2LULA

Solution nmr structure of ph domain of tyrosine-protein kinase tec from homo sapiens, northeast structural genomics consortium (nesg) target hr3504c
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
164
structure length
164
Chain Sequence
MGHHHHHHSHMNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of PH Domain of Tyrosine-protein kinase Tec from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR3504C
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase Tec
total genus 31
structure length 164
sequence length 164
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00779 BTK BTK motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2lulA00
2I5FA 2DFKA 2LKOA 4GPTB 2XQNM 5KQ1A 3M1IB 5C5BB 2M14A 3TCAA 4WJ7A 1U5FA 4HDQA 1K5DB 4MY6A 3U8ZA 5D3YA 1OY2A 2JP2A 4HB3B 1OMWA 2AEHA 4H8SA 2VRWB 4YONA 1WJMA 1FHWA 2MKRA 3TO1A 1PLSA 2VSZA 1WGUA 3PG7A 1U29A 1EF1A 5HE0A 1MAIA 2CRFA 1KI1B 2HTHB 3ZVRA 2D9YA 3QBVB 1ZC3B 1X1FA 1QC6A 2LULA 1UEFA 1MIXA 2UZSA 4DX90 4Y94A 4Z2NA 2EJ8A 2G35A 5DIFB 5JP4A 3HQCA 2GCJA 2YF0A 1Q67A 4EKUA 4ZRJA 1RJ2A 5C6RA 1QQGA 2X18A 2YRYA 3MPXA 1ISNA 2M38A 4XWXA 1TJ6A 1P6SA 4GN1A 2COCA 4TYZA 2N0YA 2DX5A 3PVWA 1NTVA 1ZVRA 4GMXB 2HE7A 5KQ4A 2J59M 3HK0A 1E5WA 2Z0QA 4GZUA 1M7RA 2QKLA 4A6FB 5CLQB 2PZ1A 1FHXA 1MIZB 2L1CA 3O96A 2D2QA 1U5DA 1K5GB 3A98B 2KGXB 1GC6A 3KRWA 5CLLB 1XD4A 2Y7BA 1WG7A 3RCPA 2K00A 2R0DA 1XCGA 5C79A 2EC1A 4TKNA 3NSUA 3PP2A 5L81A 2W2WA 3OANA 1M7EA 2LOZA 2P8VA 1Y5OA 1KZGA 3F0WA 3SO6A 2Z0PA 4CHJA 3HW2B 4GXBA 5D3WA 5GOWB 3T06A 1MK7B 4HB4B 2VKIA 3MDBC 1ZSQA 3PVLA 4HAZB 4WVFB 1WVHA 1X86A 2Y8FA 3ULCA 3TVVA 4A5KA 3SV1A 3SYXA 2ELBA 2NZ8B 4HAVB 2DYQA 4DBBA 1FOEA 3F5RA 4K81A 4KHAA 4EMOA 1X11A 5J3TA 1P3RA 2ROVA 2K2JA 3G9WA 4CHMA 2H7DA 3KZ1A 3VIAA 1V88A 1FGYA 4HATB 2D9ZA 2COFA 1W1GA 1DYNA 3A8PA 1XX0A 2IYBA 3AU5A 4IFSA 2YSZA 1OQNA 4WSFA 2DYNA 1P5TA 2DKQA 2W2XC 4P7IA 1V5PA 4K2PA 2CAYA 1MPHA 1UNRA 4NSWA 2H7EA 3SUZA 2ADZA 1V5UA 2DTCA 5LOPB 2P0DA 1FHOA 1N3HA 1WGQA 3TW1A 2RLOA 3DXDA 4F7HA 2GCLA 4L6EA 3FSSA 1KZ7A 1GC7A 5HE2A 3KY9A 2DKPA 2P0HA 3LJUX 2YS5A 3GYOA 1UNQA 2D9XA 4A6KA 3PVUA 3TFMA 5HE1A 1GG3A 3CIKA 1U2BA 3FEHA 4KHBB 2DX1A 1W1HA 3BJIA 5KCVA 1TQZA 5D27A 2L2IA 1Z87A 1BTKA 5J3QA 1I2HA 2DA0A 3FM8C 4D0NB 4MK0A 1AQCA 1V5MA 4HB2B 2DN6A 4MT7A 3D8EA 3IVFA 4HAWB 2Y8GA 1EGXA 1BWNA 1DBHA 2I1KA 1XODA 2COAA 1XKEA 2W2XD 2DLWA 2P0FA 5DHFB 4HAYB 5JHGA 3SNHA 3DXEA 1XR0B 4DX8A 5C16A 2OQBA 1WJ1A 2CY4A 3N7CA 2IFSA 1PMSA 1EVHA 2RVBB 3BINA 4HHVA 2D9VA 3VOQA 3ODOA 4ZRKA 2KCJA 4PQ0A 2Q13A 4F7UP 3ODWA 4A6FA 4HDOA 4HAXB 2K2UA 5D3VA 2LYDA 4EJNA 3ZDTA 4C0AA 1LW3A 3QIJA 1EAZA 1W1DA 4BBKA 5LONB 5EFXA 3PSCA 2CODA 1BAKA 3AU4A 2YT1A 2D9WA 1DDMA 3P6AA 3X23A 2FJLA 1B55A 2Z0OA 3D8DA 3WA0A 2E2XA 2LOXA 2N23A 2QKMA 4DXAB 5D3XA 2MFQA 4PNKA 4K2OA 4HB0B 2GS0A 2AL6A 2RNRB 3KRXA 2YS3A 1UPQA 3ML4A 4YL8A 1ZC4B 2UVMA 2D11A 2J0KA 4KHOA 5JLJB 1I7AA 1UNPA 1Y19B 4IOYX 1SGHA 