 A;  3CMA T;  2QA4 T;  4RTX A;  1Y7X A;  1QQJ A;  1M2V A;  2L2P A;  3SHW A;  2EYW A;  3CXC A;  4PK4 A;  2HQX A;  2WSC E;  3ZFJ A;  4OF1 A;  5FU7 C;  4B6M A;  2J06 A;  2RQW A;  5GAN 6;  4C0F A;  4M77 B;  1WQ7 A;  5LJ5 j;  2J7I A;  2X4Y A;  2A28 A;  3M54 A;  4C8Q E;  3CCR T;  1UEC A;  1MMN A;  3V8J A;  2X4J A;  3FRN A;  4FSX A;  4M7D A;  1FMW A;  4BAC A;  2YDL A;  2KNB B;  5LJ3 h;  3QYH B;  5FW9 A;  1D1C A;  1AEY A;  3NPF A;  4ZGJ B;  3QSU A;  4HA8 A;  3M4Y A;  3OBW A;  3LLR A;  1YJW T;  3I56 Q;  2C0O A;  2L5Q A;  5KYU A;  1QVF P;  4M78 G;  3NTI A;  2DRM A;  1X6O A;  4D6W A;  1PSF A;  1Y96 B;  1W2B A;  4IIM A;  2P0P A;  2NWM A;  4M7A F;  1TU0 B;  1UGR B;  2VC8 A;  4PJL A;  3V7C A;  2E65 A;  1CKB A;  1DJ7 B;  2R5M A;  3HRT A;  1JJ2 A;  1WJQ A;  4LDU A;  2PUK B;  4EMK A;  1M8M A;  1ZA2 B;  4EPC A;  1BBZ A;  1XJW B;  1XQH A;  1NLO C;  1WPY A;  1IO6 A;  1Y0M A;  2BZX A;  3MP6 A;  3L42 A;  3P8B B;  1R0B G;  1VQ5 Q;  1TH7 A;  1G83 A;  4M78 B;  4C92 A;  4KUL A;  2QGG A;  4A4K A;  3PFS A;  4V2S A;  2YUO A;  3MP8 A;  1AHJ B;  1D3B A;  4C92 C;  2ZPF B;  4F7U E;  1YHQ Q;  2K3X A;  5DY9 A;  2XMF A;  1ZQ1 A;  3MO8 A;  3X25 B;  2MWP A;  3CC7 A;  3HL8 A;  1FWZ A;  3ER0 A;  3PVQ A;  1PD0 A;  3TVT A;  1VQP T;  1BIA A;  2L89 A;  4LE9 A;  1BI3 A;  2K9G A;  5KYN A;  1ZSZ A;  2NUT A;  1Q95 G;  4BI4 A;  3VS2 A;  3QZ5 B;  3C12 A;  2WSF E;  3JB9 G;  1ZSZ C;  3CQT A;  3VUB A;  3JB9 H;  4PJO A;  2EWN A;  2Z0W A;  1YJN T;  2A36 A;  1NLP C;  2X3W D;  3PGG A;  4DOW A;  2LJ3 A;  1QVF A;  4NS5 A;  5GAN g;  4PJO C;  5CKF A;  4J6Y A;  1SHF A;  2G3R A;  2I0N A;  4DBF A;  5IXB A;  2Y90 A;  2QDY B;  3GNG A;  4HXJ A;  1V1C A;  2LJ1 A;  5DLO A;  2RF0 A;  3CCV Q;  4FYY B;  2L3R A;  5CKB A;  1EIF A;  3MP1 A;  2XID A;  1MUZ A;  2PNI A;  3FJP A;  2IIM A;  4HT9 A;  3PTA A;  3CCQ T;  5GAM f;  2AKK A;  1YJ9 A;  4QKU A;  2CKK A;  1GBQ A;  2LCS A;  1M90 C;  1ZUY A;  2COY A;  2K79 A;  2ZPH B;  2RA2 A;  2EQJ A;  4QT7 A;  2Y4Y A;  3QWY A;  1VQ6 Q;  3CME A;  2HL3 A;  2YHT A;  2SEM A;  1WHG A;  5FLX E;  2XIC A;  1VQM A;  1W70 A;  2KRO A;  5KYY B;  1M8V A;  1R8O B;  3N5B B;  1H8K A;  4E7J A;  1CKA A;  2FZC B;  2CZ7 B;  2A3L A;  2DL8 A;  1M5Q 1;  3LYI A;  2E3H A;  3CCM A;  4M75 B;  4E7L A;  5IN1 A;  3TU4 K;  2CSI A;  5CIU A;  1OEB A;  3RER A;  1NPR A;  2BZY A;  2VAS A;  2V8K A;  2BE9 B;  2XD0 A;  2ECZ A;  4FM4 B;  3OYD A;  3CPF A;  5GAN 2;  3G4S Q;  2HNI A;  1E6H A;  2FPF A;  1PRL C;  4M7A A;  2O4X B;  5GMK m;  3UF4 A;  1UGQ B;  1YI2 A;  1PD1 A;  4LD6 A;  3EHQ A;  1T0H A;  3AT1 B;  4BE1 A;  1D0Z A;  2OTJ A;  4GLK A;  3CD6 Q;  4OMF B;  4E7I A;  3JCM f;  2R5A A;  4C8Q A;  3EFO A;  3UPU A;  2M02 A;  2YT6 A;  1X01 A;  5L23 A;  2ATC B;  2RQV A;  2E5K A;  4M77 E;  5CAI A;  2QXF A;  3A8O B;  2E3I A;  5C6S A;  2LNV A;  2XDD A;  3OY9 A;  2OI3 A;  4XTW A;  4E6R A;  2K5F A;  2F5K A;  1Y07 A;  4X9D A;  2EJG A;  3C4S A;  4HVV A;  5LJ5 f;  2J05 A;  1M1F A;  1M9S A;  1I0C A;  1RAH B;  1JBM A;  3T9N A;  8ATC B;  1VOM A;  1NZ9 A;  1NJI R;  1B3Q A;  3VS3 A;  2RN8 A;  1UFF A;  4JZ3 A;  2RK1 A;  4KH1 B;  2F1L A;  1PWT A;  3DB4 A;  2KRM A;  2DIL A;  4IUQ A;  3MHX A;  5EG2 A;  3G6E A;  4OML A;  