2LTOA

Tdrd3 complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
58
structure length
58
Chain Sequence
MKMWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of asymmetrically dimethylated arginine by TDRD3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transferase
molecule keywords Tudor domain-containing protein 3
total genus 8
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2012-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ltoA00
1OZ3A 3PFSA 4IUTA 5KH6A 3P8HA 4A4HA 4C5GA 3OYIA 2M1HA 3PMIA 4IUPA 3L2UA 5FRNA 2LRQA 5KCHA 2L3RA 4ZTFA 2E5QA 4FL6A 5C6SA 2XK0A 3OYHA 5FRMA 2L89A 5KE3A 4A4FA 3FLGA 2HQXA 4HCZA 2RHIA 2RJEA 3E9GA 3OYBA 2NLUA 4FU6A 3MEAA 3OS0A 2P0KA 4QVZA 4A4EA 2GFAA 4N4IA 2EQJA 3S3MA 2BIVA 1RI0A 1OZ2A 2X4XA 3LLRA 2R58A 3LH0A 3ZEHA 4B9XA 4E7IA 3CEYA 3MP1A 3S3NA 2E6NA 4II1A 3L2WA 2LVMA 2IG0A 3S6WA 4N4GA 4OVAA 2GF7A 2BKDN 2M0OA 4A4GA 1SSFA 2GFUA 3OYFA 1WJSA 3MEVA 3BDLA 3OYGA 2JTFA 2RJDA 3L2QA 2RI3A 3DLMA 3ME9A 5IAYA 3FEOA 3OYJA 3O8VA 3PNWC 5KE2A 2R5AA 4BE0A 3OYAA 3L2RA 3OMGA 2F5KA 3MO8A 3LGFA 3FC3A 2RJCA 1G5VA 1OI1A 4GY5A 1KHCA 3DB4A 2VYTA 2D9TA 3KUFA 4PLLA 3QKJA 2EFIA 2RHZA 3MEUA 3ASKA 4X34A 3H8ZA 3OYLA 2RHXA 2B8AA 2FHDA 3LGLA 4UC4A 4BE1A 2K3XA 3OMCA 5C0MA 2CKKA 2JZ2A 3C4SA 2M16A 2R57A 2QQSA 4C5HA 2RO0A 2R5MA 3EAEA 4BACA 4BD3A 4RG2A 3NTHA 4PL6A 2MWOA 4CRIA 3OY9A 4IUUA 2YRVA 2BUDA 2RI5A 2WACA 4E7HA 2RHYA 2K3YA 4Z02A 4BE2A 3MP6A 4C5EA 3NTKA 3P8DA 5D6WA 3OS2A 2MWPA 4LD6A 1MHNA 5J39A 3QIIA 2EQUA 3OYMA 4BDZA 3MEWA 2EKOA 3MP8A 4QQGA 3L42A 4E7LA 2DIQA 5D6YA 5M9OA 4E7KA 3META 4C5IA 2DIGA 2X4WA 2EQMA 2RI2A 2O4XA 5CIUA 3UT1A 2RJFA 3LX7A 2LDMA 5IN1A 4BDYA 1N27A 2QQRA 3NTIA 3M9QA 5KCOA 4IUVA 4B9WA 2PQWA 3H6ZA 3OQ5A 5J26A 4L59A 4NS5A 3F70A 2XDPA 3S3OA 3L2VA 2X4YA 3DB3A 4Q5WA 4N4HA 2LCCA 3Q1JA 2EQKA 5FROA 4EDUA 3OB9A 4IKFA 1WGSA 2L8DA 3PMTA 5D6XA 2LTOA 3FDRA 3QBYA 4QW2A 1OYXA 3SD4A 3OS1A 2G3RA 3OYNA 1H3ZA 4E7JA 1XNIA 3GOXA 3OA6A 4QQDA 3OYEA 2X35A 3E9FA 3OYDA 1WJRA 4IUQA 4PLIA 3LYIA 4ZTJA 2HQEA 2DAQA 1WJQA 3QJ6A 4IURA 3OYKA 2RHUA 4QQ6A 3OYCA 3UWNA 2O4XB
chains in the Genus database with same CATH superfamily
3QSUA 4IUTA 3G1JA 5GAN2 1QW1A 4JZ3A 1UHCA 2O01E 1BI0A 2PVGB 4M75B 4XU0A 1HD3A 2H8HA 5KYXB 2B86A 2JM8A 1WXUA 4ORZA 2IVWA 1PSEA 1VQNA 1ZX6A 4M77G 5GAN6 5IXBA 2EBPA 2JT4A 3SWNB 5GAMd 3OS5A 2F1LA 2EPDA 5HCKA 3J80E 3L2QA 2RI3A 1RADB 5LJ3g 2L3PA 3LW5E 3JCMb 1B07A 3JB9H 2E70A 5GANj 3X25B 1YITQ 1QVFS 3M56A 4RKUE 3VV0A 2COYA 4UC4A 3OW2S 3KFVA 1M1GA 2ZPGB 2ED0A 1G2BA 2CT4A 2K3BA 3VS7A 1JB0E 1GBRA 2E4HA 1VQ4T 1V29B 4A53A 4XK8E 3L1AA 4M77C 4M75A 3J81E 2DVEA 3KBGA 4C0DB 2EJFA 4JJNK 1UGVA 1QVPA 4J6YA 1ZBJA 5A0DA 1K73C 1VQLQ 2A28A 2FO0A 3FJ5A 4M7DE 2OTJT 4DBFA 2CSIA 5EC7A 1QLYA 3CMAT 2I2LA 2PQWA 3H6ZA 1YJ9T 2KT8A 5LJ5e 4AG2C 1X2QA 1KFZA 1O9SA 3L2VA 4Q5WA 3V7CA 1IGQA 3C95A 3I56Q 3JSCA 5CKBA 2YUNA 4MMKA 3CPFA 4XTWA 2YDLA 4J7IA 2DRMA 3CCET 2X35A 1JBMA 4C92G 2WSFE 1BI3A 5GAOq 3GNGA 3CXCP 3L2UA 3TSZA 1I81A 1PHTA 1W1FA 4C8QF 2RM4A 3OYBA 2NLUA 1VQ8T 2P0KA 2HSPA 5AYFA 2RMOA 5FU6C 1WX6A 1RI0A 3CCST 1OZ2A 1KD1R 2GTOA 5CR2A 3I9QA 1R8OB 1XTDA 2NUPA 4BY6C 5GMKl 2KI7A 3BDLA 1MMGA 2JM9A 4ZN3A 3VRZA 3GP8A 3OBWA 3OW2P 1YP5A 3RKXA 3H8ZA 2K3XA 3JCMV 3OMCA 2V8KA 4PJNA 3JCMX 4M7DA 5J3BA 4BACA 1ZSZA 2FZCB 1WNLA 5GAN5 2LNVA 3BFMA 1AWOA 2RHYA 4FSSA 1W4SA 1T3LA 2FVUA 4F14A 3CMET 2EGAA 2KQWA 1D3BB 4JUVA 5KYNA 3RESA 5A0LA 2YSQA 1VQ7Q 2RH2A 2L5QA 4PK4A 4EIKA 4C0FA 4HT8A 3JCMd 1YN8A 2KMTA 3I35A 2SRCA 2ENMA 2EYXA 2CP0A 1KIKA 2X51A 3QYGB 2KXDA 2ZPEB 1TWBA 2OTLQ 3M4GA 4QW2A 2DE0X 1ABOA 2EJGA 1WI7A 2LQNA 5FU7B 5LJ3f 3CCVQ 2HAXA 3G6ET 1XQHA 3G6EA 4RTVA 2O4XB 1GCPA 3RUXA 1ZLMA 4IUPA 1ZUUA 1RUWA 3C0CA 3JCMe 2C0IA 2L3RA 5GAMh 5FRMA 3QHSA 5KE3A 1AZEA 3SB2A 2X3WD 2F2XA 2NWMA 2R58A 4MDXA 2AIRB 1NJIC 4M7DF 1AD5A 1QKXA 1RACB 3LWHA 1QVFA 1P92A 2R5AA 4F7UB 2F5KA 3MO8A 2W0ZA 3JV3A 2EKHA 4R56A 1MUZA 3DB4A 2VYTA 4BDZA 1YJWQ 5CO7A 2B8AA 4BE1A 2DXBA 2M0YA 1N9SA 1Q81R 2JZ2A 2KYMA 2R57A 3GIBA 1N6AA 3EH2A 2JXBA 1K73U 2RI5A 2Z0WA 5GANh 2JOYA 3OS2A 2LC4A 1NJIR 2FPDA 3MEWA 1I5LA 1EX4A 1OU9A 4RCCA 5GAMg 4E7KA 3META 2O2OA 1BBZA 1YHQT 4HCKA 2O4XA 3LX7A 4OB2B 3G4ST 1M90R 1GL5A 4M7AF 4IUVA 1GFCA 2QA4A 5IHNA 1MV3A 1BIBA 1QVGP 1WGSA 2K6DA 4EMGA 2LTOA 1VQ5A 3QBYA 2RA2A 1OYXA 3H0IA 1NZ9A 2DMOA 4FW1A 2P4TA 1M8VA 1LJOA 4OGEA 3OA6A 2KROA 1IHWA 3OYDA 1K8AC 4N0AC 4C92F 1QQJA 1GRIA 1NE8A 3OYCA 4Y91A 3QDRB 2E64A 4ANJA 3MPUB 2O9VA 2K2VA 4PJMA 1ZHIA 3H9NA 1D0XA 2QGGA 4J9EA 1V76A 1M1KC 4J5YA 3I55A 1K9AA 5GAMe 4AFZC 3CCMQ 4M7DD 3M59A 3R6NA 3LLRA 4OGCA 1AZGB 1TSFA 4N4GA 3UF4A 2BKDN 1OULA 3HRTA 3M53A 4RUGA 2RJDA 4PJOB 1EIFA 4M7AE 1KC8R 1ABQA 2JW4A 2GTJA 5AT1B 3LGFA 1N8RC 1KSWA 3MCAB 3JB9J 3I5RA 1UEBA 4PJOC 1VQ7T 1Q86C 4JLGA 1D09B 2E12A 4C5HA 3VS5A 4RG2A 2MWOA 4CC4B 2YRVA 1IHVA 4BE2A 3HRUA 3NTKA 5LL6S 2PVOB 3UPUA 5CCAA 3CPWS 2EKOA 4DQ2A 2DXUA 3PIOA 4J6WA 1RAFB 1H641 2RB6A 4C92B 1Q95G 3LH5A 1WXBA 4EDUA 2LP5A 4F7UA 1U5SA 1VYUA 1JU5C 4WTOB 1Y71A 2JUFA 3V8KA 2XI9A 4IUQA 1YI2A 3QJ6A 4QVCA 1VQLT 3JCMc 2OTLT 1OZ3A 1QP2A 1KK7A 1VQPA 4O6JA 2QGFB 2BZ8A 1TG0A 2E5QA 3EG9A 2QI2A 5C6SA 5I11A 2EYWA 4QVDA 1QVFP 4M7AG 3EGDB 1R77A 2AT1B 3BY7A 2GNCA 2DJZA 4M78C 4E7ZA 1QWEA 2ZPIB 1SF9A 4OVAA 3DLLA 1OPLA 2FEIA 2QTXA 3DLMA 3ME9A 1ZSZC 4XAXB 2J06A 1Q7YR 2DRKA 4C0GA 3JCMP 3M0QA 2DZCA 2CREA 3CCJQ 1JJ2A 1OI1A 4GY5A 2XG8D 3MEUA 3ASKA 2CKKA 3C4SA 1BI1A 1M27C 2VV5A 3CCUA 4XU2A 3NTHA 3QG1A 1VIFA 2RD1A 3CCUT 2V1QA 1I0CA 5HK0A 5GAN4 4PJOD 3EH1A 5DLQE 3OYYA 1BYMA 2J6FA 2QQAA 2CDTA 3QIIA 3CC7A 2BE9B 2DIQA 4TVRA 3HFOA 1C6VX 4L6V5 4B6MA 1N27A 3NTIA 4ZGDB 3M9QA 3CCMA 5GAOm 2EQKA 3M5AA 1UG1A 2ED1A 1VQ9Q 4F04B 2DM1A 1Y07A 3RNJA 2MAMA 2E65A 4VUBA 1YCSB 1ZUKA 4PLIA 1AEYA 4RTXA 4IURA 1B34A 3SEMA 4EMKA 1QVGS 3UWNA 4FYYB 4M78G 1NLPC 5D7UA 4V2SA 3G71Q 2YRDA 1TU0B 2Y90A 2FYKA 5GJWB 1H3HA 2A0FB 4O5VA 5GANf 2QDYB 1K8AU 1CKBA 3R6OA 2VGMA 2GBQA 3FLGA 2HQXA 4HCZA 1Y96B 4RTWA 1A0NB 2BZXA 4MDWA 1WHHA 1B34B 2DD5A 2K9GA 4B9XA 1M1KU 1BKBA 4NL2A 3L2WA 1OPKA 4QT7A 1M4ZA 2QK0A 1VQOQ 3GBQA 5GAN3 2LX7A 2FZGB 2QG9B 2FRYA 1Y0MA 3FEOA 4PJOA 3CCLQ 4OB1B 3AT1B 2ZAEA 1VA7A 2DTIA 3H41A 3OMGA 3FC3A 3A8OB 3TEEA 4M7DG 1YITA 1VOMA 4PLLA 1UE9A 2RHXA 3H0HA 2CP2A 3GLXA 3LGLA 2FL7A 2QYZA 1YITT 2KNBB 2GQVA 1BB9A 2DL4A 1BCOA 1NYFA 4J8OA 5FWCA 4M7AD 1D3BA 2A3LA 1OOTA 1VQOA 4ZN1A 3ZBDA 1QCOA 1U1TA 1WQWA 1YJNA 2CUDA 2A08A 2EQUA 2ROTA 3OYMA 2FPEA 3MP8A 1B3QA 1UGQB 2LT1A 2F2WA 8ATCB 1W2BS 1HJDA 3KXTA 4M78E 2YWWA 4Z89A 1VQ8A 4N0AA 5LJ5j 2HZYA 5KCOA 3G4SA 4XTVA 2ZPFB 4M4ZA 4JDSA 1QWFA 3THKA 1AVZC 4E7JA 1Q82C 5GJVB 1VQ6T 3TREA 3UATA 