2D10A 1X05A 2J0MA 2LG1A 4B6HA 4F7GA 3V5WA 1MK9B 2GJYA 1FB8A 1NTYA 1DROA 3QWMA 4IAPA 2UZRA 4KAXB 1SHCA 1NU2A 1MKEA 5DI9B 5J3YA 5FI1A 2YS1A 3GYPA 1FGZA 3PEGA 2I5CA 3ODXA 4A6HA 2KUPA 2MDXA 2YVCA 4GMVA 5HE3A 2D4QA 2OTXA 1J19A 3DXCA 4CYEA 1LB1A 3U7DA 2CY5A 5JHHA 3D8FA 1TXDA 5DH9B 4ZRIA 1WI1A 1U5EA 4NY0A 3P7ZA 2ROZB 1U27A 1V89A 2RSGA 2EMTA 5C5BA 1FAOA 2NMBA 4HAUB 1PFJA 3ULBA 4K17A 1BTNA 1J0WA 1X1GA 3CXBB 2EMSA 3AJ4A 3PZDA 4KVGB 4Z2MB 1U5GA 1RRPB 2YT0A 1H4RA 1H10A 2J0JA 5DHAB 1ZM0A 2MWNB 2BCJA 3KSYA 2RUKB 2DHJA 2DHKA 1UPRA 2I1JA 1IRSA 3UZTA 1DDWA 3WYFB 2V76A 1NI2A 1DDVA 5FI0A 2RGNB 3A8QA 1V61A 2ELAA 2R09A 1AWEA 2DHIA 2ZPYA
chains in the Genus database with same CATH superfamily
2I5FA 2DFKA 2LKOA 4GPTB 2XQNM 5KQ1A 3NW8A 3M1IB 5C5BB 2M14A 3TCAA 4CSQA 4WJ7A 1U5FA 4GNKB 4HDQA 1K5DB 4MY6A 3U8ZA 5D3YA 1OY2A 2JP2A 3NWDA 4HB3B 1OMWA 2AEHA 4H8SA 2VRWB 4YONA 4QXAB 1WJMA 1FHWA 2MKRA 3TO1A 1PLSA 2VSZA 1WGUA 3PG7A 1U29A 1EF1A 5HE0A 1MAIA 2CRFA 1KI1B 2HTHB 3ZVRA 5LG4B 2D9YA 3QBVB 1ZC3B 1X1FA 5I2MA 1QC6A 2LULA 1UEFA 1MIXA 2UZSA 4DX90 4Y94A 4Z2NA 2Z59A 2EJ8A 2G35A 5DIFB 5JP4A 3HQCA 2GCJA 2YF0A 1Q67A 4EKUA 4ZRJA 1RJ2A 5C6RA 1QQGA 2X18A 2YRYA 3MPXA 1ISNA 2M38A 4XWXA 1TJ6A 1P6SA 4GN1A 2COCA 4TYZA 2N0YA 2DX5A 3PVWA 3B77A 1NTVA 1ZVRA 4GMXB 2HE7A 5KQ4A 2J59M 3HK0A 1E5WA 2Z0QA 4GZUA 1M7RA 2QKLA 4A6FB 5CLQB 2PZ1A 1FHXA 3DCXA 4OSNA 1MIZB 2L1CA 3O96A 2D2QA 1U5DA 1K5GB 2KR0A 3A98B 2ZKMX 2KGXB 1GC6A 3KRWA 5CLLB 1XD4A 2Y7BA 1WG7A 2NBVA 3RCPA 2K00A 2R0DA 1XCGA 5C79A 2EC1A 4TKNA 3NSUA 3PP2A 5L81A 2W2WA 3OANA 1M7EA 2LOZA 2P8VA 1Y5OA 1KZGA 3F0WA 4QJ3B 2Z0PA 3SO6A 4CHJA 3U12A 3HW2B 2GUMA 4GXBA 5D3WA 5GOWB 3T06A 1MK7B 4HB4B 2VKIA 3MDBC 1ZSQA 3PVLA 4HAZB 4WVFB 1WVHA 1X86A 2Y8FA 3ULCA 3TVVA 4A5KA 3SV1A 3SYXA 2ELBA 2NZ8B 4HAVB 3HSAA 2DYQA 4DBBA 1FOEA 3F5RA 4K81A 4KHAA 4EMOA 1X11A 5J3TA 1P3RA 1MI1A 2ROVA 2K2JA 3G9WA 4CHMA 2H7DA 3KZ1A 3VIAA 1V88A 1FGYA 4HATB 2D9ZA 2COFA 1W1GA 1DYNA 3A8PA 1XX0A 2IYBA 2K49A 3AU5A 4IFSA 2YSZA 1OQNA 4WSFA 2DYNA 1P5TA 3NWAA 2DKQA 2W2XC 4P7IA 1V5PA 4K2PA 2CAYA 1MPHA 1UNRA 4NSWA 2H7EA 3SUZA 2ADZA 1V5UA 2DTCA 5LOPB 2P0DA 1FHOA 2Z13A 1N3HA 1WGQA 3TW1A 4OT1A 2RLOA 3DXDA 4F7HA 2GCLA 4L6EA 3FSSA 1KZ7A 1GC7A 2YT2A 2KIGA 4GOUA 5HE2A 3KY9A 2DKPA 4D6WA 2P0HA 3LJUX 2YS5A 3GYOA 1UNQA 2D9XA 4A6KA 3PVUA 3TFMA 5HE1A 1GG3A 3CIKA 1U2BA 3FEHA 4KHBB 2DX1A 3BJIA 1W1HA 2Z14A 5KCVA 1TQZA 5D27A 2L2IA 1Z87A 1BTKA 5J3QA 1I2HA 2DA0A 3FM8C 4DIXA 4D0NB 4MK0A 1AQCA 1V5MA 4HB2B 2DN6A 4MT7A 3D8EA 3IVFA 4HAWB 2Y8GA 1EGXA 1BWNA 4QJ4B 1DBHA 2I1KA 1XODA 2COAA 1XKEA 2W2XD 2DLWA 3A58A 2P0FA 5DHFB 4HAYB 5JHGA 3SNHA 3OHMB 3DXEA 1XR0B 5IRSA 4DX8A 5C16A 2OQBA 1WJ1A 2CY4A 2KIEA 3N7CA 2IFSA 1PMSA 1EVHA 2RVBB 3BINA 2RRFA 4HHVA 2D9VA 3VOQA 3ODOA 4KHBA 4ZRKA 2KCJA 4PQ0A 2Q13A 2FJUB 4F7UP 3ODWA 4A6FA 4HDOA 4HAXB 2K2UA 5D3VA 2LYDA 4EJNA 3ZDTA 4C0AA 1LW3A 3QIJA 1EAZA 1W1DA 4BBKA 2R2YA 5LONB 5EFXA 3PSCA 2CODA 1BAKA 