3OYC A;  1UEB A;  3C0C A;  4Z8A A;  1OYX A;  5LJ3 f;  4E7H A;  3CXC S;  3SWN A;  3HFO A;  4M7A G;  2VVK A;  2DKG A;  3QDR B;  2BE7 D;  1G3W A;  2DBM A;  1N27 A;  1VYT A;  1OX8 A;  4M78 E;  4RTW A;  3LW5 E;  4F7U A;  3OYF A;  5GJV B;  5GAN e;  1N8R R;  3L2Z A;  1F1B B;  3H6Z A;  2MPX C;  3L1A A;  3PIO A;  3HSB A;  3FEO A;  4EIK A;  1ABQ A;  2CDT A;  1VQL A;  3E9F A;  2HSE B;  2ED1 A;  3R6N A;  3PVL A;  4IUR A;  1M27 C;  4M7A B;  4FIB A;  1X69 A;  4JRP A;  2FVU A;  4BE2 A;  1W2B S;  4PJM A;  2KR3 A;  3E19 A;  1I81 A;  2PVD B;  2JJ9 A;  4RG8 A;  4HT8 A;  1QLY A;  2LX9 A;  4EDU A;  5GAO p;  1UGS B;  1K9A A;  5GMK h;  1AWW A;  3BFM A;  2AHJ B;  4PJJ A;  2DPP B;  4IUP A;  2KGT A;  3TRE A;  4QW2 A;  5CQX A;  2X51 A;  2DL4 A;  2F5T X;  4KT0 E;  1M3A A;  4LXC A;  4Z88 A;  3ZL7 C;  4A63 B;  4NL3 A;  3CCJ A;  3JCM c;  2DYB A;  2EGE A;  1G5V A;  1PNJ A;  1ZBX A;  2VXE A;  3CBO A;  3RBB B;  2JZ2 A;  4LDW A;  3TSW A;  4FCY A;  1KD1 U;  3M5A A;  3I56 T;  5GAM e;  1YCY A;  3I35 A;  2KYM A;  2A0F B;  1M90 U;  4HCZ A;  2VWF A;  4JPB W;  1MV0 B;  2JMC A;  4PJN A;  2RQR A;  2EGC A;  4XK8 E;  2GFU A;  3CCS A;  1AVZ C;  3X24 B;  2QAZ A;  2KQW A;  5GAN d;  1KHI A;  2QTV A;  4E7S A;  1YJ9 Q;  4X1V A;  1H3H A;  1VYV A;  4XTY A;  2FO0 A;  2RHU A;  1QVF S;  2DF6 A;  3RDV A;  2E10 A;  2X3X D;  1VQ5 T;  2RHZ A;  1XOV A;  1LPL A;  3A8L B;  5L8R E;  2EYZ A;  4MMK A;  2E41 A;  4LUE A;  3CME Q;  4R56 A;  2E70 A;  1PSE A;  1GCP A;  1ZBJ A;  2LCL A;  1ZUK A;  1VQM Q;  1YHQ T;  3RKY A;  1BIB A;  3CBP A;  2QQS A;  2LZ6 B;  1KD1 C;  1GCQ C;  4ME7 A;  3EG0 A;  2FPD A;  3CC2 T;  3I9Q A;  2VYT A;  1G8X A;  3EG3 A;  3SDZ A;  1VUB A;  3BDU A;  4FSS A;  3EG9 B;  3PE0 A;  4M77 A;  1NJI U;  4K11 A;  2M16 A;  3V7S A;  3JCM e;  2PQW A;  2EAY A;  4J9F A;  3QJ6 A;  1U1S A;  4M77 C;  2HQE A;  4L5G A;  4HCK A;  4F04 B;  1QW1 A;  2JM9 A;  3M56 A;  2DFU A;  1YI2 Q;  3QHS A;  4JS4 A;  3CXC P;  4M7D D;  2QQA A;  1M4Z A;  3IQL A;  2CP2 A;  3X28 B;  1N9S A;  5LL6 S;  4XQ3 A;  2KE9 A;  2ROT A;  2OTJ Q;  2QI2 A;  3CCV T;  4F14 A;  1AOJ A;  2JN0 A;  2YXY A;  5CO7 A;  4BUG A;  1Y96 A;  3JRZ A;  3EGU A;  2CP0 A;  2XG8 D;  3H0I A;  2KSS A;  1WZO A;  4JLI A;  3NTH A;  4R55 A;  4J5Y A;  1OV3 A;  1VQ8 T;  1Q81 R;  1UJ0 A;  4MDX A;  2QDL A;  1JXM A;  3OS5 A;  1N8R U;  3LH0 A;  2FYK A;  1QVP A;  2QG9 B;  4X9C A;  2B8A A;  3OS2 A;  2FPE A;  1WHL A;  2RK2 A;  4A4G A;  3QZ9 B;  4N0A A;  1WHK A;  2KVQ G;  4WCI A;  5CKH A;  1VQ6 T;  3MCA B;  5LJ3 e;  4N4I A;  2RQT A;  5FRN A;  4L6V 5;  5I22 A;  2V26 A;  4M78 A;  1NJI C;  2DK3 A;  1BB9 A;  3KBG A;  2CUD A;  4C92 D;  1VQK A;  4ZNX A;  2K3B A;  1QVG A;  4M78 C;  3G6E Q;  3JV3 A;  2HAX A;  5IHN A;  1QWE A;  3JCM P;  1T0J A;  2DXU A;  1EZZ B;  1KQS S;  1K0X A;  1IGU A;  1T3L A;  3CCL A;  1UE9 A;  5C0M A;  1NEG A;  3L2U A;  1KC8 U;  5A2Q E;  1BI2 A;  3RUX A;  1GRI A;  4C0D B;  2DAQ A;  3G4S T;  5LJ5 h;  4M7A E;  2RB6 A;  3EH2 A;  1HXD A;  4AFS C;  1OU9 A;  1YBY A;  5GAO l;  3JSC A;  2KBT A;  2LQK A;  1TSF A;  4PJO D;  2LCC A;  3LGL A;  1N8R C;  3VU3 C;  4FT4 A;  4J7F A;  4IUV A;  2HCK A;  2AK5 A;  4AFU C;  5IH2 A;  3CD6 T;  1IGQ A;  1JRI A;  1D09 