2LULA

Solution nmr structure of ph domain of tyrosine-protein kinase tec from homo sapiens, northeast structural genomics consortium (nesg) target hr3504c
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
164
structure length
164
Chain Sequence
b'MGHHHHHHSHMNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase Tec
publication title Solution NMR Structure of PH Domain of Tyrosine-protein kinase Tec from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR3504C
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 31
structure length 164
sequence length 164
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00779 BTK BTK motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2lulA00
2VKIA 1WGQA 2J0JA 3BJIA 2LOXA 4L6EA 5D27A 2FJLA 4HATB 5C5BB 4K2PA 3WA0A 4Y94A 5DHAB 2HE7A 1Q67A 5DIFB 5DI9B 2LOZA 5C6RA 4F7HA 3ULCA 1FGYA 3M1IB 2RLOA 4EJNA 1J0WA 1FHOA 5D3XA 4EKUA 1BTKA 1U5GA 4A6FB 2K2JA 5CLQB 2D9ZA 1X1FA 4WSFA 5KCVA 1QQGA 3KY9A 1NU2A 1XODA 3U7DA 2D9WA 1MIXA 1V88A 4KHBB 4P7IA 1U27A 1N3HA 4EMOA 3ODWA 2KCJA 3D8FA 1PFJA 2W2XC 5L81A 3TO1A 3PVUA 2M14A 4KHAA 2DKPA 1PLSA 3CXBB 3NSUA 1W1HA 2OQBA 5JLJB 2RUKB 2Y7BA 1XR0B 5JHHA 1V5UA 2Z0PA 3A8QA 1WI1A 2Y8GA 1DDMA 4WJ7A 3D8EA 2MWNB 3TFMA 5KQ1A 4IFSA 1X11A 4HDQA 4IOYX 4GZUA 5FI1A 2YF0A 4KVGB 2GS0A 3U8ZA 2UZRA 4HAVB 3ZDTA 3KZ1A 2EMSA 2YS3A 2YS1A 2RVBB 3PSCA 4DBBA 2NMBA 2P0HA 3AU4A 1UEFA 2D10A 2DLWA 5DHFB 4GPTB 4A5KA 2CY5A 1U29A 2Q13A 2UVMA 2DTCA 3VIAA 4A6HA 5C5BA 2D9VA 2LG1A 4CHJA 1XD4A 2J0MA 3T06A 1WJMA 1UPQA 3UZTA 1U5DA 4B6HA 1MIZB 1K5GB 4HB4B 2J0KA 2W2XD 2P8VA 1XX0A 2W2WA 1X1GA 4CHMA 2COFA 2P0FA 4A6FA 4XWXA 1NTVA 1WGUA 1KZ7A 1DBHA 5HE0A 1QC6A 4Z2NA 4CYEA 4MK0A 4IAPA 5HE2A 3GYPA 2K2UA 1EVHA 3KRWA 2BCJA 1LB1A 4K17A 2J59M 2DX5A 3BINA 2R0DA 2D2QA 2GJYA 3AU5A 3X23A 2RGNB 3MPXA 1K5DB 1EGXA 1V61A 3TVVA 2ROVA 4HAWB 4A6KA 2DFKA 4KHOA 1I7AA 1U5EA 1OMWA 1UNQA 1UNPA 1Y5OA 2LULA 2D11A 4ZRJA 2QKLA 1ZC3B 1OQNA 3PEGA 3PVLA 1AWEA 4MT7A 3PVWA 2DYQA 3AJ4A 3SO6A 2HTHB 1MAIA 2DHKA 4HAUB 5D3YA 4HB2B 2RSGA 3QWMA 3ODXA 3TCAA 4YONA 1FHXA 3HQCA 1BAKA 1DYNA 1MK9B 4NSWA 1EAZA 1GC6A 1M7EA 3FM8C 2IFSA 2AL6A 4F7UP 5JHGA 3ULBA 4DX8A 1B55A 3MDBC 2CRFA 1LW3A 2DHIA 1J19A 1ZM0A 2KGXB 1V89A 3KRXA 2COCA 3SV1A 2R09A 2D4QA 1UNRA 4GMXB 1U2BA 4KAXB 5CLLB 1GC7A 1EF1A 2Z0QA 1BWNA 4DXAB 3N7CA 2CAYA 1FHWA 4NY0A 4HB3B 4Z2MB 2VSZA 3A8PA 5GOWB 1IRSA 1RJ2A 3TW1A 4GXBA 2PZ1A 3O96A 1P6SA 4HAYB 2I5FA 5D3WA 3FSSA 4K2OA 2ELAA 3FEHA 1TQZA 2MFQA 4BBKA 1V5MA 3DXCA 1W1DA 3GYOA 5HE1A 1KZGA 4HAXB 1SHCA 2ADZA 1MKEA 3V5WA 3SUZA 2I5CA 2CODA 3DXDA 1I2HA 4ZRIA 1Z87A 2H7DA 2UZSA 5LONB 1WJ1A 1H4RA 3IVFA 3SYXA 1KI1B 2YS5A 1XCGA 2D9YA 4PNKA 1W1GA 1NI2A 1ZSQA 2V76A 1DDVA 2DYNA 2G35A 3PG7A 3KSYA 2YT0A 4WVFB 4GMVA 5DH9B 2I1KA 2KUPA 2QKMA 1P3RA 2N0YA 3CIKA 1V5PA 5EFXA 3DXEA 1SGHA 1ISNA 2AEHA 1UPRA 1FGZA 1ZC4B 2H7EA 3G9WA 1Y19B 2LYDA 2GCLA 2DA0A 1U5FA 3ML4A 1P5TA 2DN6A 2ZPYA 5J3YA 