3AU4A 2YT1A 2D9WA 1DDMA 3P6AA 3X23A 2FJLA 5I2SA 1B55A 2Z0OA 3D8DA 3WA0A 2E2XA 2LOXA 2N23A 2QKMA 4DXAB 5D3XA 2MFQA 4PNKA 4K2OA 4HB0B 2GS0A 2AL6A 2RNRB 3KRXA 2YS3A 1UPQA 3ML4A 4YL8A 1ZC4B 2UVMA 2D11A 2J0KA 4L1RA 4KHOA 5JLJB 1I7AA 1UNPA 1Y19B 4IOYX 3FVCA 1SGHA 2D10A 1X05A 2J0MA 2LG1A 4B6HA 4F7GA 3V5WA 1MK9B 2GJYA 1FB8A 1NTYA 1DROA 3QWMA 4IAPA 2UZRA 4KAXB 1SHCA 1NU2A 1MKEA 3HIEA 5DI9B 5J3YA 5FI1A 2YS1A 3GYPA 1FGZA 3PEGA 2I5CA 2KUQA 3ODXA 4A6HA 2KUPA 2MDXA 2YVCA 4GMVA 5HE3A 2D4QA 2OTXA 1J19A 3DXCA 4CYEA 1LB1A 3U7DA 2CY5A 5JHHA 3D8FA 1TXDA 5DH9B 4QJ5B 4ZRIA 1WI1A 1U5EA 4NY0A 3P7ZA 2ROZB 1U27A 1V89A 2RSGA 2Z4DA 2EMTA 5C5BA 1FAOA 2NMBA 4HAUB 1PFJA 3ULBA 1T77A 4K17A 1BTNA 1J0WA 1X1GA 3CXBB 2EMSA 2K8EA 3AJ4A 3PZDA 4HSIA 4KVGB 1ZYIA 4Z2MB 1U5GA 1RRPB 2YT0A 1H4RA 1H10A 2J0JA 5M4YB 5DHAB 1ZM0A 2MWNB 2BCJA 3KSYA 2RUKB 2DHJA 2DHKA 1UPRA 2I1JA 1IRSA 3NWFA 3UZTA 1DDWA 3WYFB 2V76A 1NI2A 1DDVA 5FI0A 2RGNB 3A8QA 1V61A 2ELAA 2R09A 1AWEA 2DHIA 2ZPYA
chains in the Genus database with same CATH topology
2I5FA 2DFKA 2LKOA 4GPTB 2XQNM 5KQ1A 3M1IB 5C5BB 2M14A 3TCAA 4WJ7A 1U5FA 4HDQA 1K5DB 4MY6A 3U8ZA 5D3YA 1OY2A 2JP2A 4HB3B 1OMWA 2AEHA 4H8SA 2VRWB 4YONA 1WJMA 1FHWA 2MKRA 3TO1A 1PLSA 2VSZA 1WGUA 3PG7A 1U29A 1EF1A 5HE0A 1MAIA 2CRFA 1KI1B 2HTHB 3ZVRA 2D9YA 3QBVB 1ZC3B 1X1FA 1QC6A 2LULA 1UEFA 1MIXA 2UZSA 4DX90 4Y94A 4Z2NA 2EJ8A 2G35A 5DIFB 5JP4A 3HQCA 2GCJA 2YF0A 1Q67A 4EKUA 4ZRJA 1RJ2A 5C6RA 1QQGA 2X18A 2YRYA 3MPXA 1ISNA 2M38A 4XWXA 1TJ6A 1P6SA 4GN1A 2COCA 4TYZA 2N0YA 2DX5A 3PVWA 1NTVA 1ZVRA 4GMXB 2HE7A 5KQ4A 2J59M 3HK0A 1E5WA 2Z0QA 4GZUA 1M7RA 2QKLA 4A6FB 5CLQB 2PZ1A 1FHXA 1MIZB 2L1CA 3O96A 2D2QA 1U5DA 1K5GB 3A98B 2KGXB 1GC6A 3KRWA 5CLLB 1XD4A 2Y7BA 1WG7A 3RCPA 2K00A 2R0DA 1XCGA 5C79A 2EC1A 4TKNA 3NSUA 3PP2A 5L81A 2W2WA 3OANA 1M7EA 2LOZA 2P8VA 1Y5OA 1KZGA 3F0WA 3SO6A 2Z0PA 4CHJA 3HW2B 4GXBA 5D3WA 5GOWB 3T06A 1MK7B 4HB4B 2VKIA 3MDBC 1ZSQA 3PVLA 4HAZB 4WVFB 1WVHA 1X86A 2Y8FA 3ULCA 3TVVA 4A5KA 3SV1A 3SYXA 2ELBA 2NZ8B 4HAVB 2DYQA 4DBBA 1FOEA 3F5RA 4K81A 4KHAA 4EMOA 1X11A 5J3TA 1P3RA 2ROVA 2K2JA 3G9WA 4CHMA 2H7DA 3KZ1A 3VIAA 1V88A 1FGYA 4HATB 2D9ZA 2COFA 1W1GA 1DYNA 3A8PA 1XX0A 2IYBA 3AU5A 4IFSA 2YSZA 1OQNA 4WSFA 2DYNA 1P5TA 2DKQA 2W2XC 4P7IA 1V5PA 4K2PA 2CAYA 1MPHA 1UNRA 4NSWA 2H7EA 3SUZA 2ADZA 1V5UA 2DTCA 5LOPB 2P0DA 1FHOA 1N3HA 1WGQA 3TW1A 2RLOA 3DXDA 4F7HA 2GCLA 4L6EA 3FSSA 1KZ7A 1GC7A 5HE2A 3KY9A 2DKPA 2P0HA 3LJUX 2YS5A 3GYOA 1UNQA 2D9XA 4A6KA 3PVUA 3TFMA 5HE1A 1GG3A 3CIKA 1U2BA 3FEHA 4KHBB 2DX1A 1W1HA 3BJIA 5KCVA 1TQZA 5D27A 2L2IA 1Z87A 1BTKA 5J3QA 1I2HA 2DA0A 3FM8C 4D0NB 4MK0A 1AQCA 1V5MA 4HB2B 2DN6A 4MT7A 3D8EA 3IVFA 4HAWB 2Y8GA 1EGXA 1BWNA 1DBHA 2I1KA 1XODA 2COAA 1XKEA 2W2XD 2DLWA 2P0FA 5DHFB 4HAYB 5JHGA 3SNHA 3DXEA 1XR0B 4DX8A 5C16A 2OQBA 1WJ1A 2CY4A 3N7CA 2IFSA 1PMSA 1EVHA 2RVBB 3BINA 4HHVA 2D9VA 3VOQA 3ODOA 4ZRKA 2KCJA 4PQ0A 2Q13A 4F7UP 3ODWA 4A6FA 4HDOA 4HAXB 2K2UA 5D3VA 