B;  1VQL Q;  3BY7 A;  5IHK A;  2L3Q A;  2LVM A;  1BCM A;  4FW1 A;  1IRE B;  2HL5 C;  3DLM A;  1ZA1 B;  4O6J A;  2EW3 A;  3TEE A;  1KFZ A;  1G2B A;  4CI0 C;  1OPL A;  1YIT Q;  2RJD A;  2D0Q B;  2O9S A;  5EC7 A;  1WX6 A;  1XNI A;  3J80 E;  4M7D C;  2ENM A;  5HK3 A;  1NEB A;  5IXF A;  2AKL A;  3M0S A;  3M0T A;  3L2R A;  2XDB A;  1LCK A;  3OYL A;  2EQI A;  3DKM A;  1SSF A;  2O31 A;  3F70 A;  2DEQ A;  2PUO B;  4TVR A;  3OYJ A;  2P0K A;  5CKD A;  1AWO A;  2L8D A;  2EQU A;  3CCJ Q;  2CS7 A;  3KXT A;  2M0O A;  3P8D A;  1X43 A;  2CGH A;  3OMG A;  4JUV A;  2JVV A;  2QGF B;  5KYY A;  4EMK C;  2P84 A;  2DIG A;  3URG A;  3FC3 A;  1GFD A;  3HFN A;  2DYI A;  4M75 A;  1PG5 B;  1U1T A;  1UJY A;  2EKH A;  3RMS A;  4J9B A;  3RIR A;  3CCU A;  1FMV A;  2QQR A;  4F17 A;  1X75 C;  3CCS Q;  4MDW A;  1K9M U;  1BCO A;  2K3Y A;  4QQD A;  3OW2 P;  2YUQ A;  2DRK A;  2LTO A;  3G7Z A;  2DJZ A;  2O4X A;  2D6F A;  1I1J A;  2L3P A;  1YFN A;  4J83 A;  1W6X A;  4J8O A;  4BY6 B;  1U06 A;  2A7Y A;  1MGQ A;  2CH4 A;  2GTO A;  3S3N A;  3CC4 A;  1PKS A;  1M3B A;  2E5Q A;  1G3Y A;  1VQ9 T;  2M1H A;  4ZN3 A;  3VYG A;  2FB7 A;  2W0Z A;  1D1B A;  2K6D A;  4AT1 B;  4C8Q D;  1UB4 A;  1Q81 U;  1WFW A;  3M58 A;  2DJQ A;  1YWO A;  5FU6 B;  4M4Z A;  3CC7 T;  3OYA A;  2ZCF B;  4ZTF A;  2CYZ B;  3THK A;  1UHC A;  4QVZ A;  3M0Q A;  1QP2 A;  1RAF B;  3EFS A;  3SD4 A;  4KGX B;  1LNX A;  3EG1 A;  1C6V X;  1TUC A;  2MF2 A;  1RAG B;  3OSV A;  4C5G A;  3VV0 A;  4M75 G;  1K9M C;  2COZ A;  2XDP A;  3LGF A;  2QTX A;  3A8M B;  2JTF A;  1ZLM A;  3OB9 A;  1B34 B;  3JCM W;  3MJX A;  1KQS P;  3RR6 A;  2FRW A;  4FYW B;  2ABL A;  1K1Z A;  2DL7 A;  5D6W A;  3QUI A;  3OYN A;  2KAF A;  1M2O A;  1HD3 A;  4MML A;  3OW2 A;  3VS6 A;  1LJO A;  4OMP A;  2J6F A;  4B9X A;  2X35 A;  3PMT A;  4GY5 A;  1I8F A;  4J9C A;  1KD1 R;  1Q86 R;  1X6B A;  2EKO A;  1OQK A;  2LC4 A;  2L0A A;  3ZBD A;  1JEG A;  4OP0 A;  1N5Z A;  1Q81 C;  2LRQ A;  4IUT A;  3VS7 A;  1YJ9 T;  5GAM g;  2M0Y A;  4VUB A;  2O9V A;  2J6K A;  5AT1 B;  3CME T;  3V8L A;  3OS1 A;  3OYM A;  1VQM T;  2CH4 W;  2WSE E;  3REA B;  1VQO A;  3Q1J A;  2VB6 A;  4Q5W A;  2M51 A;  1VQK Q;  4E7Z A;  1Q7Y R;  4M7A C;  4FT2 A;  3I5S A;  2PZ1 A;  1RI9 A;  2QA4 Q;  3CCM T;  2QK0 A;  1UTI A;  2P4R A;  3E1S A;  2D0N A;  2RJE A;  1MMG A;  3CCL Q;  1BU1 A;  4C0G A;  4RTV A;  1S1N A;  4C8Q C;  2LX7 A;  2ZPB B;  1J3T A;  3OYY A;  2DA9 A;  2R57 A;  3EGX B;  5HKC A;  3P8H A;  1WJR A;  1KQS A;  2VV5 A;  5KCO A;  1TWB A;  2RPN A;  1YI2 T;  4A53 A;  1NM7 A;  1ACM B;  4OMM A;  1QVG S;  2XU8 A;  6AT1 B;  2LQ8 A;  4FU6 A;  2GNC A;  2KYB A;  4JRQ A;  3OYI A;  5GAN 7;  3JCM g;  2QYZ A;  3CPW P;  2CP7 A;  4CRI A;  3A8H B;  5GAO r;  5GMK e;  1ABO A;  2EQK A;  3JCM X;  2GQV A;  4A4H A;  2DO3 A;  2FEI A;  3M53 A;  1NBE B;  5FRM A;  4C5H A;  4UC4 A;  1HYO A;  2F2V A;  3UAT A;  4FL6 A;  3EFR A;  2K7A A;  4YTL A;  1VQ4 A;  1KIK A;  4JRI A;  4JS5 A;  4PFO A;  3SWN C;  4PL6 A;  2HSP A;  2X4W A;  1SRM A;  5GAO n;  3ZEH A;  4BDY A;  2ED0 A;  3QWX X;  3FB9 A;  2ESW A;  1SSH A;  3MEV A;  3OYK A;  1K8A U;  2AT1 B;  1UUE A;  1WHJ A;  1YIJ A;  1PRM C;  2RHY A;  3I55 A;  2LT1 A;  3JCM Q;  1QP3 