2LULA

Solution nmr structure of ph domain of tyrosine-protein kinase tec from homo sapiens, northeast structural genomics consortium (nesg) target hr3504c
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
164
structure length
164
Chain Sequence
MGHHHHHHSHMNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase Tec
publication title Solution NMR Structure of PH Domain of Tyrosine-protein kinase Tec from Homo sapiens, Northeast Structural Genomics Consortium (NESG) Target HR3504C
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 31
structure length 164
sequence length 164
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
A PF00779 BTK BTK motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2lulA00
2I1JA 3P7ZA 2YT0A 3PVUA 2D9YA 1FB8A 4KHAA 4A6KA 2Z0OA 4DXAB 4GZUA 2K2UA 3U8ZA 3HQCA 2LKOA 1Z87A 3PZDA 2W2XD 1V88A 5HE2A 4KAXB 4ZRJA 3KY9A 5JP4A 4EKUA 1BTNA 2BCJA 2Z0QA 1XODA 4PNKA 2COCA 1OMWA 1EGXA 3D8EA 2L1CA 2NZ8B 1V61A 2AEHA 5FI1A 5D3XA 4DX90 4B6HA 3AU4A 1FHWA 1RJ2A 4HB2B 1K5GB 2D11A 3BJIA 3VIAA 4IAPA 1DDMA 2UZSA 3IVFA 2OQBA 2DFKA 2G35A 1TJ6A 2MWNB 1TXDA 2YS3A 4XWXA 2GCLA 3CXBB 4HAZB 2VRWB 1W1HA 3A8QA 5DH9B 1KZGA 1H10A 4GMVA 2YF0A 2V76A 3PVWA 3UZTA 1FGYA 1WVHA 4KHBB 2IFSA 1XCGA 2W2XC 5CLLB 3PP2A 3ULBA 2DX5A 1KI1B 2DYNA 3KRXA 2ROZB 4Z2NA 4P7IA 4A6FB 4CHJA 1PFJA 1ZM0A 3OANA 2YS5A 3V5WA 4IOYX 5CLQB 2P0DA 4CHMA 3ODWA 3AU5A 4ZRIA 5D27A 2YT1A 3AJ4A 2ELAA 2LOXA 2W2WA 4A6FA 2QKMA 3PG7A 3ODXA 2YS1A 5L81A 4HATB 3X23A 2GS0A 4MK0A 3PVLA 2D4QA 1U27A 5HE1A 1ZSQA 4MY6A 2ROVA 3BINA 1MAIA 2ADZA 5JHGA 2JP2A 4Z2MB 2N0YA 2J0KA 1X1GA 2MKRA 3ODOA 3SNHA 5JHHA 2CY5A 2E2XA 5D3VA 2M14A 4HDQA 5HE3A 1DDVA 5DHFB 2D9WA 3TW1A 4C0AA 2CAYA 5J3YA 3SYXA 1B55A 1ZC3B 2ZPYA 1UPRA 1FHOA 2DTCA 3TCAA 4WJ7A 4PQ0A 3HW2B 3DXEA 2VKIA 3WA0A 1DDWA 2GJYA 1Y5OA 3KRWA 5J3QA 1NU2A 1WGQA 1UNQA 2MFQA 1IRSA 4HDOA 1EAZA 2RUKB 2Y8GA 3T06A 3GYPA 3WYFB 4IFSA 2D9XA 4GXBA 4F7GA 4A6HA 5C79A 1XD4A 3D8FA 1AQCA 1UEFA 3CIKA 5DHAB 3QIJA 5J3TA 4HB0B 1U29A 3G9WA 2I5FA 1WGUA 4HB3B 1MK9B 1FOEA 1KZ7A 2D2QA 2FJLA 