1S72T 1WJQA 5LJ3e 3VRYA 1SHGA 4ELYC 2DYIA 5KH6A 2RF0A 2RPNA 1GCQA 2DZ9A 2MCNA 3VS0A 3A1PA 4J9CA 2EYQA 2BE7D 4F7UG 3CMEA 1ZSZB 4OMLA 5FW9A 2HL5C 3HP9A 2M9UA 4MZMA 3S3NA 2JTMA 1WLPB 2P84A 1KQSA 2GF7A 2XMFA 1X69A 1KD1C 3CCLA 3CCVA 2J7IA 2VB6A 2AZVA 2D0NA 3FIFA 1G5VA 4OMPA 5GAOr 1V1CA 5FU7C 2CT3A 2BTTA 2ECZA 2JS0A 2DETA 2RQUA 2CS7A 5IXFA 1U3OA 1T0HA 3E19A 4LXCA 3CXCS 4JJDA 2DTOA 1M2OA 2D1XA 2E3HA 3G71A 3JB9I 2CH4W 3A98A 1M2VA 3NHNA 2BZYA 4LE9A 3CMEQ 4E47A 2VC8A 4JLIA 3VU3C 5KYWB 5KYUA 1VQNQ 1VQ4A 4BDYA 2LDMA 3EHRA 3ZL7C 1MV0B 1K8AR 1K76A 1RL2A 1FYNA 1M90U 4P5NA 3OB9A 5D6XA 4DBRA 2LT4A 2ABLA 1JJ2P 3OW2A 1NJIU 3CMAA 5IT9E 4KGXB 4LDXA 4QQ6A 1VQ4Q 1WPYA 1K9MU 5GAOp 1WHMA 3BW1A 2M1HA 1VYTA 1M8MA 5KCHA 4OMQA 2YUPA 5I2SA 4EMKC 3CC4Q 3TVTA 4DOWA 2PZ1A 1RLQC 1RI9A 1UJ0A 4AFQC 1RAAB 5LJ5d 2F5TX 5LJ5h 2QEXT 4ELZC 1SSFA 5GMKe 2QTVA 4K11A 5IH2A 1NPRA 4CC7A 1C1AA 4PJOF 3EGXB 1YBYA 1WIEA 2E3IA 2K4YA 3CC4A 3OSVA 4HA8A 4C8QB 2RJCA 5LJ3h 2DD4A 1VQ5T 2CZ1B 4E6RA 2LQWA 4C0DC 2E6ZA 1AWWA 2JMCA 3CCJT 3TU4K 4BD3A 2NUZA 3RR6A 4Z02A 4C5EA 2VVKA 3P8DA 4OF1A 4FYXB 2PVDB 1QCNA 3HHTB 1ZA1B 4XU3A 1YFNA 1LVKA 3CCQQ 4JJBA 2QQ9A 1ACMB 1JQQA 4XTXA 2GGRA 3M4YA 2KT1A 1TOVA 1UUEA 4F7UF 4C92E 3QJYA 1WFWA 5GAN8 4BY6B 5J26A 3QZ5B 2QA4Q 1G3WA 1VQMA 4M78D 4NS5A 5CK9A 1X27A 2XDPA 5GMKi 4XTYA 4AT1B 2XD0A 2O31A 1IGUA 1VQKT 1X75C 2A7YA 1EFNA 2HDAA 4OMFB 2A36A 1XNIA 4PJJA 4RG8A 3V8LA 2DERA 2HQEA 2RHUA 2XDDA 2LJ3A 1Y57A 2NUTB 2ZGWA 1YJNT 5GANd 4J9GA 4ZGJB 2OTJQ 1NLOC 3REBB 2JVVA 4ZTFA 1CSKA 4XU1A 1OEBA 1ARKA 2PNIA 4DEXA 3URGA 4DBHA 1W2BP 3CC2Q 4A54A 1Z9QA 3D7SB 3OBYA 1W2BA 2AKLA 2L0AA 3J7AF 2KR3A 3A8LB 4KUIA 1PCXA 3CPWP 4M78B 4E7IA 3CEYA 2E6NA 3QWYA 2XKOC 1VQ9T 1X6BA 2JTFA 3JB9G 1HYOA 5IAYA 7AT1B 2KGTA 1JXOA 5EG2A 4NL3A 3PT9A 4BE0A 2OTLA 3OYAA 2DEQA 2DNUA 1GXIE 3CC2A 4M77B 2D9TA 3OYLA 1X6GA 3UA7A 1WHKA 2FHDA 5HY6A 3CXCA 2A37A 2DVJA 1S1NA 2CZ7B 5C0MA 1X2KA 5I22A 1IZ6A 1SHFA 2YLCA 4X9CA 3RMQA 2BUDA 3EGDA 4LDYA 1Z9ZA 2K5FA 1VQOT 2DTHA 3O5ZA 2KAFA 1AOJA 1WHJA 4Y28E 2HMAA 1Q86R 2EQMA 1RAIB 2D0QB 1MMDA 1LOJA 1KQSS 2RJFA 3MJXA 1YJ9Q 5HK3A 4RTUA 5GAN7 2KDSA 3EFOA 2WSEE 2KYBA 3S3OA 2C0OA 1WQ7A 3G71T 1TXQA 5GMKj 3PMTA 2DYBA 2MK5A 1SPKA 1WA7A 2G3RA 1TUGB 5IHKA 2ESWA 3GOXA 2E5KA 4IIOA 1M90C 1IRXA 1WJRA 2X9HA 2KVQG 3LYIA 4ZTJA 4LDVA 3OYKA 2MPXC 3CC7T 5GMKm 3P8HA 2H3EB 4OMOA 3PIPA 5FRNA 1UTIA 1ZSGA 2XK0A 1PG5B 4M7AC 2L89A 1YJWA 1UHFA 2IIMA 3QDFA 1YI2Q 2DL5A 4BUGA 3CQTA 4FM4B 2YHTA 3WVEB 3S3MA 3H0FA 3JCMg 2J6OA 3NFCA 2MYSA 2M51A 1VQPQ 2IG0A 1I4K1 2GFUA 3VUBA 4FYVB 2KRNA 3A8GB 1K1ZA 3REAB 1TTHB 3CCUQ 5I2MA 2NYSA 5KE2A 1OV3A 3JCMh 1AT1B 3X28B 2HKQB 3QZ9B 2K2MA 1G3SA 2LQKA 2KY9A 3PGGA 4A4KA 3BDUA 2DPPB 1G3YA 4LNPA 3X24B 4CRIA 2WACA 2DXTA 4A63B 4IIMA 3QWXX 4C8QG 3MP6A 4GLMA 3UA6A 5D6WA 1Q86U 4LD6A 5J39A 5CKHA 1M3BA 1OU8A 1SRMA 5GAOn 3TSWA 4EPCA 4C5IA 2DIGA 1PNJA 3T9NA 4ME7A 2PUOB 3QYHB 4LDUA 2QQRA 4Z8AA 4M77A 4M75C 2MMPA 2GQIA 2V8IA 2XIDA 2AHJB 3VKIA 1Q81C 1FMKA 1KG1A 2LCCA 3A8HB 2ROLA 2VGNA 3CCSA 1FXXA 3OS1A 4DEYA 1M5Q1 1NEGA 1JJ2S 4QQDA 3OYEA 4ZNXA 1VUBA 3CCMT 2DAQA 1YIJT 3RBBB 8AT1B 5DM7R 9ATCB 5KYXA 1X6OA 3OYIA 2X4JA 1RABB 3M0RA 2O88A 2XU8A 2YRCA 4FL6A 3V8JA 1WZOA 2VASA 2KRSA 4FSXA 3CCEA 4A4FA 3EG9B 2RJEA 3E9GA 1JO8A 1LNXA 2KSSA 1VQLA 3VS4A 3MP1A 3MHXA 2LVMA 2HBWA 5CKEA 3OYFA 1WJSA 2C0TA 2CYZB 2DX1A 3GF5A 4JZ4A 3L2RA 1K9MC 3CC4T 2DBMA 1M3CA 2D8JA 2PU9B 2OJ2A 3PVLA 1QKWA 4C92A 2M16A 1SKUB 4DBQA 2HL3A 4DA4A 3PE0A 4PL6A 1YCYA 2DXCA 2H3JA 3MKDA 4PKCC 2K3YA 4QKUA 1WYXA 1Y96A 3ER0A 1W6XA 2D8HA 3CD6Q 2DILA 2K5IA 1NG2A 3RKWA 4X1VA 2LX9A 1C0MA 1YIJQ 3U23A 3CD6A 1YJWT 3CCVT 2LCSA 2CSQA 5IN1A 1VQ8Q 2JNGA 1YI2T 1N5ZA 1KHIA 1H92A 2RN8A 1GBQA 4R55A 1D0YA 2X4YA 4CC3A 2EW3A 1NM7A 1G3TA 2L8DA 2QDLA 4M75D 5DY9A 1M3AA 3ULRB 2ATCB 3CC7Q 1X01A 4R0KA 4RTTA 2DKGA 4BB7A 1KD1U 3RMSA 4M78A 4JS5A 2CUBA 1ZUYA 2QXFA 3V7RA 4AFSC 1DJ7B 3CCRT 1ZQ1A 2EYZA 2D6FA 1FX7A 1MNDA 1R0BG 2DL7A 4FU6A 1GFDA 3RDVA 4QVZA 3RIRA 2GFAA 4X9DA 4M7AA 1NPPA 2MF2A 4WF2A 4J9IA 2KRMA 3HSBA 3CD6T 1UDLA 2E41A 1K0SA 2I0NA 1UJYA 4C0ZA 3PNWC 1ZA2B 4XTZA 1B7TA 4C8QE 4E7SA 1KHCA 1VQPT 2KBTA 2RHZA 3CCSQ 1OX8A 1KQ2A 1UGSB 4LDWA 3M54A 2YLBA 4KGZB 2DLPA 3L2ZA 2E10A 2DF6A 4RCBA 4Z88A 1RAEB 2R5MA 3VUZA 1JRIA 4IUUA 4OP0A 2OX7A 3HKSA 1LCKA 3DKMA 1UFFA 1G8XA 3N5BB 1RAGB 3NMZC 2RK1A 2ZPBB 3PTAA 4OMMA 4M78F 3IQLA 4EMHA 3CCEQ 3CPWA 5CQYA 1FMVA 1AWXA 2HD0A 3M0UA 2HEQA 3VS1A 1D0ZA 3WXMB 3F70A 4M75F 2XDBA 1UGRB 3X26B 2EIFA 2QEXA 3Q1JA 3M0TA 4D6WA 2CP5A 1YJNQ 3M57A 5GAOl 1H3ZA 1PD1A 3CMAQ 2RQWA 4M75G 3E9FA 1IB8A 3SFMA 4PJOE 1Q81U 4M7AB 2EGCA 4PJLA 4A4HA 2AK5A 3EG1A 1O75A 3OSSC 1WHGA 2DL3A 1M1FA 1TUCA 3CBMA 2SEMA 3I55T 1K9MR 4JJCA 4AMCA 2OAUA 4C92D 2QQBA 4CI0C 4RMOA 2J6KA 3MEAA 2CGHA 4J83A 1UB4A 2EQJA 3HRSA 2BIVA 6AT1B 2O9SA 1MMAA 3ZEHA 5CVIA 2K79A 2EYYA 1XJWB 1I5OB 3P8BB 2M02A 4HCBA 3MEVA 2OAWA 4HKEA 3TCJA 2LJ0A 1E7OA 2CH4A 3EG3A 1U06A 5CKFA 1IO6A 3JB9F 3TQ7P 1E6HA 4C8QC 4LN2A 2MOXA 1D1AA 1D1BA 1MMNA 3SWNA 4PFOA 5CAIA 1K0XA 5KYUB 2RNAA 3OY9A 1HSQA 4WCIA 1PWTA 1Q7YC 3AHUA 2KK4A 2VKNA 3G7ZA 1TH7A 1VQ9A 4QQGA 1BU1A 1WDXA 2VWFA 5L8RE 4F16A 4YTLA 5FU6B 2DO3A 4J7FA 4L5GA 5GAMj 5CIUA 5LJ5f 2COWA 4J9DA 4B9WA 2E1HA 1VQMQ 4FT2A 2RQVA 2GCXA 3VYHB 5CQXA 1HXDA 2PUKB 1GCQC 5FLXE 3FDRA 1SRLA 2HBPA 1YWOA 4ZGEB 2F2VA 2DBKA 1RLPC 1VQ6A 1I07A 1FWZA 2KEAA 4M77D 3CC2T 1NBEB 4D8DA 2FB7A 2JMAA 2F69A 1OX9A 2RQTA 4BI8B 1KC8U 2JS2A 3NGPA 3I5SA 2YUQA 2RHIA 4PJOG 1Q82R 1WXTA 3OS0A 4E2FB 1VQNT 2AKKA 3JRZA 1Q7YU 2G6FX 3QO3A 2X4XA 1U1SA 3QXEB 4J9BA 3LH0A 4Y92A 4KUDK 4II1A 3S6WA 3JCMW 1IXDA 1VQ7A 4OMNA 4A4GA 4LUEA 2JTEA 2DFUA 2Y4YA 3OYGA 1M9SA 2HKNA 5HKCA 3VS3A 2DK3A 1OQKA 1E6GA 2DA9A 4MMLA 5LJ3j 1TUDA 1BCMA 2HQHA 2QEXQ 2ZZDA 3QKJA 2EFIA 1PRMC 2YXYA 2RK2A 1QVGA 2QASA 1QMCA 2RO0A 4XQ3A 4C8QD 4HCCA 1UGPB 3G4SQ 2PTKA 1T0JA 2CZ0B 1H8KA 2KXCA 2X3XD 3RERA 3G6EQ 1AHJB 1MHNA 3FRNA 4KBMB 2YUOA 4M75E 3CBOA 3L42A 1SEMA 2VXFA 3M0SA 2JN0A 2NUTA 5D6YA 3CCRQ 4M77F 1YWPA 1VQ5Q 4BI3A 2RI2A 3CCJA 1SG5A 3EGUA 1YJ9A 1EZZB 2P0QA 1PC0A 4GLKA 1ZBXA 3JCMQ 5FROA 4HVUA 3M0PA 4IKFA 2CP6A 4HXJA 2YT6A 1BI2A 5GANe 5DLOA 3WVDB 4BI4A 5GMKh 3UDCA 3EG2A 1Y7XA 1YIJA 2DEUA 1PM3A 3PFSA 2EGEA 1X43A 1YHQQ 3SHWA 1NEBA 1R0CB 1VIEA 4OB0B 1VQKA 3PVQA 2HNIA 4MZTA 3OYHA 3JAME 1LPLA 4M7DC 1XOVA 1YHQA 1VYVA 2ZCFB 2FZKB 3CCQA 4KULA 4J9FA 3HPWA 4F17A 3GPLA 4N4IA 3CCQT 2LJ1A 3GNFB 2V8JA 3LWIA 4M7DB 3FJPA 2LZ6B 4EMKB 4JPBW 1TS9A 3CBPA 2M0OA 1QCFA 4KRTA 4C8QA 4ESRA 3M58A 4FCYA 5FWBA 3O8VA 3HFNA 5KYYA 1JXMA 3VJPA 3SWNC 2WSCE 4X34A 2CZ6B 2CP3A 5A0GA 2K57A 2XHCA 3VYGA 4ATOA 1KQ1A 3M55A 2LNHB 2EJ9A 3EAEA 