A;  3G6E T;  1WDX A;  2KY9 A;  1H3Z A;  3OMC A;  1ZX6 A;  3VRZ A;  1AZG B;  2DET A;  2KDS A;  4CC7 A;  3O5Z A;  2QEX A;  5LJ3 g;  5KH6 A;  4ORZ A;  5KYW B;  1TXQ A;  2F69 A;  1YIT A;  3EH1 A;  4J9H A;  1K76 A;  2X9H A;  3HP9 A;  3CCU Q;  3OYB A;  1V29 B;  1M1K U;  1NYG A;  5DLQ E;  1N6A A;  3EG9 A;  1ZHI A;  3J7A F;  1WQW A;  3JCM b;  2ZPI B;  4M77 D;  2DTO A;  2OTL A;  4LNP A;  2JNG A;  1AT1 B;  1YJN Q;  1G3T A;  3NHN A;  5I21 A;  4MZM A;  1QKW A;  3CPW A;  4HVW A;  3JB9 J;  2YRC A;  4Y28 E;  3V8K A;  1NG2 A;  1QMC A;  1VQL T;  2D9T A;  3G71 A;  1KC8 R;  2DXB A;  5CKE A;  3M59 A;  3M4G A;  2NUP B;  3LWH A;  1LOJ A;  2DE0 X;  3OYG A;  3E9G A;  1M3C A;  3CC4 Q;  4DEX A;  4A4E A;  3I5R A;  3HPW A;  4FW2 A;  2CZ0 B;  2B86 A;  5ECA A;  2RJC A;  5GAO q;  1Q86 U;  3VS0 A;  4PFP A;  4DOV A;  5KYX A;  3JCM J;  2MIO A;  4KH0 B;  3JCM V;  1PHT A;  3FIF A;  3PT9 A;  2K2V A;  1FX7 A;  2A37 A;  4II1 A;  2CT3 A;  4ZGE B;  2CP3 A;  3CCJ T;  3VS5 A;  2MAM A;  1M1K C;  3EHR A;  1KQ1 A;  4ELZ C;  3BW1 A;  5J26 A;  3LH5 A;  3TCJ A;  3FDR A;  4M78 D;  1Q7Y U;  1B07 A;  3RKX A;  1K0S A;  1M1G A;  1BKB A;  5GAN 4;  1WNL A;  4M75 E;  5GAN j;  2JMA A;  3OS0 A;  3PNW C;  2DVE A;  2NUZ A;  2COW A;  2DTH A;  5A0D A;  4ESR A;  4ZN1 A;  1WXU A;  2GQI A;  5HY6 A;  3REB B;  2LNH B;  3HHT B;  3NTK A;  2YLB A;  2LDM A;  4OMO A;  3CCS T;  4M7D F;  3H8Z A;  3RES A;  2HDA A;  1UDL A;  1N9R A;  1GL5 A;  1UG1 A;  2FL7 A;  1Q86 C;  2KI7 A;  2EGA A;  5I2S A;  1QVG P;  1VYU A;  1EX4 A;  5CQY A;  4FYX B;  2K4Y A;  2DXC A;  4LUD A;  1RUW A;  3QXE B;  2OX7 A;  5GAO m;  2P0Q A;  3GOX A;  1K9M R;  1S72 A;  1MNE A;  1CSK A;  2D1X A;  3AHU A;  5CVI A;  4DA4 A;  1VQO Q;  2MCN A;  3UA6 A;  3OW2 S;  2HBW A;  2RD1 A;  1FXX A;  5GAM d;  1Q7Y C;  2E6Z A;  1VQ7 A;  4QVD A;  5LJ5 e;  4F16 A;  2RH2 A;  4CC2 A;  4C92 F;  4ELY C;  4JJN K;  5GAM j;  2H3J A;  1OI1 A;  3CCE A;  1VA7 A;  2PU9 B;  1K73 R;  1VQN A;  1W1F A;  2PVO B;  5KYX B;  2ZPG B;  4J7I A;  2W10 A;  1IRX A;  2JS2 A;  5FWC A;  4IKF A;  4JRK A;  3QKJ A;  4E2F B;  1RAI B;  1WXB A;  4AFQ C;  2JXB A;  2YLC A;  3QO3 A;  3RMQ A;  4C5E A;  4N0A C;  3INZ A;  4PJO F;  3C94 A;  9ATC B;  1BI1 A;  1MND A;  3QG1 A;  3M0U A;  3CMA A;  2DX1 A;  2QA4 A;  3TSZ A;  3WVE B;  2EYX A;  1K4U S;  1D1A A;  5CCA A;  4LDY A;  1VIE A;  1RAB B;  1JXO A;  3O8V A;  4BI3 A;  4MZP A;  3KFV A;  2KT8 A;  1VQ4 Q;  1MMD A;  3NGP A;  4N4G A;  1O9S A;  3MET A;  1MV3 A;  3JCM d;  1IB8 A;  4JLG A;  3OQ5 A;  3CCR A;  4KUI A;  3M9Q A;  1KK7 A;  3UWN A;  1Z9Q A;  4E7K A;  2RI5 A;  1VQK T;  1YIJ Q;  1I07 A;  4JDS A;  4IUU A;  1Y71 A;  3I55 Q;  1R77 A;  3LX7 A;  1Q82 R;  2LQN A;  4LN2 A;  4Z02 A;  4C5I A;  4BDZ A;  1YJW A;  3NMZ C;  5LJ5 d;  4RCB A;  2QEX Q;  3A1P A;  3CCL T;  4LDV A;  2FRY A;  1MMA A;  5FU6 C;  2V8I A;  2LQW A;  3H0F A;  2BKD N;  2I2L A;  2K2M A;  1RAA B;  1ZSG A;  2GFA A;  3M0P A;  2D8H A;  2CT4 A;  5GAN 8;  2OTL Q;  2V1Q A;  1UGP B;  2EFI A;  1OPK A;  1B34 A;  5LJ3 d;  4RTZ A;  3CBM A;  2AZV A;  3G71 Q;  1KC8 C;  2IG0 A;  4KGV B;  1ARK A;  1HJD A;  2JW4 A;  2V1R A;  1GFC A;  2CUB A;  5LJ3 j;  4OB2 B;  5HCK A;  1TS9 A;  2O88 A;  1G3S A;  