4HDOA 3QBVB 3OANA 5FI0A 1DROA 2X18A 3PP2A 2IYBA 1M7RA 1TJ6A 4C0AA 2YRYA 2Z0OA 1ZVRA 5J3QA 2COAA 3VOQA 3RCPA 3ODOA 5LOPB 2N23A 2L2IA 2DX1A 1XKEA 3SNHA 1WG7A 1PMSA 3P6AA 1AQCA 2MDXA 1FAOA 4DX90 2DHJA 3WYFB 1H10A 1DDWA 2GCJA 1X05A 3F5RA 2K00A 2EJ8A 2JP2A 3ZVRA 5KQ4A 2L1CA 1OY2A 3D8DA 5D3VA 3P7ZA 4D0NB 5J3TA 1FOEA 4MY6A 2LKOA 2I1JA 1X86A 2EMTA 5C16A 3LJUX 1TXDA 2CY4A 1WVHA 3F0WA 2YSZA 1MK7B 1GG3A 4HHVA 3PZDA 2OTXA 2MKRA 2RNRB 3HK0A 4ZRKA 2M38A 4K81A 5JP4A 2D9XA 4HB0B 4H8SA 1FB8A 4HAZB 1MPHA 2ELBA 1NTYA 1E5WA 4TKNA 2XQNM 2P0DA 2YVCA 1RRPB 4PQ0A 2ROZB 4F7GA 4GN1A 2NZ8B 3A98B 3QIJA 2EC1A 5C79A 4TYZA 2Y8FA 3HW2B 4YL8A 5HE3A 2YT1A 2VRWB 1BTNA 2E2XA 2DKQA
chains in the Genus database with same CATH superfamily
2VKIA 1WGQA 2J0JA 3BJIA 2LOXA 4L6EA 5D27A 2FJLA 4HATB 5C5BB 4K2PA 3WA0A 1MI1A 4Y94A 3HSAA 5DHAB 2HE7A 1Q67A 5LG4B 5DIFB 5DI9B 2LOZA 5C6RA 4F7HA 3ULCA 1FGYA 3M1IB 4QJ5B 2RLOA 4EJNA 1J0WA 1FHOA 5D3XA 4EKUA 1BTKA 1U5GA 4A6FB 2K2JA 5CLQB 2D9ZA 1X1FA 4WSFA 5KCVA 1QQGA 3KY9A 1NU2A 1XODA 3U7DA 2D9WA 1MIXA 1V88A 4KHBB 4P7IA 1U27A 1N3HA 4EMOA 3ODWA 4QJ3B 2KCJA 3D8FA 1PFJA 2W2XC 5L81A 3TO1A 2K8EA 3PVUA 2M14A 4KHAA 2DKPA 1PLSA 3CXBB 3NSUA 1W1HA 1ZYIA 2OQBA 5JLJB 2RUKB 2Y7BA 5I2SA 1XR0B 2K49A 2R2YA 5JHHA 1V5UA 2Z0PA 3A8QA 1WI1A 2Y8GA 1DDMA 4WJ7A 3D8EA 2MWNB 3FVCA 3TFMA 5KQ1A 4IFSA 1X11A 4HDQA 4IOYX 4GZUA 2YT2A 5FI1A 4D6WA 2YF0A 4KVGB 2GS0A 3U8ZA 2UZRA 4HAVB 3ZDTA 3KZ1A 2EMSA 2YS3A 2YS1A 2RVBB 3PSCA 4DBBA 2NMBA 2P0HA 3U12A 3AU4A 1UEFA 4QXAB 2D10A 2DLWA 5DHFB 4GPTB 4A5KA 2CY5A 1U29A 2Q13A 2UVMA 2DTCA 3VIAA 3OHMB 4A6HA 5C5BA 2D9VA 2LG1A 4CHJA 1XD4A 2J0MA 3T06A 1WJMA 1UPQA 3UZTA 1U5DA 3HIEA 4B6HA 1MIZB 1K5GB 4HB4B 2J0KA 2NBVA 2W2XD 2P8VA 1XX0A 2KUQA 2W2WA 1X1GA 4CHMA 2COFA 2P0FA 4A6FA 4XWXA 1NTVA 1WGUA 1KZ7A 1DBHA 5HE0A 1QC6A 4Z2NA 4CYEA 4KHBA 4MK0A 4IAPA 5HE2A 3GYPA 2K2UA 1EVHA 3KRWA 2BCJA 1LB1A 4K17A 2J59M 2DX5A 3BINA 2R0DA 2D2QA 2GJYA 3AU5A 3X23A 2RGNB 3MPXA 1K5DB 1EGXA 1V61A 3TVVA 2ROVA 4HAWB 4A6KA 2DFKA 4KHOA 1I7AA 1U5EA 1OMWA 1UNQA 1UNPA 1Y5OA 2GUMA 2LULA 2D11A 4OT1A 4ZRJA 2QKLA 1ZC3B 1OQNA 3PEGA 2FJUB 3PVLA 1AWEA 2Z59A 4MT7A 3PVWA 2DYQA 3AJ4A 3SO6A 2HTHB 1MAIA 2DHKA 4HAUB 3NWFA 5D3YA 4HB2B 2RSGA 4DIXA 3QWMA 3ODXA 3TCAA 4YONA 1FHXA 3HQCA 1BAKA 3B77A 1DYNA 1MK9B 4NSWA 2RRFA 1EAZA 1GC6A 1M7EA 3FM8C 2IFSA 2AL6A 4F7UP 5JHGA 3ULBA 4DX8A 1B55A 3MDBC 2CRFA 1LW3A 4GNKB 2DHIA 1J19A 1ZM0A 2KGXB 1V89A 3KRXA 2COCA 3SV1A 2KIGA 2R09A 2D4QA 1UNRA 4GMXB 1U2BA 4KAXB 5CLLB 2Z13A 1GC7A 1EF1A 2Z0QA 1BWNA 4DXAB 3N7CA 2KR0A 2CAYA 1FHWA 4NY0A 4HB3B 4Z2MB 2VSZA 3A8PA 5GOWB 1IRSA 1RJ2A 3TW1A 4GXBA 2PZ1A 3O96A 1P6SA 4HAYB 2I5FA 5D3WA 3FSSA 5I2MA 4K2OA 2ELAA 3FEHA 1TQZA 2MFQA 4BBKA 1V5MA 3DXCA 2Z4DA 1W1DA 3GYOA 5HE1A 1KZGA 4HAXB 1SHCA 2ADZA 1MKEA 3V5WA 3SUZA 2I5CA 2CODA 3DXDA 4HSIA 1I2HA 4ZRIA 1Z87A 2H7DA 1T77A 2UZSA 5LONB 1WJ1A 3NW8A 1H4RA 3IVFA 3SYXA 1KI1B 2YS5A 1XCGA 2D9YA 4PNKA 1W1GA 1NI2A 