2LYDA 4EJNA 3ZDTA 4C0AA 1LW3A 3QIJA 1EAZA 1W1DA 4BBKA 5LONB 5EFXA 3PSCA 2CODA 1BAKA 3AU4A 2YT1A 2D9WA 1DDMA 3P6AA 3X23A 2FJLA 1B55A 2Z0OA 3D8DA 3WA0A 2E2XA 2LOXA 2N23A 2QKMA 4DXAB 5D3XA 2MFQA 4PNKA 4K2OA 4HB0B 2GS0A 2AL6A 2RNRB 3KRXA 2YS3A 1UPQA 3ML4A 4YL8A 1ZC4B 2UVMA 2D11A 2J0KA 4KHOA 5JLJB 1I7AA 1UNPA 1Y19B 4IOYX 1SGHA 2D10A 1X05A 2J0MA 2LG1A 4B6HA 4F7GA 3V5WA 1MK9B 2GJYA 1FB8A 1NTYA 1DROA 3QWMA 4IAPA 2UZRA 4KAXB 1SHCA 1NU2A 1MKEA 5DI9B 5J3YA 5FI1A 2YS1A 3GYPA 1FGZA 3PEGA 2I5CA 3ODXA 4A6HA 2KUPA 2MDXA 2YVCA 4GMVA 5HE3A 2D4QA 2OTXA 1J19A 3DXCA 4CYEA 1LB1A 3U7DA 2CY5A 5JHHA 3D8FA 1TXDA 5DH9B 4ZRIA 1WI1A 1U5EA 4NY0A 3P7ZA 2ROZB 1U27A 1V89A 2RSGA 2EMTA 5C5BA 1FAOA 2NMBA 4HAUB 1PFJA 3ULBA 4K17A 1BTNA 1J0WA 1X1GA 3CXBB 2EMSA 3AJ4A 3PZDA 4KVGB 4Z2MB 1U5GA 1RRPB 2YT0A 1H4RA 1H10A 2J0JA 5DHAB 1ZM0A 2MWNB 2BCJA 3KSYA 2RUKB 2DHJA 2DHKA 1UPRA 2I1JA 1IRSA 3UZTA 1DDWA 3WYFB 2V76A 1NI2A 1DDVA 5FI0A 2RGNB 3A8QA 1V61A 2ELAA 2R09A 1AWEA 2DHIA 2ZPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5F A;  2DFK A;  2LKO A;  4GPT B;  2XQN M;  5KQ1 A;  3M1I B;  5C5B B;  2M14 A;  3TCA A;  4WJ7 A;  1U5F A;  4HDQ A;  1K5D B;  4MY6 A;  3U8Z A;  5D3Y A;  1OY2 A;  2JP2 A;  4HB3 B;  1OMW A;  2AEH A;  4H8S A;  2VRW B;  4YON A;  1WJM A;  1FHW A;  2MKR A;  3TO1 A;  1PLS A;  2VSZ A;  1WGU A;  3PG7 A;  1U29 A;  1EF1 A;  5HE0 A;  1MAI A;  2CRF A;  1KI1 B;  2HTH B;  3ZVR A;  2D9Y A;  3QBV B;  1ZC3 B;  1X1F A;  1QC6 A;  2LUL A;  1UEF A;  1MIX A;  2UZS A;  4DX9 0;  4Y94 A;  4Z2N A;  2EJ8 A;  2G35 A;  5DIF B;  5JP4 A;  3HQC A;  2GCJ A;  2YF0 A;  1Q67 A;  4EKU A;  4ZRJ A;  1RJ2 A;  5C6R A;  1QQG A;  2X18 A;  2YRY A;  3MPX A;  1ISN A;  2M38 A;  4XWX A;  1TJ6 A;  1P6S A;  4GN1 A;  2COC A;  4TYZ A;  2N0Y A;  2DX5 A;  3PVW A;  1NTV A;  1ZVR A;  4GMX B;  2HE7 A;  5KQ4 A;  2J59 M;  3HK0 A;  1E5W A;  2Z0Q A;  4GZU A;  1M7R A;  2QKL A;  4A6F B;  5CLQ B;  2PZ1 A;  1FHX A;  1MIZ B;  2L1C A;  3O96 A;  2D2Q A;  1U5D A;  1K5G B;  3A98 B;  2KGX B;  1GC6 A;  3KRW A;  5CLL B;  1XD4 A;  2Y7B A;  1WG7 A;  3RCP A;  2K00 A;  2R0D A;  1XCG A;  5C79 A;  2EC1 A;  4TKN A;  3NSU A;  3PP2 A;  5L81 A;  2W2W A;  3OAN A;  1M7E A;  2LOZ A;  2P8V A;  1Y5O A;  1KZG A;  3F0W A;  3SO6 A;  2Z0P A;  4CHJ A;  3HW2 B;  4GXB A;  5D3W A;  5GOW B;  3T06 A;  1MK7 B;  4HB4 B;  2VKI A;  3MDB C;  1ZSQ A;  3PVL A;  4HAZ B;  4WVF B;  1WVH A;  1X86 A;  2Y8F A;  3ULC A;  3TVV A;  4A5K A;  3SV1 A;  3SYX A;  2ELB A;  2NZ8 B;  4HAV B;  2DYQ A;  4DBB A;  1FOE A;  3F5R A;  4K81 A;  4KHA A;  4EMO A;  1X11 A;  5J3T A;  1P3R A;  2ROV A;  2K2J A;  3G9W A;  4CHM A;  2H7D A;  3KZ1 A;  3VIA A;  1V88 A;  1FGY A;  4HAT B;  2D9Z A;  2COF A;  1W1G A;  1DYN A;  3A8P A;  1XX0 A;  2IYB A;  3AU5 A;  4IFS A;  2YSZ A;  1OQN A;  4WSF A;  2DYN A;  1P5T A;  2DKQ A;  2W2X C;  4P7I A;  1V5P A;  4K2P A;  2CAY A;  1MPH A;  1UNR A;  4NSW A;  2H7E A;  3SUZ A;  2ADZ A;  