2DA0A 4GPTB 4HHVA 4K81A 5JLJB 1OY2A 4L6EA 2UZRA 4NY0A 2HE7A 1H4RA 1XR0B 3KZ1A 1X1FA 4HB4B 2VSZA 1UNPA 1FAOA 1E5WA 5HE0A 2LOZA 1BTKA 4F7UP 3TFMA 1X86A 1QQGA 2ELBA 4TKNA 2DN6A 1DBHA 2L2IA 2P0HA 1J0WA 4KHOA 2P8VA 5DIFB 1ZVRA 2MDXA 3MDBC 2NMBA 1I7AA 4WVFB 1U2BA 2H7EA 4K17A 2K00A 3O96A 3QWMA 3DXCA 2YVCA 3LJUX 1X11A 2HTHB 4WSFA 4Y94A 2KCJA 5EFXA 2RGNB 3M1IB 2OTXA 5C6RA 1QC6A 5C5BB 1V5UA 5LONB 2COAA 3VOQA 1AWEA 1PLSA 2P0FA 1U5DA 1Y19B 5DI9B 1EF1A 1U5FA 3RCPA 1M7RA 5C5BA 4K2OA 2CODA 2CRFA 1WG7A 2DHIA 2Z0PA 3FEHA 1GC6A 2Y8FA 4MT7A 1NTVA 1EVHA 1BAKA 1FHXA 1WI1A 1W1DA 4K2PA 2COFA 2RVBB 2YSZA 1ZC4B 3A98B 3FM8C 2I1KA 3TO1A 1P3RA 1SGHA 1U5EA 2PZ1A 1ISNA 2M38A 2I5CA 3F5RA 1MIXA 2IYBA 1PMSA 4GN1A 1MK7B 3ZVRA 1UNRA 1M7EA 1FGZA 1I2HA 2Q13A 3P6AA 5D3YA 4YONA 5D3WA 2LYDA 1NI2A 2DX1A 2RLOA 2XQNM 2RNRB 4EMOA 2EJ8A 1TQZA 1V5PA 2K2JA 2GCJA 2QKLA 1P5TA 2CY4A 3GYOA 2N23A 5GOWB 1MPHA 1P6SA 1V89A 1BWNA 4HAXB 1W1GA 1XKEA 3FSSA 3ZDTA 3SV1A 2YRYA 3QBVB 4BBKA 2UVMA 1SHCA 2LG1A 2D9VA 3ULCA 3HK0A 3NSUA 2EMTA 5KQ1A 2AL6A 3KSYA 3A8PA 4GMXB 4ZRKA 1XX0A 5FI0A 4NSWA 1DYNA 4TYZA 1N3HA 1MIZB 2D10A 1RRPB 1MKEA 4DX8A 4A5KA 4F7HA 2DYQA 4H8SA 1UPQA 2EMSA 1K5DB 3TVVA 4D0NB 3SO6A 4HAUB 5KCVA 3N7CA 3PSCA 4EJNA 2DHKA 2J0JA 3SUZA 4HAVB 4HAYB 3D8DA 3ML4A 1WJMA 1LB1A 2Y7BA 1OQNA 1GC7A 2KUPA 5LOPB 2D9ZA 1WJ1A 2J0MA 1X05A 2R09A 4CYEA 2H7DA 1J19A 2J59M 2DLWA 1DROA 4DBBA 1U5GA 4YL8A 2R0DA 1GG3A 4HAWB 2KGXB 5C16A 3MPXA 2DKQA 4KVGB 1NTYA 3U7DA 2LULA 2DHJA 1Q67A 2DKPA 1LW3A 3PEGA 2EC1A 2X18A 3F0WA 3DXDA 1V5MA 5KQ4A 2RSGA
chains in the Genus database with same CATH superfamily
2I1JA 3P7ZA 2YT0A 3PVUA 2D9YA 1FB8A 4KHAA 4A6KA 2Z0OA 4DXAB 4GZUA 2KIGA 2K2UA 3U8ZA 3HQCA 2LKOA 1MI1A 1Z87A 3PZDA 2W2XD 5LG4B 1V88A 5HE2A 4L1RA 4KAXB 4ZRJA 3KY9A 5JP4A 4EKUA 1BTNA 2BCJA 2Z0QA 1XODA 4PNKA 2COCA 1OMWA 1EGXA 3D8EA 2L1CA 2NZ8B 1V61A 4QJ4B 2AEHA 5FI1A 5D3XA 4DX90 4B6HA 3AU4A 1FHWA 1RJ2A 4HB2B 1K5GB 2YT2A 2D11A 3BJIA 3VIAA 4IAPA 1DDMA 2UZSA 3IVFA 2OQBA 1ZYIA 2Z13A 2DFKA 2G35A 1TJ6A 2MWNB 1TXDA 2YS3A 4QXAB 4XWXA 4CSQA 2GCLA 3CXBB 