4L1RA 1ZSQA 2V76A 1DDVA 2DYNA 2G35A 3PG7A 3KSYA 2YT0A 4WVFB 4GMVA 5DH9B 2I1KA 2KUPA 2QKMA 1P3RA 2N0YA 3CIKA 1V5PA 5EFXA 3DXEA 1SGHA 1ISNA 2AEHA 1UPRA 1FGZA 1ZC4B 2H7EA 3G9WA 1Y19B 2LYDA 2GCLA 2DA0A 1U5FA 3ML4A 1P5TA 2DN6A 2ZPYA 5J3YA 4HDOA 3QBVB 4CSQA 3OANA 5FI0A 1DROA 2X18A 3PP2A 2IYBA 1M7RA 1TJ6A 4C0AA 5IRSA 2YRYA 2Z0OA 1ZVRA 5J3QA 2COAA 3VOQA 3RCPA 3ODOA 5LOPB 3DCXA 3A58A 2N23A 2L2IA 2DX1A 1XKEA 3SNHA 1WG7A 1PMSA 3P6AA 1AQCA 2MDXA 1FAOA 4QJ4B 4DX90 2DHJA 3WYFB 1H10A 1DDWA 2GCJA 1X05A 3F5RA 2K00A 2EJ8A 2JP2A 3ZVRA 5KQ4A 2L1CA 1OY2A 3D8DA 5D3VA 3P7ZA 4GOUA 4D0NB 5J3TA 1FOEA 4MY6A 2LKOA 2I1JA 1X86A 2EMTA 5C16A 4OSNA 2Z14A 3LJUX 1TXDA 2CY4A 1WVHA 3F0WA 2YSZA 3NWAA 1MK7B 1GG3A 4HHVA 3PZDA 2OTXA 2MKRA 2RNRB 3HK0A 4ZRKA 2M38A 4K81A 5JP4A 2ZKMX 2D9XA 4HB0B 4H8SA 1FB8A 4HAZB 1MPHA 2ELBA 1NTYA 1E5WA 5M4YB 4TKNA 2XQNM 2P0DA 2YVCA 1RRPB 4PQ0A 2ROZB 4F7GA 4GN1A 2KIEA 2NZ8B 3A98B 3QIJA 2EC1A 5C79A 4TYZA 2Y8FA 3HW2B 3NWDA 4YL8A 5HE3A 2YT1A 2VRWB 1BTNA 2E2XA 2DKQA
chains in the Genus database with same CATH topology
2VKIA 1WGQA 2J0JA 3BJIA 2LOXA 4L6EA 5D27A 2FJLA 4HATB 5C5BB 4K2PA 3WA0A 4Y94A 5DHAB 2HE7A 1Q67A 5DIFB 5DI9B 2LOZA 5C6RA 4F7HA 3ULCA 1FGYA 3M1IB 2RLOA 4EJNA 1J0WA 1FHOA 5D3XA 4EKUA 1BTKA 1U5GA 4A6FB 2K2JA 5CLQB 2D9ZA 1X1FA 4WSFA 5KCVA 1QQGA 3KY9A 1NU2A 1XODA 3U7DA 2D9WA 1MIXA 1V88A 4KHBB 4P7IA 1U27A 1N3HA 4EMOA 3ODWA 2KCJA 3D8FA 1PFJA 2W2XC 5L81A 3TO1A 3PVUA 2M14A 4KHAA 2DKPA 1PLSA 3CXBB 3NSUA 1W1HA 2OQBA 5JLJB 2RUKB 2Y7BA 1XR0B 5JHHA 1V5UA 2Z0PA 3A8QA 1WI1A 2Y8GA 1DDMA 4WJ7A 3D8EA 2MWNB 3TFMA 5KQ1A 4IFSA 1X11A 4HDQA 4IOYX 4GZUA 5FI1A 2YF0A 4KVGB 2GS0A 3U8ZA 2UZRA 4HAVB 3ZDTA 3KZ1A 2EMSA 2YS3A 2YS1A 2RVBB 3PSCA 4DBBA 2NMBA 2P0HA 3AU4A 1UEFA 2D10A 2DLWA 5DHFB 4GPTB 4A5KA 2CY5A 1U29A 2Q13A 2UVMA 2DTCA 3VIAA 4A6HA 5C5BA 2D9VA 2LG1A 4CHJA 1XD4A 2J0MA 3T06A 1WJMA 1UPQA 3UZTA 1U5DA 4B6HA 1MIZB 1K5GB 4HB4B 2J0KA 2W2XD 2P8VA 1XX0A 2W2WA 1X1GA 4CHMA 2COFA 2P0FA 4A6FA 4XWXA 1NTVA 1WGUA 1KZ7A 1DBHA 5HE0A 1QC6A 4Z2NA 4CYEA 4MK0A 4IAPA 5HE2A 3GYPA 2K2UA 1EVHA 3KRWA 2BCJA 1LB1A 4K17A 2J59M 2DX5A 3BINA 2R0DA 2D2QA 2GJYA 3AU5A 3X23A 2RGNB 3MPXA 1K5DB 1EGXA 1V61A 3TVVA 2ROVA 4HAWB 4A6KA 2DFKA 4KHOA 1I7AA 1U5EA 1OMWA 1UNQA 1UNPA 1Y5OA 2LULA 2D11A 4ZRJA 2QKLA 1ZC3B 1OQNA 3PEGA 3PVLA 1AWEA 4MT7A 3PVWA 2DYQA 3AJ4A 3SO6A 2HTHB 1MAIA 2DHKA 4HAUB 5D3YA 4HB2B 2RSGA 3QWMA 3ODXA 3TCAA 4YONA 1FHXA 3HQCA 1BAKA 1DYNA 1MK9B 4NSWA 1EAZA 1GC6A 1M7EA 3FM8C 2IFSA 2AL6A 4F7UP 5JHGA 3ULBA 4DX8A 1B55A 3MDBC 2CRFA 1LW3A 2DHIA 1J19A 1ZM0A 2KGXB 1V89A 3KRXA 2COCA 3SV1A 2R09A 2D4QA 1UNRA 4GMXB 1U2BA 4KAXB 5CLLB 1GC7A 1EF1A 2Z0QA 1BWNA 4DXAB 3N7CA 2CAYA 1FHWA 4NY0A 4HB3B 4Z2MB 2VSZA 3A8PA 5GOWB 1IRSA 1RJ2A 3TW1A 4GXBA 2PZ1A 3O96A 1P6SA 4HAYB 2I5FA 5D3WA 3FSSA 4K2OA 2ELAA 3FEHA 1TQZA 2MFQA 4BBKA 1V5MA 3DXCA 1W1DA 3GYOA 5HE1A 1KZGA 4HAXB 1SHCA 2ADZA 1MKEA 3V5WA 3SUZA 2I5CA 2CODA 3DXDA 1I2HA 4ZRIA 1Z87A 