1V5U A;  2DTC A;  5LOP B;  2P0D A;  1FHO A;  1N3H A;  1WGQ A;  3TW1 A;  2RLO A;  3DXD A;  4F7H A;  2GCL A;  4L6E A;  3FSS A;  1KZ7 A;  1GC7 A;  5HE2 A;  3KY9 A;  2DKP A;  2P0H A;  3LJU X;  2YS5 A;  3GYO A;  1UNQ A;  2D9X A;  4A6K A;  3PVU A;  3TFM A;  5HE1 A;  1GG3 A;  3CIK A;  1U2B A;  3FEH A;  4KHB B;  2DX1 A;  1W1H A;  3BJI A;  5KCV A;  1TQZ A;  5D27 A;  2L2I A;  1Z87 A;  1BTK A;  5J3Q A;  1I2H A;  2DA0 A;  3FM8 C;  4D0N B;  4MK0 A;  1AQC A;  1V5M A;  4HB2 B;  2DN6 A;  4MT7 A;  3D8E A;  3IVF A;  4HAW B;  2Y8G A;  1EGX A;  1BWN A;  1DBH A;  2I1K A;  1XOD A;  2COA A;  1XKE A;  2W2X D;  2DLW A;  2P0F A;  5DHF B;  4HAY B;  5JHG A;  3SNH A;  3DXE A;  1XR0 B;  4DX8 A;  5C16 A;  2OQB A;  1WJ1 A;  2CY4 A;  3N7C A;  2IFS A;  1PMS A;  1EVH A;  2RVB B;  3BIN A;  4HHV A;  2D9V A;  3VOQ A;  3ODO A;  4ZRK A;  2KCJ A;  4PQ0 A;  2Q13 A;  4F7U P;  3ODW A;  4A6F A;  4HDO A;  4HAX B;  2K2U A;  5D3V A;  2LYD A;  4EJN A;  3ZDT A;  4C0A A;  1LW3 A;  3QIJ A;  1EAZ A;  1W1D A;  4BBK A;  5LON B;  5EFX A;  3PSC A;  2COD A;  1BAK A;  3AU4 A;  2YT1 A;  2D9W A;  1DDM A;  3P6A A;  3X23 A;  2FJL A;  1B55 A;  2Z0O A;  3D8D A;  3WA0 A;  2E2X A;  2LOX A;  2N23 A;  2QKM A;  4DXA B;  5D3X A;  2MFQ A;  4PNK A;  4K2O A;  4HB0 B;  2GS0 A;  2AL6 A;  2RNR B;  3KRX A;  2YS3 A;  1UPQ A;  3ML4 A;  4YL8 A;  1ZC4 B;  2UVM A;  2D11 A;  2J0K A;  4KHO A;  5JLJ B;  1I7A A;  1UNP A;  1Y19 B;  4IOY X;  1SGH A;  2D10 A;  1X05 A;  2J0M A;  2LG1 A;  4B6H A;  4F7G A;  3V5W A;  1MK9 B;  2GJY A;  1FB8 A;  1NTY A;  1DRO A;  3QWM A;  4IAP A;  2UZR A;  4KAX B;  1SHC A;  1NU2 A;  1MKE A;  5DI9 B;  5J3Y A;  5FI1 A;  2YS1 A;  3GYP A;  1FGZ A;  3PEG A;  2I5C A;  3ODX A;  4A6H A;  2KUP A;  2MDX A;  2YVC A;  4GMV A;  5HE3 A;  2D4Q A;  2OTX A;  1J19 A;  3DXC A;  4CYE A;  1LB1 A;  3U7D A;  2CY5 A;  5JHH A;  3D8F A;  1TXD A;  5DH9 B;  4ZRI A;  1WI1 A;  1U5E A;  4NY0 A;  3P7Z A;  2ROZ B;  1U27 A;  1V89 A;  2RSG A;  2EMT A;  5C5B A;  1FAO A;  2NMB A;  4HAU B;  1PFJ A;  3ULB A;  4K17 A;  1BTN A;  1J0W A;  1X1G A;  3CXB B;  2EMS A;  3AJ4 A;  3PZD A;  4KVG B;  4Z2M B;  1U5G A;  1RRP B;  2YT0 A;  1H4R A;  1H10 A;  2J0J A;  5DHA B;  1ZM0 A;  2MWN B;  2BCJ A;  3KSY A;  2RUK B;  2DHJ A;  2DHK A;  1UPR A;  2I1J A;  1IRS A;  3UZT A;  1DDW A;  3WYF B;  2V76 A;  1NI2 A;  1DDV A;  5FI0 A;  2RGN B;  3A8Q A;  1V61 A;  2ELA A;  2R09 A;  1AWE A;  2DHI A;  2ZPY A; 
#chains in the Genus database with same CATH topology
 2I5F A;  2DFK A;  2LKO A;  4GPT B;  2XQN M;  5KQ1 A;  3NW8 A;  3M1I B;  5C5B B;  2M14 A;  3TCA A;  4CSQ A;  4WJ7 A;  1U5F A;  4GNK B;  4HDQ A;  1K5D B;  4MY6 A;  3U8Z A;  5D3Y A;  1OY2 A;  2JP2 A;  3NWD A;  4HB3 B;  1OMW A;  2AEH A;  4H8S A;  2VRW B;  4YON A;  4QXA B;  1WJM A;  1FHW A;  2MKR A;  3TO1 A;  1PLS A;  2VSZ A;  1WGU A;  3PG7 A;  1U29 A;  1EF1 A;  5HE0 A;  1MAI A;  2CRF A;  1KI1 B;  2HTH B;  3ZVR A;  5LG4 B;  