3QUIA 2OTJA 3ZFJA 2L3SA 4PNOA 1MGQA 2Y4XA 3SDZA 4CC2A 2W10A 1S72A 4FIBA 3EG0A 2KE9A 4FT4A 2V1RA 4E7LA 1J3TA 3HL8A 1KJWA 2JJ9A 4KH0B 5I21A 3I56T 5M9OA 1S72Q 3C12A 2J05A 1D1CA 1G83A 2X4WA 3INZA 1VQ6Q 4LUDA 1N8RU 2P0PA 4OB3B 4C92C 3A8MB 5LJ5g 5ECAA 1T3SA 3VS2A 2XICA 1F1BB 4GBQA 2EAYA 1KQSP 3EFSA 3JCMf 3SD4A 4XTUA 3QPHA 4JRKA 4MZPA 4KGVB 3OYNA 4JRQA 2L3QA 4NOYA 2VXEA 2C06A 4FW2A 4KH1B 2K5LA 3E2UA 1CKAA 1KC8C 1PRLC 5KYWA 2MIOA 4JS4A 2P4RA 2AZSA 2OI3A 4C5GA 4PFPA 2EVRA 3PMIA 5LJ3d 2LRQA 3E1SA 3X20B 3EFRA 2EQIA 5A2QE 2HSEB 1PKSA 1VQMT 2HCKA 4HVWA 4PFZA 2ZPHB 1BIAA 4A4EA 3VS6A 1IREB 1K4US 4KT0E 1HK9A 4J6XA 2VUBA 1YNZA 3I56A 2CP7A 2MI6A 3CCLT 2DL8A 3OYJA 4LD9K 5GANg 1SSHA 3NPFA 2FG0A 1M30A 1M1KR 2COZA 1FMWA 4HT9A 2NUPB 3KUFA 2DJQA 1I1JA 3CCRA 2FPFA 1I8FA 2QQSA 2LQ8A 1PKTA 4AG1C 4RTZA 4JRPA 4M77E 2L2PA 2K7AA 4E7HA 1M2VB 1UECA 5GAMf 4DOVA 2MWPA 2LMJA 1AWJA 1RAHB 2IPOB 1VQKQ 4HVVA 1N9RA 5L23A 4RTYA 3V7SA 1N8RR 2V26A 5IHIA 3UT1A 1U8RA 1JEGA 1PSFA 2RQRA 3EHQA 2QA4T 3JCMJ 2LCLA 3BE3A 1PD0A 2QAZA 3OQ5A 1Q82U 4L59A 4D8KA 1WHLA 1NYGA 3A5ZB 3I55Q 3DB3A 4N4HA 4FYWB 3EGXA 1K73R 1W70A 2EWNA 4JRIA 3C94A 5KYYB 4F7UE 3EFOB 3RKYA 4J9HA 5CKDA 4AFUC 3HTRA 2FRWA 1MNEA 3FB9A 1QP3A 3JB9D 1BK2A
chains in the Genus database with same CATH topology
1OZ3A 2ZGWA 3QSUA 1YJNT 4IUTA 4A4HA 4ZGJB 5GANd 5GAN2 1QP2A 3OSSC 1O75A 1QW1A 1VQPA 1M1FA 2JVVA 4ZTFA 4O6JA 3CBMA 2E5QA 2O01E 2QI2A 4XU1A 5C6SA 3I55T 1BI0A 2PVGB 4M75B 3URGA 2OAUA 4XU0A 4QVDA 4A54A 4C92D 2QQBA 4M7AG 4CI0C 3OBYA 1W2BA 4RMOA 3MEAA 2IVWA 2CGHA 4J83A 3J7AF 1PSEA 1UB4A 2EQJA 3A8LB 4KUIA 3HRSA 2BIVA 3BY7A 4M78B 2DJZA 4M78C 1VQNA 3ZEHA 5GAN6 4M77G 5CVIA 4E7IA 3CEYA 3SWNB 2E6NA 2ZPIB 3P8BB 5GAMd 3OS5A 4OVAA 3DLLA 2XKOC 1VQ9T 4HCBA 3MEVA 4HKEA 3TCJA 3J80E 2JTFA 3L2QA 2RI3A 3JB9G 2QTXA 3DLMA 3ME9A 5IAYA 5LJ3g 4XAXB 5EG2A 4NL3A 3PT9A 5CKFA 4C0GA 3LW5E 3JCMb 4BE0A 2OTLA 3OYAA 3JB9H 3JB9F 3JCMP 2DEQA 2DZCA 1GXIE 2E70A 1JJ2A 5GANj 4C8QC 1OI1A 4GY5A 3CC2A 2D9TA 4M77B 2XG8D 3M56A 3MEUA 4RKUE 3VV0A 3ASKA 3X25B 3OYLA 1QVFS 4UC4A 2FHDA 5HY6A 3CXCA 3OW2S 2CZ7B 1M1GA 2ZPGB 5C0MA 2CKKA 3C4SA 3SWNA 5CAIA 1IZ6A 1BI1A 2VV5A 1JB0E 2YLCA 3CCUA 4XU2A 3NTHA 4X9CA 3RMQA 1VQ4T 3QG1A 2RD1A 1V29B 1VIFA 3OY9A 4A53A 2BUDA 4XK8E 3L1AA 4M77C 4M75A 3J81E 5HK0A 3CCUT 5GAN4 1Q7YC 4PJOD 5DLQE 3OYYA 4LDYA 2DVEA 2K5FA 3KBGA 4C0DB 1VQOT 3AHUA 1BYMA 2KK4A 2QQAA 2EJFA 4JJNK 2DTHA 3G7ZA 3QIIA 1QVPA 1TH7A 4J6YA 1VQ9A 3CC7A 2KAFA 4QQGA 5A0DA 2DIQA 4TVRA 5L8RE 1K73C 4Y28E 4YTLA 5FU6B 2DO3A 4J7FA 2EQMA 2D0QB 3HFOA 4L5GA 4M7DE 4L6V5 5GAMj 2OTJT 5CIUA 1LOJA 1KQSS 2RJFA 5LJ5f 3CMAT 1N27A 2I2LA 5HK3A 3NTIA 4ZGDB 3M9QA 4B9WA 2PQWA 3H6ZA 2E1HA 5GAN7 3CCMA 1YJ9T 2KDSA 5LJ5e 4FT2A 2WSEE 2GCXA 3VYHB 5GAOm 1Q82U 3S3OA 1O9SA 3L2VA 4Q5WA 5CQXA 1HXDA 1WQ7A 2EQKA 3M5AA 3V7CA 3G71T 3C95A 5GMKj 3PMTA 2PUKB 5FLXE 1Y07A 3FDRA 3JSCA 5CKBA 2MAMA 4MMKA 2E65A 2HBPA 3CPFA 2G3RA 4ZGEB 4XTWA 4VUBA 3GOXA 4J7IA 3CCET 2X35A 1M90C 1JBMA 4C92G 1WJRA 4PLIA 2KVQG 3LYIA 4ZTJA 1VQ6A 4LDVA 4IURA 3OYKA 1B34A 1FWZA 2WSFE 4M77D 1BI3A 4EMKA 3CC7T 5GMKm 3CC2T 5GAOq 3UWNA 1QVGS 3GNGA 4M78G 3P8HA 2FB7A 4V2SA 3PIPA 3L2UA 5FRNA 2F69A 2Y90A 2FYKA 4O5VA 5GANf 1K8AU 2QDYB 4BI8B 1I81A 2XK0A 3R6OA 4M7AC 2L89A 1YJWA 1KC8U 2VGMA 3FLGA 2HQXA 4HCZA 1Y96B 4BUGA 2RHIA 4PJOG 2RM4A 4C8QF 3OYBA 2NLUA 1VQ8T 4FM4B 3OS0A 4MDWA 2P0KA 2YHTA 1VQNT 5AYFA 3WVEB 3JRZA 5FU6C 3S3MA 1Q7YU 3JCMg 1RI0A 3CCST 1B34B 1OZ2A 2DD5A 1U1SA 2X4XA 3NFCA 3QO3A 3LH0A 3QXEB 5CR2A 4KUDK 4B9XA 1M1KU 1BKBA 4NL2A 4II1A 3L2WA 2IG0A 1R8OB 3S6WA 1XTDA 3JCMW 1I4K1 1VQ7A 4A4GA 1M4ZA 2GFUA 3VUBA 5GAN3 4BY6C 5GMKl 2Y4YA 3A8GB 1M9SA 3BDLA 3OYGA 4ZN3A 5HKCA 3GP8A 2DK3A 3FEOA 5I2MA 4PJOA 4OB1B 5KE2A 3OBWA 3JCMh 4MMLA 5LJ3j 3OMGA 2DTIA 3X28B 3FC3A 3A8OB 3RKXA 3TEEA 3QZ9B 2ZZDA 4M7DG 1YITA 4PLLA 1G3SA 2LQKA 2EFIA 2KY9A 3QKJA 3H8ZA 3PGGA 2RHXA 3LGLA 3GLXA 4A4KA 2FL7A 1YITT 2K3XA 2GQVA 2RK2A 3JCMV 1QVGA 3OMCA 3BDUA 2V8KA 2DPPB 1G3YA 3JCMX 4M7DA 2RO0A 4J8OA 4XQ3A 5J3BA 4BACA 4C8QD 4HCCA 3X24B 1UGPB 4CRIA 4M7AD 1D3BA 1WNLA 5GAN5 2A3LA 2CZ0B 2WACA 2DXTA 2LNVA 3BFMA 3RERA 2RHYA 1VQOA 4ZN1A 1W4SA 2FVUA 4C8QG 3MP6A 3ZBDA 1AHJB 1U1TA 1WQWA 3CMET 1YJNA 5D6WA 1Q86U 4LD6A 5J39A 1MHNA 5CKHA 2EQUA 3FRNA 4KBMB 2KQWA 3OYMA 4M75E 3MP8A 1D3BB 4JUVA 3CBOA 5GAOn 3L42A 2VXFA 3RESA 5A0LA 2JN0A 1UGQB 2LT1A 5D6YA 2RH2A 4M77F 4BI3A 4EPCA 2L5QA 1W2BS 4C5IA 2DIGA 2RI2A 3T9NA 3CCJA 4ME7A 4C0FA 3KXTA 4HT8A 4M78E 2PUOB 3JCMd 3QYHB 1YJ9A 4LDUA 2QQRA 1VQ8A 2P0QA 4N0AA 2KMTA 5KCOA 4M77A 4M75C 5LJ5j 3G4SA 2MMPA 2V8IA 4XTVA 2XIDA 2AHJB 2ZPFB 3VKIA 4GLKA 1Q81C 1ZBXA 1KG1A 2LCCA 3QYGB 3A8HB 5FROA 3JCMQ 4JDSA 2VGNA 4IKFA 2ZPEB 3CCSA 1FXXA 3M4GA 4QW2A 1BI2A 5GANe 3OS1A 5DLOA 1M5Q1 2EJGA 3WVDB 4E7JA 1Q82C 5FU7B 5LJ3f 1VQ6T 4BI4A 1JJ2S 4QQDA 3TREA 3OYEA 2HAXA 3G6ET 1VUBA 5GMKh 3CCMT 1S72T 2DAQA 1WJQA 3UDCA 5LJ3e 1YIJT 1XQHA 3G6EA 1Y7XA 1YIJA 2O4XB 4ELYC 5DM7R 3PFSA 3RUXA 5KH6A 1X6OA 3OYIA 2X4JA 4IUPA 1VIEA 4OB0B 3JCMe 1VQKA 2DZ9A 2L3RA 2XU8A 2HNIA 5GAMh 4MZTA 4FL6A 3V8JA 3OYHA 5FRMA 3JAME 3QHSA 5KE3A 4M7DC 4FSXA 1XOVA 3CCEA 4A4FA 1YHQA 2RJEA 2ZCFB 3E9GA 2EYQA 1LNXA 2KSSA 3SB2A 3CCQA 4F7UG 1VQLA 4KULA 3CMEA 3HPWA 3GPLA 4N4IA 3CCQT 3GNFB 3HP9A 2V8JA 2M9UA 3LWIA 4M7DB 2R58A 3FJPA 4MDXA 4MZMA 4EMKB 3MP1A 3MHXA 3S3NA 2LVMA 2JTMA 1KQSA 3CBPA 2GF7A 2M0OA 5CKEA 1NJIC 3OYFA 1WJSA 4C8QA 4M7DF 3LWHA 1KD1C 1QVFA 3M58A 1P92A 3CCLA 3O8VA 3HFNA 3CCVA 2R5AA 2CYZB 3GF5A 4F7UB 3FIFA 3VJPA 3SWNC 2WSCE 3L2RA 2F5KA 3MO8A 1K9MC 1G5VA 4R56A 3CC4T 3DB4A 5GAOr 2VYTA 4X34A 2CZ6B 5FU7C 4BDZA 5A0GA 2B8AA 2K57A 2PU9B 5CO7A 2XHCA 4BE1A 2DXBA 2CS7A 1N9SA 4C92A 3VYGA 2JZ2A 4ATOA 1KQ1A 2M16A 3M55A 2R57A 4DA4A 3GIBA 2EJ9A 1N6AA 3EAEA 4PL6A 3QUIA 2OTJA 1YCYA 3E19A 2DXCA 2H3JA 4PKCC 3ZFJA 3CXCS 1K73U 2RI5A 4PNOA 1VQMA 1MGQA 2K3YA 2Y4XA 1Y96A 3ER0A 2JOYA 3SDZA 5GANh 2DTOA 3OS2A 1S72A 4FIBA 2LC4A 2K5IA 3MEWA 1I5LA 3G71A 3JB9I 3RKWA 4FT4A 4E7LA 4RCCA 2LX9A 3HL8A 5GAMg 5I21A 3I56T 5M9OA 4E7KA 3META 4E47A 2VC8A 3C12A 4JLIA 3VU3C 2X4WA 1YJWT 3CD6A 3CCVT 1YHQT 3INZA 1VQ4A 2O4XA 4BDYA 3LX7A 2LDMA 4OB2B 5IN1A 3G4ST 2JNGA 1N8RU 4M7AF 2P0PA 4IUVA 1YI2T 1KHIA 4OB3B 4C92C 3A8MB 2QA4A 1RL2A 5LJ5g 4R55A 1M90U 2X4YA 4P5NA 1BIBA 2XICA 1G3TA 3OB9A 1WGSA 2EAYA 2L8DA 3EFSA 5D6XA 3JCMf 2LTOA 4EMGA 3QBYA 2RA2A 4M75D 5DY9A 1OYXA 3SD4A 1NZ9A 4XTUA 3QPHA 2P4TA 2LT4A 4JRKA 4MZPA 1M8VA 3OYNA 4JRQA 1LJOA 4NOYA 4OGEA 2VXEA 1X01A 2C06A 3OW2A 1NJIU 3OA6A 3CMAA 5IT9E 4LDXA 3OYDA 1K8AC 4N0AC 2K5LA 4C92F 2DKGA 4BB7A 1KD1U 3RMSA 4QQ6A 1KC8C 1NE8A 3OYCA 4Y91A 3QDRB 1WPYA 4M78A 4JS5A 2E64A 4JS4A 1K9MU 5GAOp 2K2VA 