2H7DA 2UZSA 5LONB 1WJ1A 1H4RA 3IVFA 3SYXA 1KI1B 2YS5A 1XCGA 2D9YA 4PNKA 1W1GA 1NI2A 1ZSQA 2V76A 1DDVA 2DYNA 2G35A 3PG7A 3KSYA 2YT0A 4WVFB 4GMVA 5DH9B 2I1KA 2KUPA 2QKMA 1P3RA 2N0YA 3CIKA 1V5PA 5EFXA 3DXEA 1SGHA 1ISNA 2AEHA 1UPRA 1FGZA 1ZC4B 2H7EA 3G9WA 1Y19B 2LYDA 2GCLA 2DA0A 1U5FA 3ML4A 1P5TA 2DN6A 2ZPYA 5J3YA 4HDOA 3QBVB 3OANA 5FI0A 1DROA 2X18A 3PP2A 2IYBA 1M7RA 1TJ6A 4C0AA 2YRYA 2Z0OA 1ZVRA 5J3QA 2COAA 3VOQA 3RCPA 3ODOA 5LOPB 2N23A 2L2IA 2DX1A 1XKEA 3SNHA 1WG7A 1PMSA 3P6AA 1AQCA 2MDXA 1FAOA 4DX90 2DHJA 3WYFB 1H10A 1DDWA 2GCJA 1X05A 3F5RA 2K00A 2EJ8A 2JP2A 3ZVRA 5KQ4A 2L1CA 1OY2A 3D8DA 5D3VA 3P7ZA 4D0NB 5J3TA 1FOEA 4MY6A 2LKOA 2I1JA 1X86A 2EMTA 5C16A 3LJUX 1TXDA 2CY4A 1WVHA 3F0WA 2YSZA 1MK7B 1GG3A 4HHVA 3PZDA 2OTXA 2MKRA 2RNRB 3HK0A 4ZRKA 2M38A 4K81A 5JP4A 2D9XA 4HB0B 4H8SA 1FB8A 4HAZB 1MPHA 2ELBA 1NTYA 1E5WA 4TKNA 2XQNM 2P0DA 2YVCA 1RRPB 4PQ0A 2ROZB 4F7GA 4GN1A 2NZ8B 3A98B 3QIJA 2EC1A 5C79A 4TYZA 2Y8FA 3HW2B 4YL8A 5HE3A 2YT1A 2VRWB 1BTNA 2E2XA 2DKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKI A;  1WGQ A;  2J0J A;  3BJI A;  2LOX A;  4L6E A;  5D27 A;  2FJL A;  4HAT B;  5C5B B;  4K2P A;  3WA0 A;  4Y94 A;  5DHA B;  2HE7 A;  1Q67 A;  5DIF B;  5DI9 B;  2LOZ A;  5C6R A;  4F7H A;  3ULC A;  1FGY A;  3M1I B;  2RLO A;  4EJN A;  1J0W A;  1FHO A;  5D3X A;  4EKU A;  1BTK A;  1U5G A;  4A6F B;  2K2J A;  5CLQ B;  2D9Z A;  1X1F A;  4WSF A;  5KCV A;  1QQG A;  3KY9 A;  1NU2 A;  1XOD A;  3U7D A;  2D9W A;  1MIX A;  1V88 A;  4KHB B;  4P7I A;  1U27 A;  1N3H A;  4EMO A;  3ODW A;  2KCJ A;  3D8F A;  1PFJ A;  2W2X C;  5L81 A;  3TO1 A;  3PVU A;  2M14 A;  4KHA A;  2DKP A;  1PLS A;  3CXB B;  3NSU A;  1W1H A;  2OQB A;  5JLJ B;  2RUK B;  2Y7B A;  1XR0 B;  5JHH A;  1V5U A;  2Z0P A;  3A8Q A;  1WI1 A;  2Y8G A;  1DDM A;  4WJ7 A;  3D8E A;  2MWN B;  3TFM A;  5KQ1 A;  4IFS A;  1X11 A;  4HDQ A;  4IOY X;  4GZU A;  5FI1 A;  2YF0 A;  4KVG B;  2GS0 A;  3U8Z A;  2UZR A;  4HAV B;  3ZDT A;  3KZ1 A;  2EMS A;  2YS3 A;  2YS1 A;  2RVB B;  3PSC A;  4DBB A;  2NMB A;  2P0H A;  3AU4 A;  1UEF A;  2D10 A;  2DLW A;  5DHF B;  4GPT B;  4A5K A;  2CY5 A;  1U29 A;  2Q13 A;  2UVM A;  2DTC A;  3VIA A;  4A6H A;  5C5B A;  2D9V A;  2LG1 A;  4CHJ A;  1XD4 A;  2J0M A;  3T06 A;  1WJM A;  1UPQ A;  3UZT A;  1U5D A;  4B6H A;  1MIZ B;  1K5G B;  4HB4 B;  2J0K A;  2W2X D;  2P8V A;  1XX0 A;  2W2W A;  1X1G A;  4CHM A;  2COF A;  2P0F A;  4A6F A;  4XWX A;  1NTV A;  1WGU A;  1KZ7 A;  1DBH A;  5HE0 A;  1QC6 A;  4Z2N A;  4CYE A;  4MK0 A;  4IAP A;  5HE2 A;  3GYP A;  2K2U A;  1EVH A;  3KRW A;  2BCJ A;  1LB1 A;  4K17 A;  2J59 M;  2DX5 A;  3BIN A;  2R0D A;  2D2Q A;  2GJY A;  3AU5 A;  3X23 A;  2RGN B;  3MPX A;  1K5D B;  1EGX A;  1V61 A;  3TVV A;  2ROV A;  4HAW B;  4A6K A;  2DFK A;  4KHO A;  1I7A A;  1U5E A;  1OMW A;  1UNQ A;  1UNP A;  1Y5O A;  2LUL A;  2D11 A;  4ZRJ A;  2QKL A;  1ZC3 B;  1OQN A;  3PEG A;  3PVL A;  1AWE A;  4MT7 A;  