2D9Y A;  3QBV B;  1ZC3 B;  1X1F A;  5I2M A;  1QC6 A;  2LUL A;  1UEF A;  1MIX A;  2UZS A;  4DX9 0;  4Y94 A;  4Z2N A;  2Z59 A;  2EJ8 A;  2G35 A;  5DIF B;  5JP4 A;  3HQC A;  2GCJ A;  2YF0 A;  1Q67 A;  4EKU A;  4ZRJ A;  1RJ2 A;  5C6R A;  1QQG A;  2X18 A;  2YRY A;  3MPX A;  1ISN A;  2M38 A;  4XWX A;  1TJ6 A;  1P6S A;  4GN1 A;  2COC A;  4TYZ A;  2N0Y A;  2DX5 A;  3PVW A;  3B77 A;  1NTV A;  1ZVR A;  4GMX B;  2HE7 A;  5KQ4 A;  2J59 M;  3HK0 A;  1E5W A;  2Z0Q A;  4GZU A;  1M7R A;  2QKL A;  4A6F B;  5CLQ B;  2PZ1 A;  1FHX A;  3DCX A;  4OSN A;  1MIZ B;  2L1C A;  3O96 A;  2D2Q A;  1U5D A;  1K5G B;  2KR0 A;  3A98 B;  2ZKM X;  2KGX B;  1GC6 A;  3KRW A;  5CLL B;  1XD4 A;  2Y7B A;  1WG7 A;  2NBV A;  3RCP A;  2K00 A;  2R0D A;  1XCG A;  5C79 A;  2EC1 A;  4TKN A;  3NSU A;  3PP2 A;  5L81 A;  2W2W A;  3OAN A;  1M7E A;  2LOZ A;  2P8V A;  1Y5O A;  1KZG A;  3F0W A;  4QJ3 B;  2Z0P A;  3SO6 A;  4CHJ A;  3U12 A;  3HW2 B;  2GUM A;  4GXB A;  5D3W A;  5GOW B;  3T06 A;  1MK7 B;  4HB4 B;  2VKI A;  3MDB C;  1ZSQ A;  3PVL A;  4HAZ B;  4WVF B;  1WVH A;  1X86 A;  2Y8F A;  3ULC A;  3TVV A;  4A5K A;  3SV1 A;  3SYX A;  2ELB A;  2NZ8 B;  4HAV B;  3HSA A;  2DYQ A;  4DBB A;  1FOE A;  3F5R A;  4K81 A;  4KHA A;  4EMO A;  1X11 A;  5J3T A;  1P3R A;  1MI1 A;  2ROV A;  2K2J A;  3G9W A;  4CHM A;  2H7D A;  3KZ1 A;  3VIA A;  1V88 A;  1FGY A;  4HAT B;  2D9Z A;  2COF A;  1W1G A;  1DYN A;  3A8P A;  1XX0 A;  2IYB A;  2K49 A;  3AU5 A;  4IFS A;  2YSZ A;  1OQN A;  4WSF A;  2DYN A;  1P5T A;  3NWA A;  2DKQ A;  2W2X C;  4P7I A;  1V5P A;  4K2P A;  2CAY A;  1MPH A;  1UNR A;  4NSW A;  2H7E A;  3SUZ A;  2ADZ A;  1V5U A;  2DTC A;  5LOP B;  2P0D A;  1FHO A;  2Z13 A;  1N3H A;  1WGQ A;  3TW1 A;  4OT1 A;  2RLO A;  3DXD A;  4F7H A;  2GCL A;  4L6E A;  3FSS A;  1KZ7 A;  1GC7 A;  2YT2 A;  2KIG A;  4GOU A;  5HE2 A;  3KY9 A;  2DKP A;  4D6W A;  2P0H A;  3LJU X;  2YS5 A;  3GYO A;  1UNQ A;  2D9X A;  4A6K A;  3PVU A;  3TFM A;  5HE1 A;  1GG3 A;  3CIK A;  1U2B A;  3FEH A;  4KHB B;  2DX1 A;  3BJI A;  1W1H A;  2Z14 A;  5KCV A;  1TQZ A;  5D27 A;  2L2I A;  1Z87 A;  1BTK A;  5J3Q A;  1I2H A;  2DA0 A;  3FM8 C;  4DIX A;  4D0N B;  4MK0 A;  1AQC A;  1V5M A;  4HB2 B;  2DN6 A;  4MT7 A;  3D8E A;  3IVF A;  4HAW B;  2Y8G A;  1EGX A;  1BWN A;  4QJ4 B;  1DBH A;  2I1K A;  1XOD A;  2COA A;  1XKE A;  2W2X D;  2DLW A;  3A58 A;  2P0F A;  5DHF B;  4HAY B;  5JHG A;  3SNH A;  3OHM B;  3DXE A;  1XR0 B;  5IRS A;  4DX8 A;  5C16 A;  2OQB A;  1WJ1 A;  2CY4 A;  2KIE A;  3N7C A;  2IFS A;  1PMS A;  1EVH A;  2RVB B;  3BIN A;  2RRF A;  4HHV A;  2D9V A;  3VOQ A;  3ODO A;  4KHB A;  4ZRK A;  2KCJ A;  4PQ0 A;  2Q13 A;  2FJU B;  4F7U P;  3ODW A;  4A6F A;  4HDO A;  4HAX B;  2K2U A;  5D3V A;  2LYD A;  4EJN A;  3ZDT A;  4C0A A;  1LW3 A;  3QIJ A;  1EAZ A;  1W1D A;  4BBK A;  2R2Y A;  5LON B;  5EFX A;  3PSC A;  2COD A;  1BAK A;  3AU4 A;  2YT1 A;  2D9W A;  1DDM A;  3P6A A;  