2OAU A;  1EFN A;  1YN8 A;  2JS0 A;  3G1J A;  3GBQ A;  3FLG A;  2C0I A;  3UA7 A;  1YNZ A;  1E7O A;  3HKS A;  1VQP A;  3L2V A;  5J3B A;  2MWO A;  3J81 E;  4IIO A;  4C8Q F;  4M75 C;  3CPW S;  2IVW A;  3EGD B;  1XTD A;  1U3O A;  5GAN 3;  1W4S A;  1VQ9 A;  1YJN A;  4DQ2 A;  2RI2 A;  5GAN f;  2GCX A;  4M7A D;  3X26 B;  1U8R A;  2DNU A;  3DLL A;  1SG5 A;  1AZE A;  1Z9Z A;  4NL2 A;  2RQU A;  5A0G A;  2CZ1 B;  1K8A R;  1KHC A;  4R0K A;  4M7D G;  3CCU T;  3CC2 Q;  2BZ8 A;  1M2V B;  4AFZ C;  1K73 U;  3HRS A;  3U23 A;  2C0T A;  5FU7 B;  1SKU B;  3CCQ A;  3EGX A;  1ZUU A;  4HCB A;  5D6Y A;  2OAW A;  2AIR B;  1H64 1;  2H8H A;  1PCX A;  2EIF A;  3S3O A;  2JUF A;  1QCN A;  1FMK A;  1RL2 A;  1WGS A;  1WHH A;  2FHD A;  4KUD K;  2IPO B;  2JT4 A;  2JTM A;  2HEQ A;  1M1K R;  2D8J A;  1SHG A;  4LD9 K;  1C1A A;  4KBM B;  3CC4 T;  3ULR B;  2HBP A;  1S72 Q;  4F7U F;  2HQH A;  4M7D B;  4OGC A;  2YRD A;  4XU2 A;  3EAE A;  4BB7 A;  3GNF B;  2E64 A;  3R6O A;  2HKQ B;  2E1H A;  1X6G A;  5KYU B;  1VQ8 Q;  1KQ2 A;  1VQ7 Q;  1OUL A;  4C92 G;  1KJW A;  2P4T A;  2RHI A;  5GJW B;  2LP5 A;  3KUF A;  5HK0 A;  2DMO A;  2EBP A;  3PMI A;  4AG2 C;  3FJ5 A;  2QQ9 A;  1TUG B;  1WYX A;  5IHI A;  2DZC A;  2ZZD A;  4JZ4 A;  4WF2 A;  5KE2 A;  1SEM A;  3CCE Q;  2V8J A;  1X2K A;  2QAS A;  2DLP A;  2KK4 A;  3VKI A;  1K73 C;  4EMK B;  1VQN Q;  3EG2 A;  2GGR A;  1D0X A;  1HSQ A;  2R58 A;  3QBY A;  2G6F X;  4OVA A;  1SRL A;  3PIP A;  2PVG B;  1Q82 U;  7AT1 B;  4B9W A;  3VRY A;  4ATO A;  4BI8 B;  2DEU A;  2VGN A;  3OSS C;  2HMA A;  2CZ6 B;  4PJO G;  4C92 B;  1X2Q A;  2NLU A;  4J6X A;  4L59 A;  1D3B B;  5KYW A;  2K5I A;  2Y4X A;  1U5S A;  3CMA Q;  5D6X A;  3H41 A;  2ZPE B;  1WA7 A;  2GF7 A;  4A54 A;  2XK0 A;  2L3S A;  4GLM A;  3H0H A;  1ZSZ B;  2NUT B;  4J9I A;  4DBR A;  2QQB A;  3A8G B;  3A98 A;  3UDC A;  1PC0 A;  3WXM B;  4P5N A;  4PLL A;  3BDL A;  1QWF A;  2RHX A;  4PJO B;  4QQG A;  4OB1 B;  2NUP A;  4KGZ B;  3X20 B;  1HK9 A;  3CCR Q;  3E2U A;  3VS4 A;  1VQO T;  1OZ3 A;  1I5O B;  2NYS A;  3H9N A;  3MKD A;  4RCC A;  1QCF A;  3CEY A;  3VYH B;  2OJ2 A;  4J9D A;  1R0C B;  4CC3 A;  3QPH A;  2OTJ T;  4XU0 A;  1Q82 C;  4Y92 A;  2GBQ A;  1YJW Q;  4D8D A;  4XTX A;  4J9G A;  1NE8 A;  2O2O A;  2HZY A;  2BUD A;  2J6O A;  3GLX A;  2EYY A;  2DVJ A;  2HKN A;  1RLP C;  4MZT A;  1OX9 A;  4PKC C;  4X34 A;  5CK9 A;  1VIF A;  2KEA A;  3M55 A;  5M9O A; 
#chains in the Genus database with same CATH homology
 1YBY A;  1NPP A;  5GAO l;  2DTH A;  5A0D A;  4ZN1 A;  4EMG A;  3JSC A;  3GNG A;  5HY6 A;  2LQK A;  2LT4 A;  5LJ5 g;  4PJO D;  2LCC A;  3LGL A;  3HHT B;  5DLO A;  1N8R C;  3VU3 C;  3NTK A;  4FT4 A;  2YLB A;  4IUV A;  2L3R A;  2LDM A;  4J7F A;  3GIB A;  5CKB A;  3CCS T;  1EIF A;  4QVC A;  4M7D F;  3H8Z A;  3RES A;  3MP1 A;  2XID A;  3OA6 A;  1N9R A;  3CD6 T;  3FJP A;  1JRI A;  3CPW A;  4HT9 A;  1KG1 A;  3PTA A;  2FL7 A;  3CCQ T;  3BY7 A;  5GAM f;  2LVM A;  1Q86 C;  1YJ9 A;  4M77 F;  5GAN 5;  1IRE B;  5I2S A;  3DLM A;  2CKK A;  4O6J A;  5CQY A;  3TEE A;  4M7D D;  1M90 C;  5AYF A;  4ZGD B;  2EYQ A;  4CI0 C;  2K4Y A;  2RJD A;  2DXC A;  2D0Q B;  3VJP A;  1XNI A;  3QXE B;  2ZPH B;  2RA2 A;  3J80 