3PVW A;  2DYQ A;  3AJ4 A;  3SO6 A;  2HTH B;  1MAI A;  2DHK A;  4HAU B;  5D3Y A;  4HB2 B;  2RSG A;  3QWM A;  3ODX A;  3TCA A;  4YON A;  1FHX A;  3HQC A;  1BAK A;  1DYN A;  1MK9 B;  4NSW A;  1EAZ A;  1GC6 A;  1M7E A;  3FM8 C;  2IFS A;  2AL6 A;  4F7U P;  5JHG A;  3ULB A;  4DX8 A;  1B55 A;  3MDB C;  2CRF A;  1LW3 A;  2DHI A;  1J19 A;  1ZM0 A;  2KGX B;  1V89 A;  3KRX A;  2COC A;  3SV1 A;  2R09 A;  2D4Q A;  1UNR A;  4GMX B;  1U2B A;  4KAX B;  5CLL B;  1GC7 A;  1EF1 A;  2Z0Q A;  1BWN A;  4DXA B;  3N7C A;  2CAY A;  1FHW A;  4NY0 A;  4HB3 B;  4Z2M B;  2VSZ A;  3A8P A;  5GOW B;  1IRS A;  1RJ2 A;  3TW1 A;  4GXB A;  2PZ1 A;  3O96 A;  1P6S A;  4HAY B;  2I5F A;  5D3W A;  3FSS A;  4K2O A;  2ELA A;  3FEH A;  1TQZ A;  2MFQ A;  4BBK A;  1V5M A;  3DXC A;  1W1D A;  3GYO A;  5HE1 A;  1KZG A;  4HAX B;  1SHC A;  2ADZ A;  1MKE A;  3V5W A;  3SUZ A;  2I5C A;  2COD A;  3DXD A;  1I2H A;  4ZRI A;  1Z87 A;  2H7D A;  2UZS A;  5LON B;  1WJ1 A;  1H4R A;  3IVF A;  3SYX A;  1KI1 B;  2YS5 A;  1XCG A;  2D9Y A;  4PNK A;  1W1G A;  1NI2 A;  1ZSQ A;  2V76 A;  1DDV A;  2DYN A;  2G35 A;  3PG7 A;  3KSY A;  2YT0 A;  4WVF B;  4GMV A;  5DH9 B;  2I1K A;  2KUP A;  2QKM A;  1P3R A;  2N0Y A;  3CIK A;  1V5P A;  5EFX A;  3DXE A;  1SGH A;  1ISN A;  2AEH A;  1UPR A;  1FGZ A;  1ZC4 B;  2H7E A;  3G9W A;  1Y19 B;  2LYD A;  2GCL A;  2DA0 A;  1U5F A;  3ML4 A;  1P5T A;  2DN6 A;  2ZPY A;  5J3Y A;  4HDO A;  3QBV B;  3OAN A;  5FI0 A;  1DRO A;  2X18 A;  3PP2 A;  2IYB A;  1M7R A;  1TJ6 A;  4C0A A;  2YRY A;  2Z0O A;  1ZVR A;  5J3Q A;  2COA A;  3VOQ A;  3RCP A;  3ODO A;  5LOP B;  2N23 A;  2L2I A;  2DX1 A;  1XKE A;  3SNH A;  1WG7 A;  1PMS A;  3P6A A;  1AQC A;  2MDX A;  1FAO A;  4DX9 0;  2DHJ A;  3WYF B;  1H10 A;  1DDW A;  2GCJ A;  1X05 A;  3F5R A;  2K00 A;  2EJ8 A;  2JP2 A;  3ZVR A;  5KQ4 A;  2L1C A;  1OY2 A;  3D8D A;  5D3V A;  3P7Z A;  4D0N B;  5J3T A;  1FOE A;  4MY6 A;  2LKO A;  2I1J A;  1X86 A;  2EMT A;  5C16 A;  3LJU X;  1TXD A;  2CY4 A;  1WVH A;  3F0W A;  2YSZ A;  1MK7 B;  1GG3 A;  4HHV A;  3PZD A;  2OTX A;  2MKR A;  2RNR B;  3HK0 A;  4ZRK A;  2M38 A;  4K81 A;  5JP4 A;  2D9X A;  4HB0 B;  4H8S A;  1FB8 A;  4HAZ B;  1MPH A;  2ELB A;  1NTY A;  1E5W A;  4TKN A;  2XQN M;  2P0D A;  2YVC A;  1RRP B;  4PQ0 A;  2ROZ B;  4F7G A;  4GN1 A;  2NZ8 B;  3A98 B;  3QIJ A;  2EC1 A;  5C79 A;  4TYZ A;  2Y8F A;  3HW2 B;  4YL8 A;  5HE3 A;  2YT1 A;  2VRW B;  1BTN A;  2E2X A;  2DKQ A; 
#chains in the Genus database with same CATH topology