3X23 A;  2FJL A;  5I2S A;  1B55 A;  2Z0O A;  3D8D A;  3WA0 A;  2E2X A;  2LOX A;  2N23 A;  2QKM A;  4DXA B;  5D3X A;  2MFQ A;  4PNK A;  4K2O A;  4HB0 B;  2GS0 A;  2AL6 A;  2RNR B;  3KRX A;  2YS3 A;  1UPQ A;  3ML4 A;  4YL8 A;  1ZC4 B;  2UVM A;  2D11 A;  2J0K A;  4L1R A;  4KHO A;  5JLJ B;  1I7A A;  1UNP A;  1Y19 B;  4IOY X;  3FVC A;  1SGH A;  2D10 A;  1X05 A;  2J0M A;  2LG1 A;  4B6H A;  4F7G A;  3V5W A;  1MK9 B;  2GJY A;  1FB8 A;  1NTY A;  1DRO A;  3QWM A;  4IAP A;  2UZR A;  4KAX B;  1SHC A;  1NU2 A;  1MKE A;  3HIE A;  5DI9 B;  5J3Y A;  5FI1 A;  2YS1 A;  3GYP A;  1FGZ A;  3PEG A;  2I5C A;  2KUQ A;  3ODX A;  4A6H A;  2KUP A;  2MDX A;  2YVC A;  4GMV A;  5HE3 A;  2D4Q A;  2OTX A;  1J19 A;  3DXC A;  4CYE A;  1LB1 A;  3U7D A;  2CY5 A;  5JHH A;  3D8F A;  1TXD A;  5DH9 B;  4QJ5 B;  4ZRI A;  1WI1 A;  1U5E A;  4NY0 A;  3P7Z A;  2ROZ B;  1U27 A;  1V89 A;  2RSG A;  2Z4D A;  2EMT A;  5C5B A;  1FAO A;  2NMB A;  4HAU B;  1PFJ A;  3ULB A;  1T77 A;  4K17 A;  1BTN A;  1J0W A;  1X1G A;  3CXB B;  2EMS A;  2K8E A;  3AJ4 A;  3PZD A;  4HSI A;  4KVG B;  1ZYI A;  4Z2M B;  1U5G A;  1RRP B;  2YT0 A;  1H4R A;  1H10 A;  2J0J A;  5M4Y B;  5DHA B;  1ZM0 A;  2MWN B;  2BCJ A;  3KSY A;  2RUK B;  2DHJ A;  2DHK A;  1UPR A;  2I1J A;  1IRS A;  3NWF A;  3UZT A;  1DDW A;  3WYF B;  2V76 A;  1NI2 A;  1DDV A;  5FI0 A;  2RGN B;  3A8Q A;  1V61 A;  2ELA A;  2R09 A;  1AWE A;  2DHI A;  2ZPY A; 
#chains in the Genus database with same CATH homology
 2I5F A;  2DFK A;  2LKO A;  4GPT B;  2XQN M;  5KQ1 A;  3M1I B;  5C5B B;  2M14 A;  3TCA A;  4WJ7 A;  1U5F A;  4HDQ A;  1K5D B;  4MY6 A;  3U8Z A;  5D3Y A;  1OY2 A;  2JP2 A;  4HB3 B;  1OMW A;  2AEH A;  4H8S A;  2VRW B;  4YON A;  1WJM A;  1FHW A;  2MKR A;  3TO1 A;  1PLS A;  2VSZ A;  1WGU A;  3PG7 A;  1U29 A;  1EF1 A;  5HE0 A;  1MAI A;  2CRF A;  1KI1 B;  2HTH B;  3ZVR A;  2D9Y A;  3QBV B;  1ZC3 B;  1X1F A;  1QC6 A;  2LUL A;  1UEF A;  1MIX A;  2UZS A;  4DX9 0;  4Y94 A;  4Z2N A;  2EJ8 A;  2G35 A;  5DIF B;  5JP4 A;  3HQC A;  2GCJ A;  2YF0 A;  1Q67 A;  4EKU A;  4ZRJ A;  1RJ2 A;  5C6R A;  1QQG A;  2X18 A;  2YRY A;  3MPX A;  1ISN A;  2M38 A;  4XWX A;  1TJ6 A;  1P6S A;  4GN1 A;  2COC A;  4TYZ A;  2N0Y A;  2DX5 A;  3PVW A;  1NTV A;  1ZVR A;  4GMX B;  2HE7 A;  5KQ4 A;  2J59 M;  3HK0 A;  1E5W A;  2Z0Q A;  4GZU A;  1M7R A;  2QKL A;  4A6F B;  5CLQ B;  2PZ1 A;  1FHX A;  1MIZ B;  2L1C A;  3O96 A;  2D2Q A;  1U5D A;  1K5G B;  3A98 B;  2KGX B;  1GC6 A;  3KRW A;  5CLL B;  1XD4 A;  2Y7B A;  1WG7 A;  3RCP A;  2K00 A;  2R0D A;  1XCG A;  5C79 A;  2EC1 A;  4TKN A;  3NSU A;  3PP2 A;  5L81 A;  2W2W A;  3OAN A;  1M7E A;  2LOZ A;  2P8V A;  1Y5O A;  1KZG A;  3F0W A;  3SO6 A;  2Z0P A;  4CHJ A;  3HW2 B;  4GXB A;  5D3W A;  5GOW B;  3T06 A;  1MK7 B;  4HB4 B;  2VKI A;  3MDB C;  1ZSQ A;  3PVL A;  4HAZ B;  4WVF B;  1WVH A;  1X86 A;  2Y8F A;  3ULC A;  3TVV A;  4A5K A;  3SV1 A;  3SYX A;  2ELB A;  2NZ8 