E;  4M7D C;  5GAO m;  2EQJ A;  2P0Q A;  2Y4Y A;  5HK3 A;  3GOX A;  3CME A;  4N4H A;  1S72 A;  4C0Z A;  3QII A;  2YHT A;  5FLX E;  3L2R A;  2XIC A;  1VQM A;  2XDB A;  4C8Q G;  1VQ4 T;  3AHU A;  1M8V A;  5CVI A;  4DA4 A;  1R8O B;  3OYL A;  3N5B B;  5GMK l;  3DKM A;  3OW2 S;  1SSF A;  3F70 A;  4E7J A;  2RD1 A;  2VXF A;  1FXX A;  2DEQ A;  2PUO B;  4TVR A;  5GAM d;  2CZ7 B;  1JB0 E;  2M9U A;  1Q7Y C;  3OYJ A;  2A3L A;  2E6Z A;  1M5Q 1;  3LYI A;  2P0K A;  3MEU A;  5CKD A;  1VQ7 A;  4OB0 B;  2L8D A;  4A4F A;  2EJF A;  2EQU A;  2WAC A;  4QVD A;  5LJ5 e;  2CS7 A;  4M75 B;  3KXT A;  3CCM A;  4PLI A;  5IN1 A;  3A5Z B;  4XU3 A;  4E7L A;  3TU4 K;  1YIJ T;  2RH2 A;  2M0O A;  3P8D A;  1GXI E;  2RO0 A;  2CGH A;  3OMG A;  4C92 F;  4JUV A;  2JVV A;  3I55 T;  4ELY C;  4XU1 A;  5CIU A;  4JJN K;  5GAM j;  3RER A;  4EMK C;  2H3J A;  1NPR A;  1OI1 A;  3CCE A;  2V8K A;  2DIG A;  2XD0 A;  3OBY A;  3I56 A;  4FM4 B;  2PU9 B;  3URG A;  3OYD A;  3FC3 A;  3CPF A;  1VQN A;  5KCH A;  5GAN 2;  1BI0 A;  2PVO B;  2QEX T;  1JJ2 S;  2XI9 A;  2HNI A;  2ZPG B;  3HFN A;  4J7I A;  4C8Q B;  4M7A A;  2O4X B;  4M75 A;  5GMK m;  1U1T A;  2DIQ A;  3RMS A;  1YIT T;  4IKF A;  1UGQ B;  1YI2 A;  1K8A C;  4JRK A;  2DZ9 A;  4LD6 A;  3QKJ A;  4M78 F;  3RIR A;  3CCU A;  2YRV A;  3ME9 A;  3L2Q A;  2QQR A;  3S6W A;  1X75 C;  4MDW A;  1K9M U;  4BE1 A;  2YLC A;  3UT1 A;  2K3Y A;  2OTJ A;  2JOY A;  4GLK A;  3QO3 A;  4M7D E;  2K57 A;  4QQD A;  3RMQ A;  4OMF B;  4C5E A;  5A0L A;  5GMK j;  3JCM f;  4N0A C;  4E7I A;  2OTL T;  2LTO A;  2R5A A;  3INZ A;  3G7Z A;  4C8Q A;  2DJZ A;  2O4X A;  4PJO F;  3UPU A;  1X01 A;  3L2W A;  2D6F A;  4PNO A;  3C94 A;  2ZGW A;  4J6W A;  5J39 A;  2E6N A;  4J83 A;  4M77 E;  5CAI A;  2QXF A;  3A8O B;  1BI1 A;  3QG1 A;  4J8O A;  3CMA A;  2QA4 A;  3G71 T;  1VQ5 A;  3WVE B;  5C6S A;  4BY6 B;  2LNV A;  2XDD A;  2A7Y A;  2MMP A;  5CCA A;  4LDY A;  5GAN h;  1MGQ A;  4F7U G;  2BIV A;  3OY9 A;  1VIE A;  3S3N A;  3CC4 A;  2E5Q A;  1RI0 A;  4XTW A;  2K5F A;  2F5K A;  1G3Y A;  1VQ9 T;  1Y07 A;  2M1H A;  3HRU A;  4X9D A;  3O8V A;  4ZN3 A;  2EJG A;  4BI3 A;  3VYG A;  3C4S A;  4MZP A;  5LJ5 f;  2FB7 A;  3DB3 A;  5KE3 A;  1M1F A;  1YHQ A;  5CR2 A;  1M9S A;  4C8Q D;  1JBM A;  1UB4 A;  1Q81 U;  3T9N A;  4N4G A;  1O9S A;  3M58 A;  2O01 E;  3MET A;  5FU6 B;  3JCM d;  1NZ9 A;  1IZ6 A;  4JLG A;  3SWN B;  3CC7 T;  3OQ5 A;  3OYA A;  3CCR A;  2DTI A;  4KUI A;  3M9Q A;  5IT9 E;  2ZCF B;  3UWN A;  4ZTF A;  2CYZ B;  4NOY A;  4E7K A;  3CC2 A;  2RK1 A;  4BD3 A;  2RI5 A;  1VQK T;  4QVZ A;  4JDS A;  3DB4 A;  1QP2 A;  4IUU A;  1Y71 A;  4IUQ A;  3MHX A;  5EG2 A;  3G6E A;  3LX7 A;  2VUB A;  3EFS A;  3SD4 A;  3OYC A;  4C92 E;  4F7U B;  1UEB A;  4Z02 A;  1LNX A;  1MHN A;  4C5I A;  5GMK i;  4BE0 A;  4BDZ A;  4Y91 A;  1YJW A;  1OYX A;  5LJ3 f;  3JB9 F;  2MF2 A;  4E7H A;  3OSV A;  5LJ5 d;  4RG2 A;  3CXC S;  4C5G A;  3SWN A;  3HFO A;  4RCB A;  4OGE A;  4M75 G;  3VV0 A;  1K9M C;  4M7A G;  2XDP A;  2DKG A;  3LGF A;  4C0D C;  3QDR B;  2QTX A;  3CCL T;  3A8M B;  2JTF A;  4LDV A;  5DM7 R;  3OB9 A;  5FU6 C;  1B34 B;  3JCM W;  1G3W A;  2V8I A;  2E12 A;  1N27 A;  5IAY A;  2BKD N;  4XTZ A;  5I2M A;  