 2VKI A;  1WGQ A;  2J0J A;  3BJI A;  2LOX A;  4L6E A;  5D27 A;  2FJL A;  4HAT B;  5C5B B;  4K2P A;  3WA0 A;  1MI1 A;  4Y94 A;  3HSA A;  5DHA B;  2HE7 A;  1Q67 A;  5LG4 B;  5DIF B;  5DI9 B;  2LOZ A;  5C6R A;  4F7H A;  3ULC A;  1FGY A;  3M1I B;  4QJ5 B;  2RLO A;  4EJN A;  1J0W A;  1FHO A;  5D3X A;  4EKU A;  1BTK A;  1U5G A;  4A6F B;  2K2J A;  5CLQ B;  2D9Z A;  1X1F A;  4WSF A;  5KCV A;  1QQG A;  3KY9 A;  1NU2 A;  1XOD A;  3U7D A;  2D9W A;  1MIX A;  1V88 A;  4KHB B;  4P7I A;  1U27 A;  1N3H A;  4EMO A;  3ODW A;  4QJ3 B;  2KCJ A;  3D8F A;  1PFJ A;  2W2X C;  5L81 A;  3TO1 A;  2K8E A;  3PVU A;  2M14 A;  4KHA A;  2DKP A;  1PLS A;  3CXB B;  3NSU A;  1W1H A;  1ZYI A;  2OQB A;  5JLJ B;  2RUK B;  2Y7B A;  5I2S A;  1XR0 B;  2K49 A;  2R2Y A;  5JHH A;  1V5U A;  2Z0P A;  3A8Q A;  1WI1 A;  2Y8G A;  1DDM A;  4WJ7 A;  3D8E A;  2MWN B;  3FVC A;  3TFM A;  5KQ1 A;  4IFS A;  1X11 A;  4HDQ A;  4IOY X;  4GZU A;  2YT2 A;  5FI1 A;  4D6W A;  2YF0 A;  4KVG B;  2GS0 A;  3U8Z A;  2UZR A;  4HAV B;  3ZDT A;  3KZ1 A;  2EMS A;  2YS3 A;  2YS1 A;  2RVB B;  3PSC A;  4DBB A;  2NMB A;  2P0H A;  3U12 A;  3AU4 A;  1UEF A;  4QXA B;  2D10 A;  2DLW A;  5DHF B;  4GPT B;  4A5K A;  2CY5 A;  1U29 A;  2Q13 A;  2UVM A;  2DTC A;  3VIA A;  3OHM B;  4A6H A;  5C5B A;  2D9V A;  2LG1 A;  4CHJ A;  1XD4 A;  2J0M A;  3T06 A;  1WJM A;  1UPQ A;  3UZT A;  1U5D A;  3HIE A;  4B6H A;  1MIZ B;  1K5G B;  4HB4 B;  2J0K A;  2NBV A;  2W2X D;  2P8V A;  1XX0 A;  2KUQ A;  2W2W A;  1X1G A;  4CHM A;  2COF A;  2P0F A;  4A6F A;  4XWX A;  1NTV A;  1WGU A;  1KZ7 A;  1DBH A;  5HE0 A;  1QC6 A;  4Z2N A;  4CYE A;  4KHB A;  4MK0 A;  4IAP A;  5HE2 A;  3GYP A;  2K2U A;  1EVH A;  3KRW A;  2BCJ A;  1LB1 A;  4K17 A;  2J59 M;  2DX5 A;  3BIN A;  2R0D A;  2D2Q A;  2GJY A;  3AU5 A;  3X23 A;  2RGN B;  3MPX A;  1K5D B;  1EGX A;  1V61 A;  3TVV A;  2ROV A;  4HAW B;  4A6K A;  2DFK A;  4KHO A;  1I7A A;  1U5E A;  1OMW A;  1UNQ A;  1UNP A;  1Y5O A;  2GUM A;  2LUL A;  2D11 A;  4OT1 A;  4ZRJ A;  2QKL A;  1ZC3 B;  1OQN A;  3PEG A;  2FJU B;  3PVL A;  1AWE A;  2Z59 A;  4MT7 A;  3PVW A;  2DYQ A;  3AJ4 A;  3SO6 A;  2HTH B;  1MAI A;  2DHK A;  4HAU B;  3NWF A;  5D3Y A;  4HB2 B;  2RSG A;  4DIX A;  3QWM A;  3ODX A;  3TCA A;  4YON A;  1FHX A;  3HQC A;  1BAK A;  3B77 A;  1DYN A;  1MK9 B;  4NSW A;  2RRF A;  1EAZ A;  1GC6 A;  1M7E A;  3FM8 C;  2IFS A;  2AL6 A;  4F7U P;  5JHG A;  3ULB A;  4DX8 A;  1B55 A;  3MDB C;  2CRF A;  1LW3 A;  4GNK B;  2DHI A;  1J19 A;  1ZM0 A;  2KGX B;  1V89 A;  3KRX A;  2COC A;  3SV1 A;  2KIG A;  2R09 A;  2D4Q A;  1UNR A;  4GMX B;  1U2B A;  4KAX B;  5CLL B;  2Z13 A;  1GC7 A;  1EF1 A;  2Z0Q A;  1BWN A;  4DXA B;  3N7C A;  2KR0 A;  2CAY A;  1FHW A;  4NY0 A;  4HB3 B;  4Z2M B;  2VSZ A;  3A8P A;  5GOW B;  1IRS A;  1RJ2 A;  3TW1 A;  4GXB A;  2PZ1 A;  3O96 A;  1P6S A;  4HAY B;  2I5F A;  5D3W A;  3FSS A;  5I2M A;  4K2O A;  2ELA A;  3FEH A;  1TQZ A;  2MFQ A;  4BBK A;  1V5M A;  3DXC A;  2Z4D A;  1W1D A;  3GYO A;  5HE1 A;  1KZG A;  4HAX B;  1SHC A;  2ADZ A;  1MKE A;  3V5W A;  3SUZ A;  2I5C A;  2COD A;  3DXD A;  4HSI A;  1I2H A;  4ZRI A;  1Z87 A;  2H7D A;  1T77 A;  2UZS A;  5LON B;  1WJ1 A;  3NW8 A;  1H4R A;  3IVF A;  3SYX A;  1KI1 B;  2YS5 A;  1XCG A;  2D9Y A;  4PNK A;  1W1G A;  1NI2 A;  4L1R A;  1ZSQ A;  2V76 A;  1DDV A;  2DYN A;  2G35 A;  3PG7 A;  3KSY A;  2YT0 