4HAZB 2VRWB 1W1HA 3A8QA 5DH9B 1KZGA 1H10A 4GMVA 3HIEA 2YF0A 2V76A 2GUMA 3PVWA 3UZTA 1FGYA 1WVHA 4KHBB 2IFSA 1XCGA 2W2XC 4OT1A 3PP2A 3NWFA 5CLLB 3ULBA 2DX5A 1KI1B 3NW8A 2DYNA 3KRXA 2ROZB 4Z2NA 4P7IA 4A6FB 4CHJA 1PFJA 3NWDA 1ZM0A 2K49A 3OANA 2YS5A 3V5WA 4IOYX 4KHBA 5CLQB 2P0DA 4CHMA 3ODWA 3AU5A 2K8EA 4ZRIA 5D27A 2YT1A 3AJ4A 2ELAA 2LOXA 2W2WA 4A6FA 2QKMA 3PG7A 3ODXA 2YS1A 5L81A 4HATB 3X23A 2GS0A 4MK0A 3PVLA 2D4QA 1U27A 5HE1A 1ZSQA 4MY6A 2ROVA 3BINA 1MAIA 2ADZA 5JHGA 2JP2A 4Z2MB 2N0YA 2J0KA 1X1GA 2MKRA 3ODOA 3SNHA 5JHHA 2CY5A 2E2XA 5D3VA 2M14A 4HDQA 5HE3A 1DDVA 5DHFB 2D9WA 3TW1A 4C0AA 2CAYA 5J3YA 3SYXA 1B55A 1ZC3B 2ZPYA 1UPRA 1FHOA 2DTCA 3TCAA 4WJ7A 4PQ0A 3HW2B 3DXEA 2VKIA 3WA0A 1DDWA 2GJYA 1Y5OA 3KRWA 5J3QA 1NU2A 1WGQA 1UNQA 2MFQA 1IRSA 4HDOA 1EAZA 2RUKB 2Y8GA 3T06A 3GYPA 3WYFB 4IFSA 2D9XA 4GXBA 4F7GA 4A6HA 5C79A 1XD4A 3D8FA 1AQCA 1UEFA 3CIKA 5DHAB 3QIJA 5J3TA 4HB0B 1U29A 3G9WA 2I5FA 1WGUA 4HB3B 1MK9B 1FOEA 1KZ7A 3U12A 2D2QA 2KR0A 4HSIA 2FJLA 2DA0A 4GPTB 4HHVA 4K81A 3B77A 5JLJB 1OY2A 4L6EA 2UZRA 4NY0A 2HE7A 1H4RA 1XR0B 3KZ1A 1X1FA 4HB4B 2VSZA 4D6WA 1UNPA 1FAOA 2KUQA 1E5WA 5HE0A 2LOZA 1BTKA 4F7UP 3TFMA 1X86A 1QQGA 2ELBA 4TKNA 2DN6A 1DBHA 2L2IA 2P0HA 1J0WA 4QJ3B 4KHOA 2P8VA 5DIFB 1ZVRA 2MDXA 3MDBC 5I2MA 2NMBA 1I7AA 4WVFB 1U2BA 2H7EA 4K17A 2K00A 3A58A 3O96A 3QWMA 3DXCA 2YVCA 3LJUX 2KIEA 1X11A 2HTHB 4WSFA 4Y94A 2KCJA 5EFXA 2RGNB 3M1IB 2OTXA 5C6RA 1QC6A 5C5BB 3NWAA 1V5UA 5LONB 3HSAA 2COAA 3VOQA 1AWEA 1PLSA 2P0FA 1U5DA 1Y19B 5DI9B 1EF1A 1U5FA 3RCPA 1M7RA 5C5BA 4K2OA 2ZKMX 2CODA 2CRFA 1WG7A 2DHIA 2Z0PA 3FEHA 1GC6A 2Y8FA 4MT7A 1NTVA 1EVHA 4QJ5B 1FHXA 1WI1A 1BAKA 5M4YB 1W1DA 4K2PA 2COFA 2RVBB 2YSZA 1ZC4B 3A98B 3FM8C 2FJUB 2I1KA 3TO1A 1P3RA 1SGHA 1U5EA 2PZ1A 1ISNA 2M38A 2I5CA 3F5RA 1MIXA 2IYBA 1PMSA 2Z4DA 4GN1A 1MK7B 3ZVRA 1UNRA 1M7EA 1FGZA 1I2HA 2Q13A 3P6AA 4GOUA 5D3YA 4YONA 5D3WA 2LYDA 1NI2A 2DX1A 2RLOA 2XQNM 4DIXA 2RNRB 4EMOA 2EJ8A 1TQZA 1V5PA 2K2JA 2GCJA 2QKLA 1P5TA 1T77A 2CY4A 3FVCA 3GYOA 2N23A 5GOWB 1MPHA 2NBVA 1P6SA 1V89A 1BWNA 4HAXB 1W1GA 1XKEA 3FSSA 3ZDTA 