2I2L A;  4M78 E;  3M57 A;  4RMO A;  3LW5 E;  2Y90 A;  4F7U A;  3GP8 A;  3OYF A;  2MI6 A;  2GFA A;  5I21 A;  3OYH A;  2VGM A;  5GAN e;  3JB9 I;  5D6W A;  3QUI A;  4RKU E;  3OYN A;  3L2Z A;  2KAF A;  3CCV A;  5GAN 8;  3H6Z A;  4MML A;  3OW2 A;  3L1A A;  1LJO A;  1UGP B;  3PIO A;  5GAM h;  4B9X A;  3HSB A;  2EFI A;  3FEO A;  1B34 A;  2X35 A;  3QYG B;  5FRO A;  2XHC A;  3PMT A;  4PJO E;  4XTU A;  5LJ3 d;  1VQL A;  1WJS A;  3CBM A;  1I8F A;  3E9F A;  3GF5 A;  4GY5 A;  1VQ8 A;  2EKO A;  2LC4 A;  3ZBD A;  2KMT A;  4IUR A;  2XKO C;  4OP0 A;  3JB9 D;  1Q81 C;  1OZ2 A;  2LRQ A;  2IG0 A;  4IUT A;  4QQ6 A;  4M7A B;  5GAM g;  4XTV A;  1YJ9 T;  4ZTJ A;  4FIB A;  4VUB A;  3WVD B;  3ASK A;  2RM4 A;  4XAX B;  3GPL A;  2FVU A;  4JRP A;  4BE2 A;  1W2B S;  4M75 F;  5LJ3 j;  4OB2 B;  3E19 A;  1I81 A;  2PVD B;  1G3S A;  4RG8 A;  4HT8 A;  2DD4 A;  2OAU A;  2LX9 A;  3QJY A;  4EDU A;  1VQ6 A;  5GAO p;  3CME T;  1S72 T;  2HD0 A;  3FLG A;  3NFC A;  3V8L A;  1UGS B;  3OS1 A;  3VUZ A;  5GMK h;  3HKS A;  3OYM A;  1I4K 1;  2AHJ B;  3BFM A;  1VQM T;  2DPP B;  3RKW A;  3L2V A;  1VQP A;  4IUP A;  2WSE E;  4LDX A;  5J3B A;  4OB3 B;  3TRE A;  1VQO A;  4QW2 A;  3Q1J A;  2MWO A;  5CQX A;  3V7R A;  3S3M A;  4O5V A;  3J81 E;  4Q5W A;  4C8Q F;  2K5L A;  4M7A C;  4M75 C;  3CPW S;  2F5T X;  4FT2 A;  4KT0 E;  3SB2 A;  4HKE A;  2IVW A;  1VQ7 T;  3CCJ A;  4NL3 A;  3JCM c;  2DXT A;  3CCM T;  1XTD A;  5GAN 3;  1W4S A;  1VQ9 A;  1G5V A;  3E1S A;  1YJN A;  4DQ2 A;  2RI2 A;  1ZBX A;  2RJE A;  5GAN f;  2VXE A;  3CBO A;  2GCX A;  4M7A D;  2JZ2 A;  4M75 D;  4LDW A;  3X26 B;  4C0G A;  3C95 A;  1U8R A;  4C8Q C;  4E47 A;  3DLL A;  1KD1 U;  2EJ9 A;  3CCE T;  2ZPB B;  1BYM A;  3M5A A;  3JAM E;  3I56 T;  3G4S A;  5GAM e;  1YCY A;  4EMH A;  3OYY A;  2R57 A;  4HCC A;  1VQN T;  5HKC A;  4HCZ A;  3SFM A;  3P8H A;  4NL2 A;  1WJR A;  1KQS A;  5A0G A;  3MEA A;  2CZ1 B;  2RJF A;  2VV5 A;  5KCO A;  1KHC A;  1YI2 T;  4A53 A;  4M7D G;  1P92 A;  3CCU T;  1O75 A;  4XK8 E;  2GFU A;  2X4X A;  3CCS A;  2EQM A;  1QVG S;  3JCM h;  2XU8 A;  1K73 U;  3HRS A;  2LQ8 A;  4M77 G;  1I5L A;  4FU6 A;  5FU7 B;  3CD6 A;  3LWI A;  3X24 B;  4JRQ A;  3OYI A;  2KQW A;  3CCQ A;  4HCB A;  3MEW A;  5D6Y A;  5GAN d;  1KHI A;  5GAN 7;  1H64 1;  3JCM g;  4BY6 C;  4CRI A;  2EIF A;  3A8H B;  4XTY A;  5GAO r;  2RHU A;  3S3O A;  2JUF A;  5GMK e;  2RI3 A;  2EQK A;  3JCM X;  3OYE A;  2DD5 A;  1RL2 A;  2C06 A;  2GQV A;  3CMA T;  1QVF S;  1WGS A;  4A4H A;  2DO3 A;  2E10 A;  1Y7X A;  3M53 A;  2QA4 T;  2FHD A;  1VQ5 T;  4KUD K;  5FRM A;  2JTM A;  2RHZ A;  1XOV A;  4C5H A;  4LD9 K;  4UC4 A;  4KBM B;  3CC4 T;  3A8L B;  5L8R E;  3CXC A;  2HBP A;  4MMK A;  2E41 A;  4R56 A;  4FL6 A;  2E70 A;  3EFR A;  1PSE A;  2HQX A;  2LCL A;  2WSC E;  4OGC A;  4OF1 A;  3ZFJ A;  4YTL A;  4F7U F;  1VQ4 A;  4M7D B;  4XU2 A;  4JRI A;  5FU7 C;  3EAE A;  4BB7 A;  4JS5 A;  1YHQ T;  3RKY A;  3SWN C;  1BIB A;  3GNF B;  2E64 A;  3CBP A;  4PL6 A;  5GAN 6;  2X4W A;  4C0F A;  3R6O A;  4M77 B;  5GAO n;  1WQ7 A;  2QQS A;  2E1H A;  3ZEH A;  5LJ5 j;  4BDY A;  2X4Y A;  3FB9 A;  3M54 A;  4C8Q E;  1KD1 C;  3CCR T;  1KQ2 A;  3MEV A;  3OYK A;  4ME7 A;  4C92 G;  1K8A U;  