A;  4WVF B;  4GMV A;  5DH9 B;  2I1K A;  2KUP A;  2QKM A;  1P3R A;  2N0Y A;  3CIK A;  1V5P A;  5EFX A;  3DXE A;  1SGH A;  1ISN A;  2AEH A;  1UPR A;  1FGZ A;  1ZC4 B;  2H7E A;  3G9W A;  1Y19 B;  2LYD A;  2GCL A;  2DA0 A;  1U5F A;  3ML4 A;  1P5T A;  2DN6 A;  2ZPY A;  5J3Y A;  4HDO A;  3QBV B;  4CSQ A;  3OAN A;  5FI0 A;  1DRO A;  2X18 A;  3PP2 A;  2IYB A;  1M7R A;  1TJ6 A;  4C0A A;  5IRS A;  2YRY A;  2Z0O A;  1ZVR A;  5J3Q A;  2COA A;  3VOQ A;  3RCP A;  3ODO A;  5LOP B;  3DCX A;  3A58 A;  2N23 A;  2L2I A;  2DX1 A;  1XKE A;  3SNH A;  1WG7 A;  1PMS A;  3P6A A;  1AQC A;  2MDX A;  1FAO A;  4QJ4 B;  4DX9 0;  2DHJ A;  3WYF B;  1H10 A;  1DDW A;  2GCJ A;  1X05 A;  3F5R A;  2K00 A;  2EJ8 A;  2JP2 A;  3ZVR A;  5KQ4 A;  2L1C A;  1OY2 A;  3D8D A;  5D3V A;  3P7Z A;  4GOU A;  4D0N B;  5J3T A;  1FOE A;  4MY6 A;  2LKO A;  2I1J A;  1X86 A;  2EMT A;  5C16 A;  4OSN A;  2Z14 A;  3LJU X;  1TXD A;  2CY4 A;  1WVH A;  3F0W A;  2YSZ A;  3NWA A;  1MK7 B;  1GG3 A;  4HHV A;  3PZD A;  2OTX A;  2MKR A;  2RNR B;  3HK0 A;  4ZRK A;  2M38 A;  4K81 A;  5JP4 A;  2ZKM X;  2D9X A;  4HB0 B;  4H8S A;  1FB8 A;  4HAZ B;  1MPH A;  2ELB A;  1NTY A;  1E5W A;  5M4Y B;  4TKN A;  2XQN M;  2P0D A;  2YVC A;  1RRP B;  4PQ0 A;  2ROZ B;  4F7G A;  4GN1 A;  2KIE A;  2NZ8 B;  3A98 B;  3QIJ A;  2EC1 A;  5C79 A;  4TYZ A;  2Y8F A;  3HW2 B;  3NWD A;  4YL8 A;  5HE3 A;  2YT1 A;  2VRW B;  1BTN A;  2E2X A;  2DKQ A; 
#chains in the Genus database with same CATH homology
 2VKI A;  1WGQ A;  2J0J A;  3BJI A;  2LOX A;  4L6E A;  5D27 A;  2FJL A;  4HAT B;  5C5B B;  4K2P A;  3WA0 A;  4Y94 A;  5DHA B;  2HE7 A;  1Q67 A;  5DIF B;  5DI9 B;  2LOZ A;  5C6R A;  4F7H A;  3ULC A;  1FGY A;  3M1I B;  2RLO A;  4EJN A;  1J0W A;  1FHO A;  5D3X A;  4EKU A;  1BTK A;  1U5G A;  4A6F B;  2K2J A;  5CLQ B;  2D9Z A;  1X1F A;  4WSF A;  5KCV A;  1QQG A;  3KY9 A;  1NU2 A;  1XOD A;  3U7D A;  2D9W A;  1MIX A;  1V88 A;  4KHB B;  4P7I A;  1U27 A;  1N3H A;  4EMO A;  3ODW A;  2KCJ A;  3D8F A;  1PFJ A;  2W2X C;  5L81 A;  3TO1 A;  3PVU A;  2M14 A;  4KHA A;  2DKP A;  1PLS A;  3CXB B;  3NSU A;  1W1H A;  2OQB A;  5JLJ B;  2RUK B;  2Y7B A;  1XR0 B;  5JHH A;  1V5U A;  2Z0P A;  3A8Q A;  1WI1 A;  2Y8G A;  1DDM A;  4WJ7 A;  3D8E A;  2MWN B;  3TFM A;  5KQ1 A;  4IFS A;  1X11 A;  4HDQ A;  4IOY X;  4GZU A;  5FI1 A;  2YF0 A;  4KVG B;  2GS0 A;  3U8Z A;  2UZR A;  4HAV B;  3ZDT A;  3KZ1 A;  2EMS A;  2YS3 A;  2YS1 A;  2RVB B;  3PSC A;  4DBB A;  2NMB A;  2P0H A;  3AU4 A;  1UEF A;  2D10 A;  2DLW A;  5DHF B;  4GPT B;  4A5K A;  2CY5 A;  1U29 A;  2Q13 A;  2UVM A;  2DTC A;  3VIA A;  4A6H A;  5C5B A;  2D9V A;  2LG1 A;  4CHJ A;  1XD4 A;  2J0M A;  3T06 A;  1WJM A;  1UPQ A;  3UZT A;  1U5D A;  4B6H A;  1MIZ B;  1K5G B;  4HB4 B;  2J0K A;  2W2X D;  2P8V A;  1XX0 A;  2W2W A;  1X1G A;  4CHM A;  2COF A;  2P0F A;  4A6F A;  4XWX A;  1NTV A;  1WGU A;  1KZ7 A;  1DBH A;  5HE0 A;  1QC6 A;  4Z2N A;  