3SV1A 2YRYA 2Z59A 3QBVB 4BBKA 2R2YA 2UVMA 1SHCA 2LG1A 2D9VA 3ULCA 3OHMB 3HK0A 3NSUA 2EMTA 5KQ1A 2AL6A 3KSYA 3A8PA 4GMXB 4ZRKA 1XX0A 5FI0A 4NSWA 1DYNA 4TYZA 1N3HA 1MIZB 2D10A 3DCXA 1RRPB 1MKEA 4DX8A 4A5KA 4F7HA 2DYQA 2RRFA 4H8SA 1UPQA 2EMSA 1K5DB 3TVVA 4D0NB 3SO6A 4HAUB 5KCVA 3N7CA 3PSCA 4EJNA 2DHKA 2J0JA 3SUZA 4HAVB 5IRSA 4HAYB 3D8DA 3ML4A 1WJMA 1LB1A 2Y7BA 1OQNA 1GC7A 2KUPA 5LOPB 2D9ZA 1WJ1A 2J0MA 1X05A 2R09A 4CYEA 2H7DA 1J19A 2J59M 2DLWA 2Z14A 4OSNA 4DBBA 1DROA 1U5GA 4YL8A 2R0DA 1GG3A 4HAWB 5I2SA 2KGXB 5C16A 3MPXA 4GNKB 2DKQA 4KVGB 1NTYA 3U7DA 2LULA 2DHJA 1Q67A 2DKPA 1LW3A 3PEGA 2EC1A 2X18A 3F0WA 3DXDA 1V5MA 5KQ4A 2RSGA
chains in the Genus database with same CATH topology
2I1JA 3P7ZA 2YT0A 3PVUA 2D9YA 1FB8A 4KHAA 4A6KA 2Z0OA 4DXAB 4GZUA 2K2UA 3U8ZA 3HQCA 2LKOA 1Z87A 3PZDA 2W2XD 1V88A 5HE2A 4KAXB 4ZRJA 3KY9A 5JP4A 4EKUA 1BTNA 2BCJA 2Z0QA 1XODA 4PNKA 2COCA 1OMWA 1EGXA 3D8EA 2L1CA 2NZ8B 1V61A 2AEHA 5FI1A 5D3XA 4DX90 4B6HA 3AU4A 1FHWA 1RJ2A 4HB2B 1K5GB 2D11A 3BJIA 3VIAA 4IAPA 1DDMA 2UZSA 3IVFA 2OQBA 2DFKA 2G35A 1TJ6A 2MWNB 1TXDA 2YS3A 4XWXA 2GCLA 3CXBB 4HAZB 2VRWB 1W1HA 3A8QA 5DH9B 1KZGA 1H10A 4GMVA 2YF0A 2V76A 3PVWA 3UZTA 1FGYA 1WVHA 4KHBB 2IFSA 1XCGA 2W2XC 5CLLB 3PP2A 3ULBA 2DX5A 1KI1B 2DYNA 3KRXA 2ROZB 4Z2NA 4P7IA 4A6FB 4CHJA 1PFJA 1ZM0A 3OANA 2YS5A 3V5WA 4IOYX 5CLQB 2P0DA 4CHMA 3ODWA 3AU5A 4ZRIA 5D27A 2YT1A 3AJ4A 2ELAA 2LOXA 2W2WA 4A6FA 2QKMA 3PG7A 3ODXA 2YS1A 5L81A 4HATB 3X23A 2GS0A 4MK0A 3PVLA 2D4QA 1U27A 5HE1A 1ZSQA 4MY6A 2ROVA 3BINA 1MAIA 2ADZA 5JHGA 2JP2A 4Z2MB 2N0YA 2J0KA 1X1GA 2MKRA 3ODOA 3SNHA 5JHHA 2CY5A 2E2XA 5D3VA 2M14A 4HDQA 5HE3A 1DDVA 5DHFB 2D9WA 3TW1A 4C0AA 2CAYA 5J3YA 3SYXA 1B55A 1ZC3B 2ZPYA 1UPRA 1FHOA 2DTCA 3TCAA 4WJ7A 4PQ0A 3HW2B 3DXEA 2VKIA 3WA0A 1DDWA 2GJYA 1Y5OA 3KRWA 5J3QA 1NU2A 1WGQA 1UNQA 2MFQA 1IRSA 4HDOA 1EAZA 2RUKB 2Y8GA 3T06A 3GYPA 3WYFB 4IFSA 2D9XA 4GXBA 4F7GA 4A6HA 5C79A 1XD4A 3D8FA 1AQCA 1UEFA 3CIKA 5DHAB 3QIJA 5J3TA 4HB0B 1U29A 3G9WA 2I5FA 1WGUA 4HB3B 1MK9B 1FOEA 1KZ7A 2D2QA 2FJLA 2DA0A 4GPTB 4HHVA 4K81A 5JLJB 1OY2A 4L6EA 