4C5GA 3BW1A 2M1HA 3PMIA 2QXFA 3V7RA 1ZHIA 5LJ3d 2LRQA 5KCHA 3E1SA 3X20B 1DJ7B 5I2SA 3CCRT 3EFRA 1M1KC 4EMKC 4DOWA 5A2QE 1ZQ1A 2D6FA 4J5YA 3I55A 1VQMT 1FX7A 2ZPHB 1BIAA 5GAMe 4FU6A 4QVZA 3RIRA 4A4EA 2GFAA 4M7DD 3M59A 4X9DA 4M7AA 1IREB 1NPPA 3LLRA 5LJ5d 2F5TX 2MF2A 4WF2A 4OGCA 5LJ5h 4KT0E 1HK9A 4J6XA 2QEXT 2VUBA 3HSBA 4N4GA 3I56A 2BKDN 3HRTA 4ELZC 3CD6T 1SSFA 5GMKe 3M53A 2RJDA 2MI6A 3CCLT 2E41A 1NPRA 3OYJA 4PJOB 4LD9K 4C0ZA 3PNWC 4PJOF 1YBYA 5GANg 1EIFA 4M7AE 1VQ5A 2K4YA 3CC4A 4XTZA 3OSVA 4C8QE 4HA8A 4C8QB 3LGFA 1N8RC 2RJCA 4HT9A 1KHCA 1VQPT 3MCAB 5LJ3h 3KUFA 3JB9J 2RHZA 3CCRA 2DD4A 1UEBA 1UGSB 2CZ1B 4LDWA 3M54A 1VQ5T 1VQ7T 1KQ2A 4PJOC 1I8FA 2YLBA 1Q86C 4C0DC 3L2ZA 4JLGA 2E10A 2E6ZA 2E12A 2QQSA 4RCBA 4C5HA 2LQ8A 2R5MA 3CCJT 3TU4K 4BD3A 4RG2A 3VUZA 4JRPA 4M77E 2MWOA 1JRIA 4IUUA 2YRVA 4OP0A 4E7HA 3HKSA 4Z02A 4BE2A 5GAMf 4C5EA 3HRUA 3DKMA 4DOVA 3NTKA 5LL6S 2PVOB 3P8DA 4OF1A 2MWPA 3UPUA 3N5BB 5CCAA 3CPWS 2PVDB 2EKOA 3HHTB 2RK1A 2ZPBB 4XU3A 4DQ2A 3PTAA 1N9RA 3V7SA 2DXUA 2QQ9A 3PIOA 4J6WA 4M78F 4XTXA 4EMHA 3M4YA 5CQYA 3UT1A 3CPWA 1U8RA 4F7UF 4C92E 1H641 1PSFA 2HD0A 2RB6A 4C92B 2QA4T 3JCMJ 2LCLA 3QJYA 5GAN8 3OQ5A 4BY6B 5J26A 3QZ5B 4L59A 1G3WA 3WXMB 4M78D 3F70A 4M75F 4NS5A 1UGRB 5CK9A 2XDBA 2XDPA 5GMKi 4XTYA 3A5ZB 3DB3A 3X26B 2EIFA 2QEXA 4N4HA 3Q1JA 4EDUA 2XD0A 2EWNA 4F7UA 4JRIA 3C94A 4D6WA 1VQKT 4F7UE 1X75C 2A7YA 3M57A 1Y71A 4OMFB 5GAOl 3RKYA 1H3ZA 2JUFA 1XNIA 4RG8A 3V8KA 2XI9A 5CKDA 4M75G 3E9FA 3SFMA 3V8LA 4PJOE 1Q81U 4IUQA 1YI2A 2HQEA 3QJ6A 4M7AB 4QVCA 2RHUA 2XDDA 1VQLT 3FB9A 1QP3A 3JB9D 3JCMc 2OTLT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OZ3 A;  3PFS A;  4IUT A;  5KH6 A;  3P8H A;  4A4H A;  4C5G A;  3OYI A;  2M1H A;  3PMI A;  4IUP A;  3L2U A;  5FRN A;  2LRQ A;  5KCH A;  2L3R A;  4ZTF A;  2E5Q A;  4FL6 A;  5C6S A;  2XK0 A;  3OYH A;  5FRM A;  2L89 A;  5KE3 A;  4A4F A;  3FLG A;  2HQX A;  4HCZ A;  2RHI A;  2RJE A;  3E9G A;  3OYB A;  2NLU A;  4FU6 A;  3MEA A;  3OS0 A;  2P0K A;  4QVZ A;  4A4E A;  2GFA A;  4N4I A;  2EQJ A;  3S3M A;  2BIV A;  1RI0 A;  1OZ2 A;  2X4X A;  3LLR A;  2R58 A;  3LH0 A;  3ZEH A;  4B9X A;  4E7I A;  3CEY A;  3MP1 A;  3S3N A;  2E6N A;  4II1 A;  3L2W A;  2LVM A;  2IG0 A;  3S6W A;  4N4G A;  4OVA A;  2GF7 A;  2BKD N;  2M0O A;  4A4G A;  1SSF A;  2GFU A;  3OYF A;  1WJS A;  3MEV A;  3BDL A;  3OYG A;  2JTF A;  2RJD A;  3L2Q A;  2RI3 A;  3DLM A;  3ME9 A;  5IAY A;  3FEO A;  3OYJ A;  3O8V A;  3PNW C;  5KE2 A;  2R5A A;  4BE0 A;  3OYA A;  3L2R A;  3OMG A;  2F5K A;  3MO8 A;  3LGF A;  3FC3 A;  2RJC A;  1G5V A;  1OI1 A;  4GY5 A;  1KHC A;  3DB4 A;  2VYT A;  2D9T A;  3KUF A;  4PLL A;  3QKJ A;  2EFI A;  2RHZ A;  3MEU A;  3ASK A;  4X34 A;  3H8Z A;  3OYL A;  2RHX A;  2B8A A;  2FHD A;  3LGL A;  4UC4 A;  4BE1 A;  2K3X A;  3OMC A;  5C0M A;  2CKK A;  2JZ2 A;  3C4S A;  2M16 A;  2R57 A;  2QQS A;  4C5H A;  2RO0 A;  2R5M A;  3EAE A;  4BAC A;  4BD3 A;  4RG2 A;  3NTH A;  4PL6 A;  2MWO A;  4CRI A;  3OY9 A;  4IUU A;  2YRV A;  2BUD A;  2RI5 A;  2WAC A;  4E7H A;  2RHY A;  2K3Y A;  4Z02 A;  4BE2 A;  3MP6 A;  4C5E A;  3NTK A;  3P8D A;  5D6W A;  3OS2 A;  2MWP A;  4LD6 A;  1MHN A;  5J39 A;  3QII A;  2EQU A;  3OYM A;  4BDZ A;  3MEW A;  2EKO A;  3MP8 A;  4QQG A;  3L42 A;  4E7L A;  2DIQ A;  5D6Y A;  5M9O A;  4E7K A;  3MET A;  4C5I A;  2DIG A;  2X4W A;  2EQM A;  2RI2 A;  2O4X A;  5CIU A;  3UT1 A;  2RJF A;  3LX7 A;  2LDM A;  5IN1 A;  4BDY A;  1N27 A;  2QQR A;  3NTI A;  3M9Q A;  5KCO A;  4IUV A;  4B9W A;  2PQW A;  3H6Z A;  3OQ5 A;  5J26 A;  4L59 A;  4NS5 A;  3F70 A;  2XDP A;  3S3O A;  3L2V A;  2X4Y A;  3DB3 A;  4Q5W A;  4N4H A;  2LCC A;  3Q1J A;  2EQK A;  5FRO A;  4EDU A;  3OB9 A;  4IKF A;  1WGS A;  2L8D A;  3PMT A;  5D6X A;  2LTO A;  3FDR A;  3QBY A;  4QW2 A;  1OYX A;  3SD4 A;  3OS1 A;  2G3R A;  3OYN A;  1H3Z A;  4E7J A;  1XNI A;  3GOX A;  3OA6 A;  4QQD A;  3OYE A;  2X35 A;  3E9F A;  3OYD A;  1WJR A;  4IUQ A;  4PLI A;  3LYI A;  4ZTJ A;  2HQE A;  2DAQ A;  1WJQ A;  3QJ6 A;  4IUR A;  3OYK A;  2RHU A;  4QQ6 A;  3OYC A;  3UWN A;  2O4X B; 
#chains in the Genus database with same CATH topology
 3QSU A;  4IUT A;  3G1J A;  5GAN 2;  1QW1 A;  4JZ3 A;  1UHC A;  2O01 E;  1BI0 A;  2PVG B;  4M75 B;  4XU0 A;  1HD3 A;  2H8H A;  5KYX B;  2B86 A;  2JM8 A;  1WXU A;  4ORZ A;  2IVW A;  1PSE A;  1VQN A;  1ZX6 A;  4M77 G;  5GAN 6;  5IXB A;  2EBP A;  2JT4 A;  3SWN B;  5GAM d;  3OS5 A;  2F1L A;  2EPD A;  5HCK A;  3J80 E;  3L2Q A;  2RI3 A;  1RAD B;  5LJ3 g;  2L3P A;  3LW5 E;  3JCM b;  1B07 A;  3JB9 H;  2E70 A;  5GAN j;  3X25 B;  1YIT Q;  1QVF S;  3M56 A;  4RKU E;  3VV0 A;  2COY A;  4UC4 A;  3OW2 S;  3KFV A;  1M1G A;  2ZPG B;  2ED0 A;  1G2B A;  2CT4 A;  2K3B A;  3VS7 A;  1JB0 E;  1GBR A;  2E4H A;  1VQ4 T;  1V29 B;  4A53 A;  4XK8 E;  3L1A A;  4M77 C;  4M75 A;  3J81 E;  2DVE A;  3KBG A;  4C0D B;  2EJF A;  4JJN K;  1UGV A;  1QVP A;  4J6Y A;  1ZBJ A;  5A0D A;  1K73 C;  1VQL Q;  2A28 A;  2FO0 A;  3FJ5 A;  4M7D E;  2OTJ T;  4DBF A;  2CSI A;  5EC7 A;  1QLY A;  3CMA T;  2I2L A;  2PQW A;  3H6Z A;  1YJ9 T;  2KT8 A;  5LJ5 e;  4AG2 C;  1X2Q A;  1KFZ A;  1O9S A;  3L2V A;  4Q5W A;  3V7C A;  1IGQ A;  3C95 A;  3I56 Q;  3JSC A;  5CKB A;  2YUN A;  4MMK A;  3CPF A;  4XTW A;  2YDL A;  4J7I A;  2DRM A;  3CCE T;  2X35 A;  1JBM A;  4C92 G;  2WSF E;  1BI3 A;  5GAO q;  3GNG A;  3CXC P;  3L2U A;  3TSZ A;  1I81 A;  1PHT A;  1W1F A;  4C8Q F;  2RM4 A;  3OYB A;  2NLU A;  1VQ8 T;  2P0K A;  2HSP A;  5AYF A;  2RMO A;  5FU6 C;  1WX6 A;  1RI0 A;  3CCS T;  1OZ2 A;  1KD1 R;  2GTO A;  5CR2 A;  3I9Q A;  1R8O B;  1XTD A;  2NUP A;  4BY6 C;  5GMK l;  2KI7 A;  3BDL A;  1MMG A;  2JM9 A;  4ZN3 A;  3VRZ A;  3GP8 A;  3OBW A;  3OW2 P;  1YP5 A;  3RKX A;  3H8Z A;  2K3X A;  3JCM V;  3OMC A;  2V8K A;  4PJN A;  3JCM X;  4M7D A;  5J3B A;  4BAC A;  1ZSZ A;  2FZC B;  1WNL A;  5GAN 5;  2LNV A;  3BFM A;  1AWO A;  2RHY A;  4FSS A;  1W4S A;  1T3L A;  2FVU A;  4F14 A;  3CME T;  2EGA A;  2KQW A;  1D3B B;  4JUV A;  5KYN A;  3RES A;  5A0L A;  2YSQ A;  1VQ7 Q;  2RH2 A;  2L5Q A;  4PK4 A;  4EIK A;  4C0F A;  4HT8 A;  3JCM d;  1YN8 A;  2KMT A;  3I35 A;  2SRC A;  2ENM A;  2EYX A;  2CP0 A;  1KIK A;  2X51 A;  3QYG B;  2KXD A;  2ZPE B;  1TWB A;  2OTL Q;  3M4G A;  4QW2 A;  2DE0 X;  1ABO A;  2EJG A;  1WI7 A;  2LQN A;  5FU7 B;  5LJ3 f;  3CCV Q;  2HAX A;  3G6E T;  1XQH A;  3G6E A;  4RTV A;  2O4X B;  1GCP A;  3RUX A;  1ZLM A;  4IUP A;  1ZUU A;  1RUW A;  3C0C A;  3JCM e;  2C0I A;  2L3R A;  5GAM h;  5FRM A;  3QHS A;  5KE3 A;  1AZE A;  3SB2 A;  2X3W D;  2F2X A;  2NWM A;  2R58 A;  4MDX A;  2AIR B;  1NJI C;  