B;  4HAV B;  2DYQ A;  4DBB A;  1FOE A;  3F5R A;  4K81 A;  4KHA A;  4EMO A;  1X11 A;  5J3T A;  1P3R A;  2ROV A;  2K2J A;  3G9W A;  4CHM A;  2H7D A;  3KZ1 A;  3VIA A;  1V88 A;  1FGY A;  4HAT B;  2D9Z A;  2COF A;  1W1G A;  1DYN A;  3A8P A;  1XX0 A;  2IYB A;  3AU5 A;  4IFS A;  2YSZ A;  1OQN A;  4WSF A;  2DYN A;  1P5T A;  2DKQ A;  2W2X C;  4P7I A;  1V5P A;  4K2P A;  2CAY A;  1MPH A;  1UNR A;  4NSW A;  2H7E A;  3SUZ A;  2ADZ A;  1V5U A;  2DTC A;  5LOP B;  2P0D A;  1FHO A;  1N3H A;  1WGQ A;  3TW1 A;  2RLO A;  3DXD A;  4F7H A;  2GCL A;  4L6E A;  3FSS A;  1KZ7 A;  1GC7 A;  5HE2 A;  3KY9 A;  2DKP A;  2P0H A;  3LJU X;  2YS5 A;  3GYO A;  1UNQ A;  2D9X A;  4A6K A;  3PVU A;  3TFM A;  5HE1 A;  1GG3 A;  3CIK A;  1U2B A;  3FEH A;  4KHB B;  2DX1 A;  1W1H A;  3BJI A;  5KCV A;  1TQZ A;  5D27 A;  2L2I A;  1Z87 A;  1BTK A;  5J3Q A;  1I2H A;  2DA0 A;  3FM8 C;  4D0N B;  4MK0 A;  1AQC A;  1V5M A;  4HB2 B;  2DN6 A;  4MT7 A;  3D8E A;  3IVF A;  4HAW B;  2Y8G A;  1EGX A;  1BWN A;  1DBH A;  2I1K A;  1XOD A;  2COA A;  1XKE A;  2W2X D;  2DLW A;  2P0F A;  5DHF B;  4HAY B;  5JHG A;  3SNH A;  3DXE A;  1XR0 B;  4DX8 A;  5C16 A;  2OQB A;  1WJ1 A;  2CY4 A;  3N7C A;  2IFS A;  1PMS A;  1EVH A;  2RVB B;  3BIN A;  4HHV A;  2D9V A;  3VOQ A;  3ODO A;  4ZRK A;  2KCJ A;  4PQ0 A;  2Q13 A;  4F7U P;  3ODW A;  4A6F A;  4HDO A;  4HAX B;  2K2U A;  5D3V A;  2LYD A;  4EJN A;  3ZDT A;  4C0A A;  1LW3 A;  3QIJ A;  1EAZ A;  1W1D A;  4BBK A;  5LON B;  5EFX A;  3PSC A;  2COD A;  1BAK A;  3AU4 A;  2YT1 A;  2D9W A;  1DDM A;  3P6A A;  3X23 A;  2FJL A;  1B55 A;  2Z0O A;  3D8D A;  3WA0 A;  2E2X A;  2LOX A;  2N23 A;  2QKM A;  4DXA B;  5D3X A;  2MFQ A;  4PNK A;  4K2O A;  4HB0 B;  2GS0 A;  2AL6 A;  2RNR B;  3KRX A;  2YS3 A;  1UPQ A;  3ML4 A;  4YL8 A;  1ZC4 B;  2UVM A;  2D11 A;  2J0K A;  4KHO A;  5JLJ B;  1I7A A;  1UNP A;  1Y19 B;  4IOY X;  1SGH A;  2D10 A;  1X05 A;  2J0M A;  2LG1 A;  4B6H A;  4F7G A;  3V5W A;  1MK9 B;  2GJY A;  1FB8 A;  1NTY A;  1DRO A;  3QWM A;  4IAP A;  2UZR A;  4KAX B;  1SHC A;  1NU2 A;  1MKE A;  5DI9 B;  5J3Y A;  5FI1 A;  2YS1 A;  3GYP A;  1FGZ A;  3PEG A;  2I5C A;  3ODX A;  4A6H A;  2KUP A;  2MDX A;  2YVC A;  4GMV A;  5HE3 A;  2D4Q A;  2OTX A;  1J19 A;  3DXC A;  4CYE A;  1LB1 A;  3U7D A;  2CY5 A;  5JHH A;  3D8F A;  1TXD A;  5DH9 B;  4ZRI A;  1WI1 A;  1U5E A;  4NY0 A;  3P7Z A;  2ROZ B;  1U27 A;  1V89 A;  2RSG A;  2EMT A;  5C5B A;  1FAO A;  2NMB A;  4HAU B;  1PFJ A;  3ULB A;  4K17 A;  1BTN A;  1J0W A;  1X1G A;  3CXB B;  2EMS A;  3AJ4 A;  3PZD A;  4KVG B;  4Z2M B;  1U5G A;  1RRP B;  2YT0 A;  1H4R A;  1H10 A;  2J0J A;  5DHA B;  1ZM0 A;  2MWN B;  2BCJ A;  3KSY A;  2RUK B;  2DHJ A;  2DHK A;  1UPR A;  2I1J A;  1IRS A;  3UZT A;  1DDW A;  3WYF B;  2V76 A;  1NI2 A;  1DDV A;  5FI0 A;  2RGN B;  3A8Q A;  1V61 A;  2ELA A;  2R09 A;  1AWE A;  2DHI A;  2ZPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...