2UZRA 4NY0A 2HE7A 1H4RA 1XR0B 3KZ1A 1X1FA 4HB4B 2VSZA 1UNPA 1FAOA 1E5WA 5HE0A 2LOZA 1BTKA 4F7UP 3TFMA 1X86A 1QQGA 2ELBA 4TKNA 2DN6A 1DBHA 2L2IA 2P0HA 1J0WA 4KHOA 2P8VA 5DIFB 1ZVRA 2MDXA 3MDBC 2NMBA 1I7AA 4WVFB 1U2BA 2H7EA 4K17A 2K00A 3O96A 3QWMA 3DXCA 2YVCA 3LJUX 1X11A 2HTHB 4WSFA 4Y94A 2KCJA 5EFXA 2RGNB 3M1IB 2OTXA 5C6RA 1QC6A 5C5BB 1V5UA 5LONB 2COAA 3VOQA 1AWEA 1PLSA 2P0FA 1U5DA 1Y19B 5DI9B 1EF1A 1U5FA 3RCPA 1M7RA 5C5BA 4K2OA 2CODA 2CRFA 1WG7A 2DHIA 2Z0PA 3FEHA 1GC6A 2Y8FA 4MT7A 1NTVA 1EVHA 1BAKA 1FHXA 1WI1A 1W1DA 4K2PA 2COFA 2RVBB 2YSZA 1ZC4B 3A98B 3FM8C 2I1KA 3TO1A 1P3RA 1SGHA 1U5EA 2PZ1A 1ISNA 2M38A 2I5CA 3F5RA 1MIXA 2IYBA 1PMSA 4GN1A 1MK7B 3ZVRA 1UNRA 1M7EA 1FGZA 1I2HA 2Q13A 3P6AA 5D3YA 4YONA 5D3WA 2LYDA 1NI2A 2DX1A 2RLOA 2XQNM 2RNRB 4EMOA 2EJ8A 1TQZA 1V5PA 2K2JA 2GCJA 2QKLA 1P5TA 2CY4A 3GYOA 2N23A 5GOWB 1MPHA 1P6SA 1V89A 1BWNA 4HAXB 1W1GA 1XKEA 3FSSA 3ZDTA 3SV1A 2YRYA 3QBVB 4BBKA 2UVMA 1SHCA 2LG1A 2D9VA 3ULCA 3HK0A 3NSUA 2EMTA 5KQ1A 2AL6A 3KSYA 3A8PA 4GMXB 4ZRKA 1XX0A 5FI0A 4NSWA 1DYNA 4TYZA 1N3HA 1MIZB 2D10A 1RRPB 1MKEA 4DX8A 4A5KA 4F7HA 2DYQA 4H8SA 1UPQA 2EMSA 1K5DB 3TVVA 4D0NB 3SO6A 4HAUB 5KCVA 3N7CA 3PSCA 4EJNA 2DHKA 2J0JA 3SUZA 4HAVB 4HAYB 3D8DA 3ML4A 1WJMA 1LB1A 2Y7BA 1OQNA 1GC7A 2KUPA 5LOPB 2D9ZA 1WJ1A 2J0MA 1X05A 2R09A 4CYEA 2H7DA 1J19A 2J59M 2DLWA 1DROA 4DBBA 1U5GA 4YL8A 2R0DA 1GG3A 4HAWB 2KGXB 5C16A 3MPXA 2DKQA 4KVGB 1NTYA 3U7DA 2LULA 2DHJA 1Q67A 2DKPA 1LW3A 3PEGA 2EC1A 2X18A 3F0WA 3DXDA 1V5MA 5KQ4A 2RSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I1J A;  3P7Z A;  2YT0 A;  3PVU A;  2D9Y A;  1FB8 A;  4KHA A;  4A6K A;  2Z0O A;  4DXA B;  4GZU A;  2K2U A;  3U8Z A;  3HQC A;  2LKO A;  1Z87 A;  3PZD A;  2W2X D;  1V88 A;  5HE2 A;  4KAX B;  4ZRJ A;  3KY9 A;  5JP4 A;  4EKU A;  1BTN A;  2BCJ A;  2Z0Q A;  1XOD A;  4PNK A;  2COC A;  1OMW A;  1EGX A;  3D8E A;  2L1C A;  2NZ8 B;  1V61 A;  2AEH A;  5FI1 A;  5D3X A;  4DX9 0;  4B6H A;  3AU4 A;  1FHW A;  1RJ2 A;  4HB2 B;  1K5G B;  2D11 A;  3BJI A;  3VIA A;  4IAP A;  1DDM A;  2UZS A;  3IVF A;  2OQB