4M7D F;  1AD5 A;  1QKX A;  1RAC B;  3LWH A;  1QVF A;  1P92 A;  2R5A A;  4F7U B;  2F5K A;  3MO8 A;  2W0Z A;  3JV3 A;  2EKH A;  4R56 A;  1MUZ A;  3DB4 A;  2VYT A;  4BDZ A;  1YJW Q;  5CO7 A;  2B8A A;  4BE1 A;  2DXB A;  2M0Y A;  1N9S A;  1Q81 R;  2JZ2 A;  2KYM A;  2R57 A;  3GIB A;  1N6A A;  3EH2 A;  2JXB A;  1K73 U;  2RI5 A;  2Z0W A;  5GAN h;  2JOY A;  3OS2 A;  2LC4 A;  1NJI R;  2FPD A;  3MEW A;  1I5L A;  1EX4 A;  1OU9 A;  4RCC A;  5GAM g;  4E7K A;  3MET A;  2O2O A;  1BBZ A;  1YHQ T;  4HCK A;  2O4X A;  3LX7 A;  4OB2 B;  3G4S T;  1M90 R;  1GL5 A;  4M7A F;  4IUV A;  1GFC A;  2QA4 A;  5IHN A;  1MV3 A;  1BIB A;  1QVG P;  1WGS A;  2K6D A;  4EMG A;  2LTO A;  1VQ5 A;  3QBY A;  2RA2 A;  1OYX A;  3H0I A;  1NZ9 A;  2DMO A;  4FW1 A;  2P4T A;  1M8V A;  1LJO A;  4OGE A;  3OA6 A;  2KRO A;  1IHW A;  3OYD A;  1K8A C;  4N0A C;  4C92 F;  1QQJ A;  1GRI A;  1NE8 A;  3OYC A;  4Y91 A;  3QDR B;  2E64 A;  4ANJ A;  3MPU B;  2O9V A;  2K2V A;  4PJM A;  1ZHI A;  3H9N A;  1D0X A;  2QGG A;  4J9E A;  1V76 A;  1M1K C;  4J5Y A;  3I55 A;  1K9A A;  5GAM e;  4AFZ C;  3CCM Q;  4M7D D;  3M59 A;  3R6N A;  3LLR A;  4OGC A;  1AZG B;  1TSF A;  4N4G A;  3UF4 A;  2BKD N;  1OUL A;  3HRT A;  3M53 A;  4RUG A;  2RJD A;  4PJO B;  1EIF A;  4M7A E;  1KC8 R;  1ABQ A;  2JW4 A;  2GTJ A;  5AT1 B;  3LGF A;  1N8R C;  1KSW A;  3MCA B;  3JB9 J;  3I5R A;  1UEB A;  4PJO C;  1VQ7 T;  1Q86 C;  4JLG A;  1D09 B;  2E12 A;  4C5H A;  3VS5 A;  4RG2 A;  2MWO A;  4CC4 B;  2YRV A;  1IHV A;  4BE2 A;  3HRU A;  3NTK A;  5LL6 S;  2PVO B;  3UPU A;  5CCA A;  3CPW S;  2EKO A;  4DQ2 A;  2DXU A;  3PIO A;  4J6W A;  1RAF B;  1H64 1;  2RB6 A;  4C92 B;  1Q95 G;  3LH5 A;  1WXB A;  4EDU A;  2LP5 A;  4F7U A;  1U5S A;  1VYU A;  1JU5 C;  4WTO B;  1Y71 A;  2JUF A;  3V8K A;  2XI9 A;  4IUQ A;  1YI2 A;  3QJ6 A;  4QVC A;  1VQL T;  3JCM c;  2OTL T;  1OZ3 A;  1QP2 A;  1KK7 A;  1VQP A;  4O6J A;  2QGF B;  2BZ8 A;  1TG0 A;  2E5Q A;  3EG9 A;  2QI2 A;  5C6S A;  5I11 A;  2EYW A;  4QVD A;  1QVF P;  4M7A G;  3EGD B;  1R77 A;  2AT1 B;  3BY7 A;  2GNC A;  2DJZ A;  4M78 C;  4E7Z A;  1QWE A;  2ZPI B;  1SF9 A;  4OVA A;  3DLL A;  1OPL A;  2FEI A;  2QTX A;  3DLM A;  3ME9 A;  1ZSZ C;  4XAX B;  2J06 A;  1Q7Y R;  2DRK A;  4C0G A;  3JCM P;  3M0Q A;  2DZC A;  2CRE A;  3CCJ Q;  1JJ2 A;  1OI1 A;  4GY5 A;  2XG8 D;  3MEU A;  3ASK A;  2CKK A;  3C4S A;  1BI1 A;  1M27 C;  2VV5 A;  3CCU A;  4XU2 A;  3NTH A;  3QG1 A;  1VIF A;  2RD1 A;  3CCU T;  2V1Q A;  1I0C A;  5HK0 A;  5GAN 4;  4PJO D;  3EH1 A;  5DLQ E;  3OYY A;  1BYM A;  2J6F A;  2QQA A;  2CDT A;  3QII A;  3CC7 A;  2BE9 B;  2DIQ A;  4TVR A;  3HFO A;  1C6V X;  4L6V 5;  4B6M A;  1N27 A;  3NTI A;  4ZGD B;  3M9Q A;  3CCM A;  5GAO m;  2EQK A;  3M5A A;  1UG1 A;  2ED1 A;  1VQ9 Q;  4F04 B;  2DM1 A;  1Y07 A;  3RNJ A;  2MAM A;  2E65 A;  4VUB A;  1YCS B;  1ZUK A;  4PLI A;  1AEY A;  4RTX A;  4IUR A;  1B34 A;  3SEM A;  4EMK A;  1QVG S;  3UWN A;  4FYY B;  4M78 G;  1NLP C;  5D7U A;  4V2S A;  3G71 Q;  2YRD A;  1TU0 B;  2Y90 A;  2FYK A;  5GJW B;  1H3H A;  2A0F B;  4O5V A;  5GAN f;  2QDY B;  1K8A U;  1CKB A;  3R6O A;  2VGM A;  2GBQ A;  3FLG A;  2HQX A;  4HCZ A;  1Y96 B;  4RTW A;  1A0N B;  2BZX A;  4MDW A;  1WHH A;  1B34 B;  2DD5 A;  2K9G A;  4B9X A;  1M1K U;  1BKB A;  4NL2 A;  3L2W A;  1OPK A;  4QT7 A;  1M4Z A;  2QK0 A;  1VQO Q;  3GBQ A;  5GAN 3;  2LX7 A;  2FZG B;  2QG9 B;  2FRY A;  1Y0M A;  3FEO A;  4PJO A;  3CCL Q;  4OB1 B;  3AT1 B;  2ZAE A;  1VA7 A;  2DTI A;  3H41 A;  3OMG A;  3FC3 A;  3A8O B;  3TEE A;  4M7D G;  1YIT A;  1VOM A;  4PLL A;  1UE9 A;  2RHX A;  3H0H A;  2CP2 A;  3GLX A;  3LGL A;  2FL7 A;  2QYZ A;  1YIT T;  2KNB B;  2GQV A;  1BB9 A;  2DL4 A;  1BCO A;  1NYF A;  4J8O A;  5FWC A;  4M7A D;  1D3B A;  2A3L A;  1OOT A;  1VQO A;  4ZN1 A;  3ZBD A;  1QCO A;  1U1T A;  1WQW A;  1YJN A;  2CUD A;  2A08 A;  2EQU A;  2ROT A;  3OYM A;  2FPE A;  3MP8 A;  1B3Q A;  1UGQ B;  2LT1 A;  2F2W A;  8ATC B;  1W2B S;  1HJD A;  3KXT A;  4M78 E;  2YWW A;  4Z89 A;  1VQ8 A;  4N0A A;  5LJ5 j;  2HZY A;  5KCO A;  3G4S A;  4XTV A;  2ZPF B;  4M4Z A;  4JDS A;  1QWF A;  3THK A;  1AVZ C;  4E7J A;  1Q82 C;  5GJV B;  1VQ6 T;  3TRE A;  3UAT A;  1S72 T;  1WJQ A;  5LJ3 e;  3VRY A;  1SHG A;  4ELY C;  2DYI A;  5KH6 A;  2RF0 A;  2RPN A;  1GCQ A;  2DZ9 A;  2MCN A;  3VS0 A;  3A1P A;  4J9C A;  2EYQ A;  2BE7 D;  4F7U G;  3CME A;  1ZSZ B;  4OML A;  5FW9 A;  2HL5 C;  3HP9 A;  2M9U A;  4MZM A;  3S3N A;  2JTM A;  1WLP B;  2P84 A;  1KQS A;  2GF7 A;  2XMF A;  1X69 A;  1KD1 C;  3CCL A;  3CCV A;  2J7I A;  2VB6 A;  2AZV A;  2D0N A;  3FIF A;  1G5V A;  4OMP A;  5GAO r;  1V1C A;  5FU7 C;  2CT3 A;  2BTT A;  2ECZ A;  2JS0 A;  2DET A;  2RQU A;  2CS7 A;  5IXF A;  1U3O A;  1T0H A;  3E19 A;  4LXC A;  3CXC S;  4JJD A;  2DTO A;  1M2O A;  2D1X A;  2E3H A;  3G71 A;  3JB9 I;  2CH4 W;  3A98 A;  1M2V A;  3NHN A;  2BZY A;  4LE9 A;  3CME Q;  4E47 A;  2VC8 A;  4JLI A;  3VU3 C;  5KYW B;  5KYU A;  1VQN Q;  1VQ4 A;  4BDY A;  2LDM A;  3EHR A;  3ZL7 C;  1MV0 B;  1K8A R;  1K76 A;  1RL2 A;  1FYN A;  1M90 U;  4P5N A;  3OB9 A;  5D6X A;  4DBR A;  2LT4 A;  2ABL A;  1JJ2 P;  3OW2 A;  1NJI U;  3CMA A;  5IT9 E;  4KGX B;  4LDX A;  4QQ6 A;  1VQ4 Q;  1WPY A;  1K9M U;  5GAO p;  1WHM A;  3BW1 A;  2M1H A;  1VYT A;  1M8M A;  5KCH A;  4OMQ A;  2YUP A;  5I2S A;  4EMK C;  3CC4 Q;  3TVT A;  4DOW A;  2PZ1 A;  1RLQ C;  1RI9 A;  1UJ0 A;  4AFQ C;  1RAA B;  5LJ5 d;  2F5T X;  5LJ5 h;  2QEX T;  4ELZ C;  1SSF A;  5GMK e;  2QTV A;  4K11 A;  5IH2 A;  1NPR A;  4CC7 A;  1C1A A;  4PJO F;  3EGX B;  1YBY A;  1WIE A;  2E3I A;  2K4Y A;  3CC4 A;  3OSV A;  4HA8 A;  4C8Q B;  2RJC A;  5LJ3 h;  2DD4 A;  1VQ5 T;  2CZ1 B;  4E6R A;  2LQW A;  4C0D C;  2E6Z A;  1AWW A;  2JMC A;  3CCJ T;  3TU4 K;  4BD3 A;  2NUZ A;  3RR6 A;  4Z02 A;  4C5E A;  2VVK A;  3P8D A;  4OF1 A;  4FYX B;  2PVD B;  1QCN A;  3HHT B;  1ZA1 B;  4XU3 A;  1YFN A;  1LVK A;  3CCQ Q;  4JJB A;  2QQ9 A;  1ACM B;  1JQQ A;  4XTX A;  2GGR A;  3M4Y A;  2KT1 A;  1TOV A;  1UUE A;  4F7U F;  4C92 E;  3QJY A;  1WFW A;  5GAN 8;  4BY6 B;  5J26 A;  3QZ5 B;  2QA4 Q;  1G3W A;  1VQM A;  4M78 D;  4NS5 A;  5CK9 A;  1X27 A;  2XDP A;  5GMK i;  4XTY A;  4AT1 B;  2XD0 A;  2O31 A;  1IGU A;  1VQK T;  1X75 C;  2A7Y A;  1EFN A;  2HDA A;  4OMF B;  2A36 A;  1XNI A;  4PJJ A;  4RG8 A;  3V8L A;  2DER A;  2HQE A;  2RHU A;  2XDD A;  2LJ3 A;  1Y57 A;  2NUT B;  2ZGW A;  1YJN T;  5GAN d;  4J9G A;  4ZGJ B;  2OTJ Q;  1NLO C;  3REB B;  2JVV A;  4ZTF A;  1CSK A;  4XU1 A;  1OEB A;  1ARK A;  2PNI A;  4DEX A;  3URG A;  4DBH A;  1W2B P;  3CC2 Q;  4A54 A;  1Z9Q A;  3D7S B;  