4CYE A;  4MK0 A;  4IAP A;  5HE2 A;  3GYP A;  2K2U A;  1EVH A;  3KRW A;  2BCJ A;  1LB1 A;  4K17 A;  2J59 M;  2DX5 A;  3BIN A;  2R0D A;  2D2Q A;  2GJY A;  3AU5 A;  3X23 A;  2RGN B;  3MPX A;  1K5D B;  1EGX A;  1V61 A;  3TVV A;  2ROV A;  4HAW B;  4A6K A;  2DFK A;  4KHO A;  1I7A A;  1U5E A;  1OMW A;  1UNQ A;  1UNP A;  1Y5O A;  2LUL A;  2D11 A;  4ZRJ A;  2QKL A;  1ZC3 B;  1OQN A;  3PEG A;  3PVL A;  1AWE A;  4MT7 A;  3PVW A;  2DYQ A;  3AJ4 A;  3SO6 A;  2HTH B;  1MAI A;  2DHK A;  4HAU B;  5D3Y A;  4HB2 B;  2RSG A;  3QWM A;  3ODX A;  3TCA A;  4YON A;  1FHX A;  3HQC A;  1BAK A;  1DYN A;  1MK9 B;  4NSW A;  1EAZ A;  1GC6 A;  1M7E A;  3FM8 C;  2IFS A;  2AL6 A;  4F7U P;  5JHG A;  3ULB A;  4DX8 A;  1B55 A;  3MDB C;  2CRF A;  1LW3 A;  2DHI A;  1J19 A;  1ZM0 A;  2KGX B;  1V89 A;  3KRX A;  2COC A;  3SV1 A;  2R09 A;  2D4Q A;  1UNR A;  4GMX B;  1U2B A;  4KAX B;  5CLL B;  1GC7 A;  1EF1 A;  2Z0Q A;  1BWN A;  4DXA B;  3N7C A;  2CAY A;  1FHW A;  4NY0 A;  4HB3 B;  4Z2M B;  2VSZ A;  3A8P A;  5GOW B;  1IRS A;  1RJ2 A;  3TW1 A;  4GXB A;  2PZ1 A;  3O96 A;  1P6S A;  4HAY B;  2I5F A;  5D3W A;  3FSS A;  4K2O A;  2ELA A;  3FEH A;  1TQZ A;  2MFQ A;  4BBK A;  1V5M A;  3DXC A;  1W1D A;  3GYO A;  5HE1 A;  1KZG A;  4HAX B;  1SHC A;  2ADZ A;  1MKE A;  3V5W A;  3SUZ A;  2I5C A;  2COD A;  3DXD A;  1I2H A;  4ZRI A;  1Z87 A;  2H7D A;  2UZS A;  5LON B;  1WJ1 A;  1H4R A;  3IVF A;  3SYX A;  1KI1 B;  2YS5 A;  1XCG A;  2D9Y A;  4PNK A;  1W1G A;  1NI2 A;  1ZSQ A;  2V76 A;  1DDV A;  2DYN A;  2G35 A;  3PG7 A;  3KSY A;  2YT0 A;  4WVF B;  4GMV A;  5DH9 B;  2I1K A;  2KUP A;  2QKM A;  1P3R A;  2N0Y A;  3CIK A;  1V5P A;  5EFX A;  3DXE A;  1SGH A;  1ISN A;  2AEH A;  1UPR A;  1FGZ A;  1ZC4 B;  2H7E A;  3G9W A;  1Y19 B;  2LYD A;  2GCL A;  2DA0 A;  1U5F A;  3ML4 A;  1P5T A;  2DN6 A;  2ZPY A;  5J3Y A;  4HDO A;  3QBV B;  3OAN A;  5FI0 A;  1DRO A;  2X18 A;  3PP2 A;  2IYB A;  1M7R A;  1TJ6 A;  4C0A A;  2YRY A;  2Z0O A;  1ZVR A;  5J3Q A;  2COA A;  3VOQ A;  3RCP A;  3ODO A;  5LOP B;  2N23 A;  2L2I A;  2DX1 A;  1XKE A;  3SNH A;  1WG7 A;  1PMS A;  3P6A A;  1AQC A;  2MDX A;  1FAO A;  4DX9 0;  2DHJ A;  3WYF B;  1H10 A;  1DDW A;  2GCJ A;  1X05 A;  3F5R A;  2K00 A;  2EJ8 A;  2JP2 A;  3ZVR A;  5KQ4 A;  2L1C A;  1OY2 A;  3D8D A;  5D3V A;  3P7Z A;  4D0N B;  5J3T A;  1FOE A;  4MY6 A;  2LKO A;  2I1J A;  1X86 A;  2EMT A;  5C16 A;  3LJU X;  1TXD A;  2CY4 A;  1WVH A;  3F0W A;  2YSZ A;  1MK7 B;  1GG3 A;  4HHV A;  3PZD A;  2OTX A;  2MKR A;  2RNR B;  3HK0 A;  4ZRK A;  2M38 A;  4K81 A;  5JP4 A;  2D9X A;  4HB0 B;  4H8S A;  1FB8 A;  4HAZ B;  1MPH A;  2ELB A;  1NTY A;  1E5W A;  4TKN A;  2XQN M;  2P0D A;  2YVC A;  1RRP B;  4PQ0 A;  2ROZ B;  4F7G A;  4GN1 A;  2NZ8 B;  3A98 B;  3QIJ A;  2EC1 A;  5C79 A;  4TYZ A;  2Y8F A;  3HW2 B;  4YL8 A;  5HE3 A;  2YT1 A;  2VRW B;  1BTN A;  2E2X A;  2DKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...