A;  2DFK A;  2G35 A;  1TJ6 A;  2MWN B;  1TXD A;  2YS3 A;  4XWX A;  2GCL A;  3CXB B;  4HAZ B;  2VRW B;  1W1H A;  3A8Q A;  5DH9 B;  1KZG A;  1H10 A;  4GMV A;  2YF0 A;  2V76 A;  3PVW A;  3UZT A;  1FGY A;  1WVH A;  4KHB B;  2IFS A;  1XCG A;  2W2X C;  5CLL B;  3PP2 A;  3ULB A;  2DX5 A;  1KI1 B;  2DYN A;  3KRX A;  2ROZ B;  4Z2N A;  4P7I A;  4A6F B;  4CHJ A;  1PFJ A;  1ZM0 A;  3OAN A;  2YS5 A;  3V5W A;  4IOY X;  5CLQ B;  2P0D A;  4CHM A;  3ODW A;  3AU5 A;  4ZRI A;  5D27 A;  2YT1 A;  3AJ4 A;  2ELA A;  2LOX A;  2W2W A;  4A6F A;  2QKM A;  3PG7 A;  3ODX A;  2YS1 A;  5L81 A;  4HAT B;  3X23 A;  2GS0 A;  4MK0 A;  3PVL A;  2D4Q A;  1U27 A;  5HE1 A;  1ZSQ A;  4MY6 A;  2ROV A;  3BIN A;  1MAI A;  2ADZ A;  5JHG A;  2JP2 A;  4Z2M B;  2N0Y A;  2J0K A;  1X1G A;  2MKR A;  3ODO A;  3SNH A;  5JHH A;  2CY5 A;  2E2X A;  5D3V A;  2M14 A;  4HDQ A;  5HE3 A;  1DDV A;  5DHF B;  2D9W A;  3TW1 A;  4C0A A;  2CAY A;  5J3Y A;  3SYX A;  1B55 A;  1ZC3 B;  2ZPY A;  1UPR A;  1FHO A;  2DTC A;  3TCA A;  4WJ7 A;  4PQ0 A;  3HW2 B;  3DXE A;  2VKI A;  3WA0 A;  1DDW A;  2GJY A;  1Y5O A;  3KRW A;  5J3Q A;  1NU2 A;  1WGQ A;  1UNQ A;  2MFQ A;  1IRS A;  4HDO A;  1EAZ A;  2RUK B;  2Y8G A;  3T06 A;  3GYP A;  3WYF B;  4IFS A;  2D9X A;  4GXB A;  4F7G A;  4A6H A;  5C79 A;  1XD4 A;  3D8F A;  1AQC A;  1UEF A;  3CIK A;  5DHA B;  3QIJ A;  5J3T A;  4HB0 B;  1U29 A;  3G9W A;  2I5F A;  1WGU A;  4HB3 B;  1MK9 B;  1FOE A;  1KZ7 A;  2D2Q A;  2FJL A;  2DA0 A;  4GPT B;  4HHV A;  4K81 A;  5JLJ B;  1OY2 A;  4L6E A;  2UZR A;  4NY0 A;  2HE7 A;  1H4R A;  1XR0 B;  3KZ1 A;  1X1F A;  4HB4 B;  2VSZ A;  1UNP A;  1FAO A;  1E5W A;  5HE0 A;  2LOZ A;  1BTK A;  4F7U P;  3TFM A;  1X86 A;  1QQG A;  2ELB A;  4TKN A;  2DN6 A;  1DBH A;  2L2I A;  2P0H A;  1J0W A;  4KHO A;  2P8V A;  5DIF B;  1ZVR A;  2MDX A;  3MDB C;  2NMB A;  1I7A A;  4WVF B;  1U2B A;  2H7E A;  4K17 A;  2K00 A;  3O96 A;  3QWM A;  3DXC A;  2YVC A;  3LJU X;  1X11 A;  2HTH B;  4WSF A;  4Y94 A;  2KCJ A;  5EFX A;  2RGN B;  3M1I B;  2OTX A;  5C6R A;  1QC6 A;  5C5B B;  1V5U A;  5LON B;  2COA A;  3VOQ A;  1AWE A;  1PLS A;  2P0F A;  1U5D A;  1Y19 B;  5DI9 B;  1EF1 A;  1U5F A;  3RCP A;  1M7R A;  5C5B A;  4K2O A;  2COD A;  2CRF A;  1WG7 A;  2DHI A;  2Z0P A;  3FEH A;  1GC6 A;  2Y8F A;  4MT7 A;  1NTV A;  1EVH A;  1BAK A;  1FHX A;  1WI1 A;  1W1D A;  4K2P A;  2COF A;  2RVB B;  2YSZ A;  1ZC4 B;  3A98 B;  3FM8 C;  2I1K A;  3TO1 A;  1P3R A;  1SGH A;  1U5E A;  2PZ1 A;  1ISN A;  2M38 A;  2I5C A;  3F5R A;  1MIX A;  2IYB A;  1PMS A;  4GN1 A;  1MK7 B;  3ZVR A;  1UNR A;  1M7E A;  1FGZ A;  1I2H A;  2Q13 A;  3P6A A;  5D3Y A;  4YON A;  5D3W A;  2LYD A;  1NI2 A;  2DX1 A;  2RLO A;  2XQN M;  2RNR B;  4EMO A;  2EJ8 A;  1TQZ A;  1V5P A;  2K2J A;  2GCJ A;  2QKL A;  1P5T A;  2CY4 A;  3GYO A;  2N23 A;  5GOW B;  1MPH A;  1P6S A;  1V89 A;  1BWN A;  4HAX B;  1W1G A;  1XKE A;  3FSS A;  3ZDT A;  3SV1 A;  2YRY A;  3QBV B;  4BBK A;  2UVM A;  1SHC A;  2LG1 A;  2D9V A;  3ULC A;  3HK0 A;  3NSU A;  2EMT A;  5KQ1 A;  2AL6 A;  3KSY A;  3A8P A;  4GMX B;  4ZRK A;  1XX0 A;  5FI0 A;  4NSW A;  1DYN A;  4TYZ A;  1N3H A;  1MIZ B;  2D10 A;  1RRP B;  1MKE A;  4DX8 A;  4A5K A;  4F7H A;  2DYQ A;  4H8S A;  1UPQ A;  2EMS A;  1K5D B;  3TVV A;  4D0N B;  3SO6 A;  4HAU B;  5KCV A;  3N7C A;  3PSC A;  4EJN A;  2DHK A;  2J0J A;  3SUZ A;  4HAV B;  4HAY B;  3D8D A;  3ML4 A;  1WJM A;  1LB1 A;  2Y7B A;  1OQN A;  1GC7 A;  2KUP A;  5LOP B;  2D9Z A;  1WJ1 A;  2J0M A;  1X05 A;  2R09 A;  4CYE A;  2H7D A;  1J19 A;  2J59 M;  2DLW A;  1DRO A;  4DBB A;  1U5G A;  4YL8 A;  2R0D A;  1GG3 A;  4HAW B;  2KGX B;  5C16 A;  3MPX A;  2DKQ A;  4KVG B;  1NTY A;  3U7D A;  2LUL A;  2DHJ A;  1Q67 A;  2DKP A;  1LW3 A;  3PEG A;  2EC1 A;  2X18 A;  3F0W A;  3DXD A;  1V5M A;  5KQ4 A;  2RSG A; 
#chains in the Genus database with same CATH topology