3OBY A;  1W2B A;  2AKL A;  2L0A A;  3J7A F;  2KR3 A;  3A8L B;  4KUI A;  1PCX A;  3CPW P;  4M78 B;  4E7I A;  3CEY A;  2E6N A;  3QWY A;  2XKO C;  1VQ9 T;  1X6B A;  2JTF A;  3JB9 G;  1HYO A;  5IAY A;  7AT1 B;  2KGT A;  1JXO A;  5EG2 A;  4NL3 A;  3PT9 A;  4BE0 A;  2OTL A;  3OYA A;  2DEQ A;  2DNU A;  1GXI E;  3CC2 A;  4M77 B;  2D9T A;  3OYL A;  1X6G A;  3UA7 A;  1WHK A;  2FHD A;  5HY6 A;  3CXC A;  2A37 A;  2DVJ A;  1S1N A;  2CZ7 B;  5C0M A;  1X2K A;  5I22 A;  1IZ6 A;  1SHF A;  2YLC A;  4X9C A;  3RMQ A;  2BUD A;  3EGD A;  4LDY A;  1Z9Z A;  2K5F A;  1VQO T;  2DTH A;  3O5Z A;  2KAF A;  1AOJ A;  1WHJ A;  4Y28 E;  2HMA A;  1Q86 R;  2EQM A;  1RAI B;  2D0Q B;  1MMD A;  1LOJ A;  1KQS S;  2RJF A;  3MJX A;  1YJ9 Q;  5HK3 A;  4RTU A;  5GAN 7;  2KDS A;  3EFO A;  2WSE E;  2KYB A;  3S3O A;  2C0O A;  1WQ7 A;  3G71 T;  1TXQ A;  5GMK j;  3PMT A;  2DYB A;  2MK5 A;  1SPK A;  1WA7 A;  2G3R A;  1TUG B;  5IHK A;  2ESW A;  3GOX A;  2E5K A;  4IIO A;  1M90 C;  1IRX A;  1WJR A;  2X9H A;  2KVQ G;  3LYI A;  4ZTJ A;  4LDV A;  3OYK A;  2MPX C;  3CC7 T;  5GMK m;  3P8H A;  2H3E B;  4OMO A;  3PIP A;  5FRN A;  1UTI A;  1ZSG A;  2XK0 A;  1PG5 B;  4M7A C;  2L89 A;  1YJW A;  1UHF A;  2IIM A;  3QDF A;  1YI2 Q;  2DL5 A;  4BUG A;  3CQT A;  4FM4 B;  2YHT A;  3WVE B;  3S3M A;  3H0F A;  3JCM g;  2J6O A;  3NFC A;  2MYS A;  2M51 A;  1VQP Q;  2IG0 A;  1I4K 1;  2GFU A;  3VUB A;  4FYV B;  2KRN A;  3A8G B;  1K1Z A;  3REA B;  1TTH B;  3CCU Q;  5I2M A;  2NYS A;  5KE2 A;  1OV3 A;  3JCM h;  1AT1 B;  3X28 B;  2HKQ B;  3QZ9 B;  2K2M A;  1G3S A;  2LQK A;  2KY9 A;  3PGG A;  4A4K A;  3BDU A;  2DPP B;  1G3Y A;  4LNP A;  3X24 B;  4CRI A;  2WAC A;  2DXT A;  4A63 B;  4IIM A;  3QWX X;  4C8Q G;  3MP6 A;  4GLM A;  3UA6 A;  5D6W A;  1Q86 U;  4LD6 A;  5J39 A;  5CKH A;  1M3B A;  1OU8 A;  1SRM A;  5GAO n;  3TSW A;  4EPC A;  4C5I A;  2DIG A;  1PNJ A;  3T9N A;  4ME7 A;  2PUO B;  3QYH B;  4LDU A;  2QQR A;  4Z8A A;  4M77 A;  4M75 C;  2MMP A;  2GQI A;  2V8I A;  2XID A;  2AHJ B;  3VKI A;  1Q81 C;  1FMK A;  1KG1 A;  2LCC A;  3A8H B;  2ROL A;  2VGN A;  3CCS A;  1FXX A;  3OS1 A;  4DEY A;  1M5Q 1;  1NEG A;  1JJ2 S;  4QQD A;  3OYE A;  4ZNX A;  1VUB A;  3CCM T;  2DAQ A;  1YIJ T;  3RBB B;  8AT1 B;  5DM7 R;  9ATC B;  5KYX A;  1X6O A;  3OYI A;  2X4J A;  1RAB B;  3M0R A;  2O88 A;  2XU8 A;  2YRC A;  4FL6 A;  3V8J A;  1WZO A;  2VAS A;  2KRS A;  4FSX A;  3CCE A;  4A4F A;  3EG9 B;  2RJE A;  3E9G A;  1JO8 A;  1LNX A;  2KSS A;  1VQL A;  3VS4 A;  3MP1 A;  3MHX A;  2LVM A;  2HBW A;  5CKE A;  3OYF A;  1WJS A;  2C0T A;  2CYZ B;  2DX1 A;  3GF5 A;  4JZ4 A;  3L2R A;  1K9M C;  3CC4 T;  2DBM A;  1M3C A;  2D8J A;  2PU9 B;  2OJ2 A;  3PVL A;  1QKW A;  4C92 A;  2M16 A;  1SKU B;  4DBQ A;  2HL3 A;  4DA4 A;  3PE0 A;  4PL6 A;  1YCY A;  2DXC A;  2H3J A;  3MKD A;  4PKC C;  2K3Y A;  4QKU A;  1WYX A;  1Y96 A;  3ER0 A;  1W6X A;  2D8H A;  3CD6 Q;  2DIL A;  2K5I A;  1NG2 A;  3RKW A;  4X1V A;  2LX9 A;  1C0M A;  1YIJ Q;  3U23 A;  3CD6 A;  1YJW T;  3CCV T;  2LCS A;  2CSQ A;  5IN1 A;  1VQ8 Q;  2JNG A;  1YI2 T;  1N5Z A;  1KHI A;  1H92 A;  2RN8 A;  1GBQ A;  4R55 A;  1D0Y A;  2X4Y A;  4CC3 A;  2EW3 A;  1NM7 A;  1G3T A;  2L8D A;  2QDL A;  4M75 D;  5DY9 A;  1M3A A;  3ULR B;  2ATC B;  3CC7 Q;  1X01 A;  4R0K A;  4RTT A;  2DKG A;  4BB7 A;  1KD1 U;  3RMS A;  4M78 A;  4JS5 A;  2CUB A;  1ZUY A;  2QXF A;  3V7R A;  4AFS C;  1DJ7 B;  3CCR T;  1ZQ1 A;  2EYZ A;  2D6F A;  1FX7 A;  1MND A;  1R0B G;  2DL7 A;  4FU6 A;  1GFD A;  3RDV A;  4QVZ A;  3RIR A;  2GFA A;  4X9D A;  4M7A A;  1NPP A;  2MF2 A;  4WF2 A;  4J9I A;  2KRM A;  3HSB A;  3CD6 T;  1UDL A;  2E41 A;  1K0S A;  2I0N A;  1UJY A;  4C0Z A;  3PNW C;  1ZA2 B;  4XTZ A;  1B7T A;  4C8Q E;  4E7S A;  1KHC A;  1VQP T;  2KBT A;  2RHZ A;  3CCS Q;  1OX8 A;  1KQ2 A;  1UGS B;  4LDW A;  3M54 A;  2YLB A;  4KGZ B;  2DLP A;  3L2Z A;  2E10 A;  2DF6 A;  4RCB A;  4Z88 A;  1RAE B;  2R5M A;  3VUZ A;  1JRI A;  4IUU A;  4OP0 A;  2OX7 A;  3HKS A;  1LCK A;  3DKM A;  1UFF A;  1G8X A;  3N5B B;  1RAG B;  3NMZ C;  2RK1 A;  2ZPB B;  3PTA A;  4OMM A;  4M78 F;  3IQL A;  4EMH A;  3CCE Q;  3CPW A;  5CQY A;  1FMV A;  1AWX A;  2HD0 A;  3M0U A;  2HEQ A;  3VS1 A;  1D0Z A;  3WXM B;  3F70 A;  4M75 F;  2XDB A;  1UGR B;  3X26 B;  2EIF A;  2QEX A;  3Q1J A;  3M0T A;  4D6W A;  2CP5 A;  1YJN Q;  3M57 A;  5GAO l;  1H3Z A;  1PD1 A;  3CMA Q;  2RQW A;  4M75 G;  3E9F A;  1IB8 A;  3SFM A;  4PJO E;  1Q81 U;  4M7A B;  2EGC A;  4PJL A;  4A4H A;  2AK5 A;  3EG1 A;  1O75 A;  3OSS C;  1WHG A;  2DL3 A;  1M1F A;  1TUC A;  3CBM A;  2SEM A;  3I55 T;  1K9M R;  4JJC A;  4AMC A;  2OAU A;  4C92 D;  2QQB A;  4CI0 C;  4RMO A;  2J6K A;  3MEA A;  2CGH A;  4J83 A;  1UB4 A;  2EQJ A;  3HRS A;  2BIV A;  6AT1 B;  2O9S A;  1MMA A;  3ZEH A;  5CVI A;  2K79 A;  2EYY A;  1XJW B;  1I5O B;  3P8B B;  2M02 A;  4HCB A;  3MEV A;  2OAW A;  4HKE A;  3TCJ A;  2LJ0 A;  1E7O A;  2CH4 A;  3EG3 A;  1U06 A;  5CKF A;  1IO6 A;  3JB9 F;  3TQ7 P;  1E6H A;  4C8Q C;  4LN2 A;  2MOX A;  1D1A A;  1D1B A;  1MMN A;  3SWN A;  4PFO A;  5CAI A;  1K0X A;  5KYU B;  2RNA A;  3OY9 A;  1HSQ A;  4WCI A;  1PWT A;  1Q7Y C;  3AHU A;  2KK4 A;  2VKN A;  3G7Z A;  1TH7 A;  1VQ9 A;  4QQG A;  1BU1 A;  1WDX A;  2VWF A;  5L8R E;  4F16 A;  4YTL A;  5FU6 B;  2DO3 A;  4J7F A;  4L5G A;  5GAM j;  5CIU A;  5LJ5 f;  2COW A;  4J9D A;  4B9W A;  2E1H A;  1VQM Q;  4FT2 A;  2RQV A;  2GCX A;  3VYH B;  5CQX A;  1HXD A;  2PUK B;  1GCQ C;  5FLX E;  3FDR A;  1SRL A;  2HBP A;  1YWO A;  4ZGE B;  2F2V A;  2DBK A;  1RLP C;  1VQ6 A;  1I07 A;  1FWZ A;  2KEA A;  4M77 D;  3CC2 T;  1NBE B;  4D8D A;  2FB7 A;  2JMA A;  2F69 A;  1OX9 A;  2RQT A;  4BI8 B;  1KC8 U;  2JS2 A;  3NGP A;  3I5S A;  2YUQ A;  2RHI A;  4PJO G;  1Q82 R;  1WXT A;  3OS0 A;  4E2F B;  1VQN T;  2AKK A;  3JRZ A;  1Q7Y U;  2G6F X;  3QO3 A;  2X4X A;  1U1S A;  3QXE B;  4J9B A;  3LH0 A;  4Y92 A;  4KUD K;  4II1 A;  3S6W A;  3JCM W;  1IXD A;  1VQ7 A;  4OMN A;  4A4G A;  4LUE A;  2JTE A;  2DFU A;  2Y4Y A;  3OYG A;  1M9S A;  2HKN A;  5HKC A;  3VS3 A;  2DK3 A;  1OQK A;  1E6G A;  2DA9 A;  4MML A;  5LJ3 j;  1TUD A;  1BCM A;  2HQH A;  2QEX Q;  2ZZD A;  3QKJ A;  2EFI A;  1PRM C;  2YXY A;  2RK2 A;  1QVG A;  2QAS A;  1QMC A;  2RO0 A;  4XQ3 A;  4C8Q D;  4HCC A;  1UGP B;  3G4S Q;  2PTK A;  1T0J A;  2CZ0 B;  1H8K A;  2KXC A;  2X3X D;  3RER A;  3G6E Q;  1AHJ B;  1MHN A;  3FRN A;  4KBM B;  2YUO A;  4M75 E;  3CBO A;  3L42 A;  1SEM A;  2VXF A;  3M0S A;  2JN0 A;  2NUT A;  5D6Y A;  3CCR Q;  4M77 F;  1YWP A;  1VQ5 Q;  4BI3 A;  2RI2 A;  3CCJ A;  1SG5 A;  3EGU A;  1YJ9 A;  1EZZ B;  2P0Q A;  1PC0 A;  4GLK A;  1ZBX A;  3JCM Q;  5FRO A;  4HVU A;  3M0P A;  4IKF A;  2CP6 A;  4HXJ A;  2YT6 A;  1BI2 A;  5GAN e;  5DLO A;  3WVD B;  4BI4 A;  5GMK h;  3UDC A;  3EG2 A;  1Y7X A;  1YIJ A;  2DEU A;  1PM3 A;  3PFS A;  2EGE A;  1X43 A;  1YHQ Q;  3SHW A;  1NEB A;  1R0C B;  1VIE A;  4OB0 B;  1VQK A;  3PVQ A;  2HNI A;  4MZT A;  3OYH A;  3JAM E;  1LPL A;  4M7D C;  1XOV A;  1YHQ A;  1VYV A;  2ZCF B;  2FZK B;  3CCQ A;  4KUL A;  4J9F A;  3HPW A;  4F17 A;  3GPL A;  4N4I A;  3CCQ T;  2LJ1 A;  3GNF B;  2V8J A;  3LWI A;  4M7D B;  3FJP A;  2LZ6 B;  4EMK B;  4JPB W;  1TS9 A;  3CBP A;  2M0O A;  1QCF A;  4KRT A;  4C8Q A;  4ESR A;  3M58 A;  4FCY A;  5FWB A;  3O8V A;  3HFN A;  5KYY A;  1JXM A;  3VJP A;  3SWN C;  2WSC E;  4X34 A;  2CZ6 B;  2CP3 A;  5A0G A;  2K57 A;  2XHC A;  3VYG A;  4ATO A;  1KQ1 A;  3M55 A;  2LNH B;  2EJ9 A;  3EAE A;  3QUI A;  2OTJ A;  3ZFJ A;  2L3S A;  4PNO A;  1MGQ A;  2Y4X A;  3SDZ A;  4CC2 A;  2W10 A;  1S72 A;  4FIB A;  3EG0 A;  2KE9 A;  4FT4 A;  2V1R A;  4E7L A;  1J3T A;  3HL8 A;  1KJW A;  2JJ9 A;  4KH0 B;  5I21 A;  3I56 T;  5M9O A;  1S72 Q;  3C12 A;  2J05 A;  1D1C A;  1G83 A;  2X4W A;  3INZ A;  1VQ6 Q;  4LUD A;  1N8R U;  2P0P A;  4OB3 B;  4C92 C;  3A8M B;  5LJ5 g;  5ECA A;  1T3S A;  3VS2 A;  2XIC A;  1F1B B;  4GBQ A;  2EAY A;  1KQS P;  3EFS A;  3JCM f;  3SD4 A;  4XTU A;  3QPH A;  4JRK A;  4MZP A;  4KGV B;  3OYN A;  4JRQ A;  2L3Q A;  4NOY A;  2VXE A;  2C06 A;  4FW2 A;  4KH1 B;  2K5L A;  3E2U A;  1CKA A;  1KC8 C;  1PRL C;  5KYW A;  2MIO A;  4JS4 A;  2P4R A;  2AZS A;  2OI3 A;  4C5G A;  4PFP A;  2EVR A;  3PMI A;  5LJ3 d;  2LRQ A;  3E1S A;  3X20 B;  3EFR A;  2EQI A;  5A2Q E;  2HSE B;  1PKS A;  1VQM T;  2HCK A;  4HVW A;  4PFZ A;  2ZPH B;  1BIA A;  4A4E A;  3VS6 A;  1IRE B;  1K4U S;  4KT0 E;  1HK9 A;  4J6X A;  2VUB A;  1YNZ A;  3I56 A;  2CP7 A;  2MI6 A;  3CCL T;  2DL8 A;  3OYJ A;  4LD9 K;  5GAN g;  1SSH A;  3NPF A;  2FG0 A;  1M30 A;  1M1K R;  2COZ A;  1FMW A;  4HT9 A;  2NUP B;  3KUF A;  2DJQ A;  1I1J A;  3CCR A;  2FPF A;  1I8F A;  2QQS A;  2LQ8 A;  1PKT A;  4AG1 C;  4RTZ A;  4JRP A;  4M77 E;  2L2P A;  2K7A A;  4E7H A;  1M2V B;  1UEC A;  5GAM f;  4DOV A;  2MWP A;  2LMJ A;  1AWJ A;  1RAH B;  2IPO B;  1VQK Q;  4HVV A;  1N9R A;  5L23 A;  4RTY A;  3V7S A;  1N8R R;  2V26 A;  5IHI A;  3UT1 A;  1U8R A;  1JEG A;  1PSF A;  2RQR A;  3EHQ A;  2QA4 T;  3JCM J;  2LCL A;  3BE3 A;  1PD0 A;  2QAZ A;  3OQ5 A;  1Q82 U;  4L59 A;  4D8K A;  1WHL A;  1NYG A;  3A5Z B;  3I55 Q;  3DB3 A;  4N4H A;  4FYW B;  3EGX A;  1K73 R;  1W70 A;  2EWN A;  4JRI A;  3C94 A;  5KYY B;  4F7U E;  3EFO B;  3RKY A;  4J9H A;  5CKD A;  4AFU C;  3HTR A;  2FRW A;  1MNE A;  3FB9 A;  1QP3 A;  3JB9 D;  1BK2 A; 
#chains in the Genus database with same CATH homology
 1OZ3 A;  2ZGW A;  3QSU A;  1YJN T;  4IUT A;  4A4H A;  4ZGJ B;  5GAN d;  5GAN 2;  1QP2 A;  3OSS C;  1O75 A;  1QW1 A;  1VQP A;  1M1F A;  2JVV A;  4ZTF A;  4O6J A;  3CBM A;  2E5Q A;  2O01 E;  2QI2 A;  4XU1 A;  5C6S A;  3I55 T;  1BI0 A;  2PVG B;  4M75 B;  3URG A;  2OAU A;  4XU0 A;  4QVD A;  4A54 A;  4C92 D;  2QQB A;  4M7A G;  4CI0 C;  3OBY A;  1W2B A;  4RMO A;  3MEA A;  2IVW A;  2CGH A;  4J83 A;  3J7A F;  1PSE A;  1UB4 A;  2EQJ A;  3A8L B;  4KUI A;  3HRS A;  2BIV A;  3BY7 A;  4M78 B;  2DJZ A;  4M78 C;  1VQN A;  3ZEH A;  5GAN 6;  4M77 G;  5CVI A;  4E7I A;  3CEY A;  3SWN B;  2E6N A;  2ZPI B;  3P8B B;  5GAM d;  3OS5 A;  4OVA A;  3DLL A;  2XKO C;  1VQ9 T;  4HCB A;  3MEV A;  4HKE A;  3TCJ A;  3J80 E;  2JTF A;  3L2Q A;  2RI3 A;  3JB9 G;  2QTX A;  3DLM A;  3ME9 A;  5IAY A;  5LJ3 g;  4XAX B;  5EG2 A;  4NL3 A;  3PT9 A;  5CKF A;  4C0G A;  3LW5 E;  3JCM b;  4BE0 A;  2OTL A;  3OYA A;  3JB9 H;  3JB9 F;  3JCM P;  2DEQ A;  2DZC A;  1GXI E;  2E70 A;  1JJ2 A;  5GAN j;  4C8Q C;  1OI1 A;  4GY5 A;  3CC2 A;  2D9T A;  4M77 B;  2XG8 D;  3M56 A;  3MEU A;  4RKU E;  3VV0 A;  3ASK A;  3X25 B;  3OYL A;  1QVF S;  4UC4 A;  2FHD A;  5HY6 A;  3CXC A;  3OW2 S;  2CZ7 B;  1M1G A;  2ZPG B;  5C0M A;  2CKK A;  3C4S A;  3SWN A;  5CAI A;  1IZ6 A;  1BI1 A;  2VV5 A;  1JB0 E;  2YLC A;  3CCU A;  4XU2 A;  3NTH A;  4X9C A;  3RMQ A;  1VQ4 T;  3QG1 A;  2RD1 A;  1V29 B;  1VIF A;  3OY9 A;  4A53 A;  2BUD A;  4XK8 E;  3L1A A;  4M77 C;  4M75 A;  3J81 E;  5HK0 A;  3CCU T;  5GAN 4;  1Q7Y C;  4PJO D;  5DLQ E;  3OYY A;  4LDY A;  2DVE A;  2K5F A;  3KBG A;  4C0D B;  1VQO T;  3AHU A;  1BYM A;  2KK4 A;  2QQA A;  2EJF A;  4JJN K;  2DTH A;  3G7Z A;  3QII A;  1QVP A;  1TH7 A;  4J6Y A;  1VQ9 A;  3CC7 A;  2KAF A;  4QQG A;  5A0D A;  2DIQ A;  4TVR A;  5L8R E;  1K73 C;  4Y28 E;  4YTL A;  5FU6 B;  2DO3 A;  4J7F A;  2EQM A;  2D0Q B;  3HFO A;  4L5G A;  4M7D E;  4L6V 5;  5GAM j;  2OTJ T;  5CIU A;  1LOJ A;  1KQS S;  2RJF A;  5LJ5 f;  3CMA T;  1N27 A;  2I2L A;  5HK3 A;  3NTI A;  4ZGD B;  3M9Q A;  4B9W A;  2PQW A;  3H6Z A;  2E1H A;  5GAN 7;  3CCM A;  1YJ9 T;  2KDS A;  5LJ5 e;  4FT2 A;  2WSE E;  2GCX A;  3VYH B;  5GAO m;  1Q82 U;  3S3O A;  1O9S A;  3L2V A;  4Q5W A;  5CQX A;  1HXD A;  1WQ7 A;  2EQK A;  3M5A A;  3V7C A;  3G71 T;  3C95 A;  5GMK j;  3PMT A;  2PUK B;  5FLX E;  1Y07 A;  3FDR A;  3JSC A;  5CKB A;  2MAM A;  4MMK A;  2E65 A;  2HBP A;  3CPF A;  2G3R A;  4ZGE B;  4XTW A;  4VUB A;  3GOX A;  4J7I A;  3CCE T;  2X35 A;  1M90 C;  1JBM A;  4C92 G;  1WJR A;  4PLI A;  2KVQ G;  3LYI A;  4ZTJ A;  1VQ6 A;  4LDV A;  4IUR A;  3OYK A;  1B34 A;  1FWZ A;  2WSF E;  4M77 D;  1BI3 A;  4EMK A;  3CC7 T;  5GMK m;  3CC2 T;  5GAO q;  3UWN A;  1QVG S;  3GNG A;  4M78 G;  3P8H A;  2FB7 A;  4V2S A;  3PIP A;  3L2U A;  5FRN A;  2F69 A;  2Y90 A;  2FYK A;  4O5V A;  5GAN f;  1K8A U;  2QDY B;  4BI8 B;  1I81 A;  2XK0 A;  3R6O A;  4M7A C;  2L89 A;  1YJW A;  1KC8 U;  2VGM A;  3FLG A;  2HQX A;  4HCZ A;  1Y96 B;  4BUG A;  2RHI A;  4PJO G;  2RM4 A;  4C8Q F;  3OYB A;  2NLU A;  1VQ8 T;  4FM4 B;  3OS0 A;  4MDW A;  2P0K A;  2YHT A;  1VQN T;  5AYF A;  3WVE B;  3JRZ A;  5FU6 C;  3S3M A;  1Q7Y U;  3JCM g;  1RI0 A;  3CCS T;  1B34 B;  1OZ2 A;  2DD5 A;  1U1S A;  2X4X A;  3NFC A;  3QO3 A;  3LH0 A;  3QXE B;  5CR2 A;  4KUD K;  4B9X A;  1M1K U;  1BKB A;  4NL2 A;  4II1 A;  3L2W A;  2IG0 A;  1R8O B;  3S6W A;  1XTD A;  3JCM W;  1I4K 1;  1VQ7 A;  4A4G A;  1M4Z A;  2GFU A;  3VUB A;  5GAN 3;  4BY6 C;  5GMK l;  2Y4Y A;  3A8G B;  1M9S A;  3BDL A;  3OYG A;  4ZN3 A;  5HKC A;  3GP8 A;  2DK3 A;  3FEO A;  5I2M A;  4PJO A;  4OB1 B;  5KE2 A;  3OBW A;  3JCM h;  4MML A;  5LJ3 j;  3OMG A;  2DTI A;  3X28 B;  3FC3 A;  3A8O B;  3RKX A;  3TEE A;  3QZ9 B;  2ZZD A;  4M7D G;  1YIT A;  4PLL A;  1G3S A;  2LQK A;  