3V8J A;  2X4J A;  2P4T A;  2RHI A;  3CC2 T;  1YIJ A;  3KUF A;  5HK0 A;  3FRN A;  4FSX A;  4M7D A;  2RHY A;  2VYT A;  4BAC A;  3I55 A;  2LT1 A;  3JCM Q;  3PMI A;  2QQ9 A;  5LJ3 h;  1QP3 A;  3QYH B;  3SDZ A;  4R55 A;  1VUB A;  3G6E T;  2DZC A;  2KY9 A;  2ZZD A;  3BDU A;  4WF2 A;  4ZGJ B;  5KE2 A;  3QSU A;  4M77 A;  3OMC A;  1NJI U;  1H3Z A;  3OBW A;  3M4Y A;  2M16 A;  2V8J A;  3LLR A;  2KDS A;  4HA8 A;  3V7S A;  1YJW T;  2KK4 A;  3VKI A;  3JCM e;  2PQW A;  2QEX A;  1K73 C;  2L5Q A;  5LJ3 g;  4EMK B;  2EAY A;  4M78 G;  5KH6 A;  3QJ6 A;  3NTI A;  1X6O A;  4D6W A;  1PSF A;  1U1S A;  4M77 C;  2HQE A;  2F69 A;  4L5G A;  1YIT A;  1Y96 B;  1W2B A;  2P0P A;  2R58 A;  4M7A F;  1QW1 A;  3QBY A;  3M56 A;  1UGR B;  4OVA A;  3PIP A;  2VC8 A;  3QHS A;  4JS4 A;  2PVG B;  3HP9 A;  1Q82 U;  3OYB A;  4B9W A;  3V7C A;  4ATO A;  1V29 B;  4BI8 B;  1M1K U;  2E65 A;  2QQA A;  1M4Z A;  5DLQ E;  1N6A A;  2VGN A;  1DJ7 B;  2R5M A;  3HRT A;  1JJ2 A;  1ZHI A;  1WJQ A;  3J7A F;  3X28 B;  3OSS C;  1WQW A;  1N9S A;  2CZ6 B;  4PJO G;  5LL6 S;  4C92 B;  3JCM b;  4XQ3 A;  2ZPI B;  4LDU A;  2PUK B;  2QI2 A;  4M77 D;  4EMK A;  2DTO A;  4EPC A;  2OTL A;  2NLU A;  3CCV T;  2JNG A;  4J6X A;  4L59 A;  1D3B B;  2JN0 A;  1XQH A;  5CO7 A;  4BUG A;  1Y96 A;  1G3T A;  1WPY A;  2XG8 D;  3JRZ A;  2K5I A;  2KSS A;  2Y4X A;  3NTH A;  3MP6 A;  3L42 A;  4J5Y A;  4JLI A;  4MZM A;  3P8B B;  4Y28 E;  3V8K A;  3JB9 J;  1KC8 C;  1VQL T;  2D9T A;  3G71 A;  2DXB A;  5CKE A;  1VQ8 T;  5D6X A;  2ZPE B;  4MDX A;  3M59 A;  2GF7 A;  1TH7 A;  3M4G A;  4A54 A;  2XK0 A;  3LWH A;  1LOJ A;  3OS5 A;  4M78 B;  3OYG A;  3E9G A;  3LH0 A;  1N8R U;  2FYK A;  4C92 A;  4KUL A;  4A4K A;  3PFS A;  4A4E A;  1QVP A;  3HPW A;  4V2S A;  2QQB A;  3A8G B;  2B8A A;  4X9C A;  3OS2 A;  3MP8 A;  1AHJ B;  1D3B A;  2RK2 A;  3UDC A;  2CZ0 B;  3WXM B;  4A4G A;  3QZ9 B;  4P5N A;  2RJC A;  4PLL A;  4C92 C;  5GAO q;  2ZPF B;  4F7U E;  2K3X A;  3BDL A;  5DY9 A;  1Q86 U;  4N0A A;  2KVQ G;  5CKH A;  1VQ6 T;  3MCA B;  5LJ3 e;  1ZQ1 A;  4N4I A;  2RHX A;  3MO8 A;  5FRN A;  4L6V 5;  4PJO B;  3X25 B;  2MWP A;  4QQG A;  4OB1 B;  3CC7 A;  3HL8 A;  4M78 A;  1FWZ A;  3ER0 A;  4DOV A;  1NJI C;  1VQP T;  1M90 U;  1BIA A;  1HK9 A;  2DK3 A;  1BI3 A;  2L89 A;  3X20 B;  3JCM J;  3JCM V;  1VQO T;  1OZ3 A;  3FIF A;  3PT9 A;  4BI4 A;  2K2V A;  3KBG A;  4C92 D;  1VQK A;  1FX7 A;  4RCC A;  1QVG A;  4M78 C;  3QZ5 B;  3C12 A;  2WSF E;  3JB9 G;  3CEY A;  3VYH B;  3VUB A;  4II1 A;  4ZGE B;  3QPH A;  2OTJ T;  4XU0 A;  1Q82 C;  3CCJ T;  2HAX A;  2MAM A;  3JB9 H;  4PJO A;  3JCM P;  1M1K C;  2EWN A;  2DXU A;  4XTX A;  1YJN T;  1NE8 A;  1KQS S;  1KQ1 A;  3PGG A;  4DOW A;  4ELZ C;  3BW1 A;  2BUD A;  3CCL A;  5J26 A;  4NS5 A;  3TCJ A;  5GAN g;  1QVF A;  3FDR A;  4M78 D;  3GLX A;  5C0M A;  3L2U A;  1Q7Y U;  5CKF A;  3RKX A;  4PJO C;  4J6Y A;  2G3R A;  1KC8 U;  1M1G A;  5A2Q E;  1BKB A;  1BI2 A;  3RUX A;  1WNL A;  4MZT A;  2DAQ A;  4C0D B;  5GAN 4;  3G4S T;  4PKC C;  4X34 A;  5LJ5 h;  4M7A E;  2RB6 A;  4M75 E;  5GAN j;  5CK9 A;  3OS0 A;  1HXD A;  1VIF A;  2DVE A;  3PNW C;  3M55 A;  2QDY B;  5M9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...