2EFI A;  2KY9 A;  3QKJ A;  3H8Z A;  3PGG A;  2RHX A;  3LGL A;  3GLX A;  4A4K A;  2FL7 A;  1YIT T;  2K3X A;  2GQV A;  2RK2 A;  3JCM V;  1QVG A;  3OMC A;  3BDU A;  2V8K A;  2DPP B;  1G3Y A;  3JCM X;  4M7D A;  2RO0 A;  4J8O A;  4XQ3 A;  5J3B A;  4BAC A;  4C8Q D;  4HCC A;  3X24 B;  1UGP B;  4CRI A;  4M7A D;  1D3B A;  1WNL A;  5GAN 5;  2A3L A;  2CZ0 B;  2WAC A;  2DXT A;  2LNV A;  3BFM A;  3RER A;  2RHY A;  1VQO A;  4ZN1 A;  1W4S A;  2FVU A;  4C8Q G;  3MP6 A;  3ZBD A;  1AHJ B;  1U1T A;  1WQW A;  3CME T;  1YJN A;  5D6W A;  1Q86 U;  4LD6 A;  5J39 A;  1MHN A;  5CKH A;  2EQU A;  3FRN A;  4KBM B;  2KQW A;  3OYM A;  4M75 E;  3MP8 A;  1D3B B;  4JUV A;  3CBO A;  5GAO n;  3L42 A;  2VXF A;  3RES A;  5A0L A;  2JN0 A;  1UGQ B;  2LT1 A;  5D6Y A;  2RH2 A;  4M77 F;  4BI3 A;  4EPC A;  2L5Q A;  1W2B S;  4C5I A;  2DIG A;  2RI2 A;  3T9N A;  3CCJ A;  4ME7 A;  4C0F A;  3KXT A;  4HT8 A;  4M78 E;  2PUO B;  3JCM d;  3QYH B;  1YJ9 A;  4LDU A;  2QQR A;  1VQ8 A;  2P0Q A;  4N0A A;  2KMT A;  5KCO A;  4M77 A;  4M75 C;  5LJ5 j;  3G4S A;  2MMP A;  2V8I A;  4XTV A;  2XID A;  2AHJ B;  2ZPF B;  3VKI A;  4GLK A;  1Q81 C;  1ZBX A;  1KG1 A;  2LCC A;  3QYG B;  3A8H B;  5FRO A;  3JCM Q;  4JDS A;  2VGN A;  4IKF A;  2ZPE B;  3CCS A;  1FXX A;  3M4G A;  4QW2 A;  1BI2 A;  5GAN e;  3OS1 A;  5DLO A;  1M5Q 1;  2EJG A;  3WVD B;  4E7J A;  1Q82 C;  5FU7 B;  5LJ3 f;  1VQ6 T;  4BI4 A;  1JJ2 S;  4QQD A;  3TRE A;  3OYE A;  2HAX A;  3G6E T;  1VUB A;  5GMK h;  3CCM T;  1S72 T;  2DAQ A;  1WJQ A;  3UDC A;  5LJ3 e;  1YIJ T;  1XQH A;  3G6E A;  1Y7X A;  1YIJ A;  2O4X B;  4ELY C;  5DM7 R;  3PFS A;  3RUX A;  5KH6 A;  1X6O A;  3OYI A;  2X4J A;  4IUP A;  1VIE A;  4OB0 B;  3JCM e;  1VQK A;  2DZ9 A;  2L3R A;  2XU8 A;  2HNI A;  5GAM h;  4MZT A;  4FL6 A;  3V8J A;  3OYH A;  5FRM A;  3JAM E;  3QHS A;  5KE3 A;  4M7D C;  4FSX A;  1XOV A;  3CCE A;  4A4F A;  1YHQ A;  2RJE A;  2ZCF B;  3E9G A;  2EYQ A;  1LNX A;  2KSS A;  3SB2 A;  3CCQ A;  4F7U G;  1VQL A;  4KUL A;  3CME A;  3HPW A;  3GPL A;  4N4I A;  3CCQ T;  3GNF B;  3HP9 A;  2V8J A;  2M9U A;  3LWI A;  4M7D B;  2R58 A;  3FJP A;  4MDX A;  4MZM A;  4EMK B;  3MP1 A;  3MHX A;  3S3N A;  2LVM A;  2JTM A;  1KQS A;  3CBP A;  2GF7 A;  2M0O A;  5CKE A;  1NJI C;  3OYF A;  1WJS A;  4C8Q A;  4M7D F;  3LWH A;  1KD1 C;  1QVF A;  3M58 A;  1P92 A;  3CCL A;  3O8V A;  3HFN A;  3CCV A;  2R5A A;  2CYZ B;  3GF5 A;  4F7U B;  3FIF A;  3VJP A;  3SWN C;  2WSC E;  3L2R A;  2F5K A;  3MO8 A;  1K9M C;  1G5V A;  4R56 A;  3CC4 T;  3DB4 A;  5GAO r;  2VYT A;  4X34 A;  2CZ6 B;  5FU7 C;  4BDZ A;  5A0G A;  2B8A A;  2K57 A;  2PU9 B;  5CO7 A;  2XHC A;  4BE1 A;  2DXB A;  2CS7 A;  1N9S A;  4C92 A;  3VYG A;  2JZ2 A;  4ATO A;  1KQ1 A;  2M16 A;  3M55 A;  2R57 A;  4DA4 A;  3GIB A;  2EJ9 A;  1N6A A;  3EAE A;  4PL6 A;  3QUI A;  2OTJ A;  1YCY A;  3E19 A;  2DXC A;  2H3J A;  4PKC C;  3ZFJ A;  3CXC S;  1K73 U;  2RI5 A;  4PNO A;  1VQM A;  1MGQ A;  2K3Y A;  2Y4X A;  1Y96 A;  3ER0 A;  2JOY A;  3SDZ A;  5GAN h;  2DTO A;  3OS2 A;  1S72 A;  4FIB A;  2LC4 A;  2K5I A;  3MEW A;  1I5L A;  3G71 A;  3JB9 I;  3RKW A;  4FT4 A;  4E7L A;  4RCC A;  2LX9 A;  3HL8 A;  5GAM g;  5I21 A;  3I56 T;  5M9O A;  4E7K A;  3MET A;  4E47 A;  2VC8 A;  3C12 A;  4JLI A;  3VU3 C;  2X4W A;  1YJW T;  3CD6 A;  3CCV T;  1YHQ T;  3INZ A;  1VQ4 A;  2O4X A;  4BDY A;  3LX7 A;  2LDM A;  4OB2 B;  5IN1 A;  3G4S T;  2JNG A;  1N8R U;  4M7A F;  2P0P A;  4IUV A;  1YI2 T;  1KHI A;  4OB3 B;  4C92 C;  3A8M B;  2QA4 A;  1RL2 A;  5LJ5 g;  4R55 A;  1M90 U;  2X4Y A;  4P5N A;  1BIB A;  2XIC A;  1G3T A;  3OB9 A;  1WGS A;  2EAY A;  2L8D A;  3EFS A;  5D6X A;  3JCM f;  2LTO A;  4EMG A;  3QBY A;  2RA2 A;  4M75 D;  5DY9 A;  1OYX A;  3SD4 A;  1NZ9 A;  4XTU A;  3QPH A;  2P4T A;  2LT4 A;  4JRK A;  4MZP A;  1M8V A;  3OYN A;  4JRQ A;  1LJO A;  4NOY A;  4OGE A;  2VXE A;  1X01 A;  2C06 A;  3OW2 A;  1NJI U;  3OA6 A;  3CMA A;  5IT9 E;  4LDX A;  3OYD A;  1K8A C;  4N0A C;  2K5L A;  4C92 F;  2DKG A;  4BB7 A;  1KD1 U;  3RMS A;  4QQ6 A;  1KC8 C;  1NE8 A;  3OYC A;  4Y91 A;  3QDR B;  1WPY A;  4M78 A;  4JS5 A;  2E64 A;  4JS4 A;  1K9M U;  5GAO p;  2K2V A;  4C5G A;  3BW1 A;  2M1H A;  3PMI A;  2QXF A;  3V7R A;  1ZHI A;  5LJ3 d;  2LRQ A;  5KCH A;  3E1S A;  3X20 B;  1DJ7 B;  5I2S A;  3CCR T;  3EFR A;  1M1K C;  4EMK C;  4DOW A;  5A2Q E;  1ZQ1 A;  2D6F A;  4J5Y A;  3I55 A;  1VQM T;  1FX7 A;  2ZPH B;  1BIA A;  5GAM e;  4FU6 A;  4QVZ A;  3RIR A;  4A4E A;  2GFA A;  4M7D D;  3M59 A;  4X9D A;  4M7A A;  1IRE B;  1NPP A;  3LLR A;  5LJ5 d;  2F5T X;  2MF2 A;  4WF2 A;  4OGC A;  5LJ5 h;  4KT0 E;  1HK9 A;  4J6X A;  2QEX T;  2VUB A;  3HSB A;  4N4G A;  3I56 A;  2BKD N;  3HRT A;  4ELZ C;  3CD6 T;  1SSF A;  5GMK e;  3M53 A;  2RJD A;  2MI6 A;  3CCL T;  2E41 A;  1NPR A;  3OYJ A;  4PJO B;  4LD9 K;  4C0Z A;  3PNW C;  4PJO F;  1YBY A;  5GAN g;  1EIF A;  4M7A E;  1VQ5 A;  2K4Y A;  3CC4 A;  4XTZ A;  3OSV A;  4C8Q E;  4HA8 A;  4C8Q B;  3LGF A;  1N8R C;  2RJC A;  4HT9 A;  1KHC A;  1VQP T;  3MCA B;  5LJ3 h;  3KUF A;  3JB9 J;  2RHZ A;  3CCR A;  2DD4 A;  1UEB A;  1UGS B;  2CZ1 B;  4LDW A;  3M54 A;  1VQ5 T;  1VQ7 T;  1KQ2 A;  4PJO C;  1I8F A;  2YLB A;  1Q86 C;  4C0D C;  3L2Z A;  4JLG A;  2E10 A;  2E6Z A;  2E12 A;  2QQS A;  4RCB A;  4C5H A;  2LQ8 A;  2R5M A;  3CCJ T;  3TU4 K;  4BD3 A;  4RG2 A;  3VUZ A;  4JRP A;  4M77 E;  2MWO A;  1JRI A;  4IUU A;  2YRV A;  4OP0 A;  4E7H A;  3HKS A;  4Z02 A;  4BE2 A;  5GAM f;  4C5E A;  3HRU A;  3DKM A;  4DOV A;  3NTK A;  5LL6 S;  2PVO B;  3P8D A;  4OF1 A;  2MWP A;  3UPU A;  3N5B B;  5CCA A;  3CPW S;  2PVD B;  2EKO A;  3HHT B;  2RK1 A;  2ZPB B;  4XU3 A;  4DQ2 A;  3PTA A;  1N9R A;  3V7S A;  2DXU A;  2QQ9 A;  3PIO A;  4J6W A;  4M78 F;  4XTX A;  4EMH A;  3M4Y A;  5CQY A;  3UT1 A;  3CPW A;  1U8R A;  4F7U F;  4C92 E;  1H64 1;  1PSF A;  2HD0 A;  2RB6 A;  4C92 B;  2QA4 T;  3JCM J;  2LCL A;  3QJY A;  5GAN 8;  3OQ5 A;  4BY6 B;  5J26 A;  3QZ5 B;  4L59 A;  1G3W A;  3WXM B;  4M78 D;  3F70 A;  4M75 F;  4NS5 A;  1UGR B;  5CK9 A;  2XDB A;  2XDP A;  5GMK i;  4XTY A;  3A5Z B;  3DB3 A;  3X26 B;  2EIF A;  2QEX A;  4N4H A;  3Q1J A;  4EDU A;  2XD0 A;  2EWN A;  4F7U A;  4JRI A;  3C94 A;  4D6W A;  1VQK T;  4F7U E;  1X75 C;  2A7Y A;  3M57 A;  1Y71 A;  4OMF B;  5GAO l;  3RKY A;  1H3Z A;  2JUF A;  1XNI A;  4RG8 A;  3V8K A;  2XI9 A;  5CKD A;  4M75 G;  3E9F A;  3SFM A;  3V8L A;  4PJO E;  1Q81 U;  4IUQ A;  1YI2 A;  2HQE A;  3QJ6 A;  4M7A B;  4QVC A;  2RHU A;  2XDD A;  1VQL T;  3FB9 A;  1QP3 A;  3JB9 D;  3JCM c;  2OTL T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...