 2I1J A;  3P7Z A;  2YT0 A;  3PVU A;  2D9Y A;  1FB8 A;  4KHA A;  4A6K A;  2Z0O A;  4DXA B;  4GZU A;  2KIG A;  2K2U A;  3U8Z A;  3HQC A;  2LKO A;  1MI1 A;  1Z87 A;  3PZD A;  2W2X D;  5LG4 B;  1V88 A;  5HE2 A;  4L1R A;  4KAX B;  4ZRJ A;  3KY9 A;  5JP4 A;  4EKU A;  1BTN A;  2BCJ A;  2Z0Q A;  1XOD A;  4PNK A;  2COC A;  1OMW A;  1EGX A;  3D8E A;  2L1C A;  2NZ8 B;  1V61 A;  4QJ4 B;  2AEH A;  5FI1 A;  5D3X A;  4DX9 0;  4B6H A;  3AU4 A;  1FHW A;  1RJ2 A;  4HB2 B;  1K5G B;  2YT2 A;  2D11 A;  3BJI A;  3VIA A;  4IAP A;  1DDM A;  2UZS A;  3IVF A;  2OQB A;  1ZYI A;  2Z13 A;  2DFK A;  2G35 A;  1TJ6 A;  2MWN B;  1TXD A;  2YS3 A;  4QXA B;  4XWX A;  4CSQ A;  2GCL A;  3CXB B;  4HAZ B;  2VRW B;  1W1H A;  3A8Q A;  5DH9 B;  1KZG A;  1H10 A;  4GMV A;  3HIE A;  2YF0 A;  2V76 A;  2GUM A;  3PVW A;  3UZT A;  1FGY A;  1WVH A;  4KHB B;  2IFS A;  1XCG A;  2W2X C;  4OT1 A;  3PP2 A;  3NWF A;  5CLL B;  3ULB A;  2DX5 A;  1KI1 B;  3NW8 A;  2DYN A;  3KRX A;  2ROZ B;  4Z2N A;  4P7I A;  4A6F B;  4CHJ A;  1PFJ A;  3NWD A;  1ZM0 A;  2K49 A;  3OAN A;  2YS5 A;  3V5W A;  4IOY X;  4KHB A;  5CLQ B;  2P0D A;  4CHM A;  3ODW A;  3AU5 A;  2K8E A;  4ZRI A;  5D27 A;  2YT1 A;  3AJ4 A;  2ELA A;  2LOX A;  2W2W A;  4A6F A;  2QKM A;  3PG7 A;  3ODX A;  2YS1 A;  5L81 A;  4HAT B;  3X23 A;  2GS0 A;  4MK0 A;  3PVL A;  2D4Q A;  1U27 A;  5HE1 A;  1ZSQ A;  4MY6 A;  2ROV A;  3BIN A;  1MAI A;  2ADZ A;  5JHG A;  2JP2 A;  4Z2M B;  2N0Y A;  2J0K A;  1X1G A;  2MKR A;  3ODO A;  3SNH A;  5JHH A;  2CY5 A;  2E2X A;  5D3V A;  2M14 A;  4HDQ A;  5HE3 A;  1DDV A;  5DHF B;  2D9W A;  3TW1 A;  4C0A A;  2CAY A;  5J3Y A;  3SYX A;  1B55 A;  1ZC3 B;  2ZPY A;  1UPR A;  1FHO A;  2DTC A;  3TCA A;  4WJ7 A;  4PQ0 A;  3HW2 B;  3DXE A;  2VKI A;  3WA0 A;  1DDW A;  2GJY A;  1Y5O A;  3KRW A;  5J3Q A;  1NU2 A;  1WGQ A;  1UNQ A;  2MFQ A;  1IRS A;  4HDO A;  1EAZ A;  2RUK B;  2Y8G A;  3T06 A;  3GYP A;  3WYF B;  4IFS A;  2D9X A;  4GXB A;  4F7G A;  4A6H A;  5C79 A;  1XD4 A;  3D8F A;  1AQC A;  1UEF A;  3CIK A;  5DHA B;  3QIJ A;  5J3T A;  4HB0 B;  1U29 A;  3G9W A;  2I5F A;  1WGU A;  4HB3 B;  1MK9 B;  1FOE A;  1KZ7 A;  3U12 A;  2D2Q A;  2KR0 A;  4HSI A;  2FJL A;  2DA0 A;  4GPT B;  4HHV A;  4K81 A;  3B77 A;  5JLJ B;  1OY2 A;  4L6E A;  2UZR A;  4NY0 A;  2HE7 A;  1H4R A;  1XR0 B;  3KZ1 A;  1X1F A;  4HB4 B;  2VSZ A;  4D6W A;  1UNP A;  1FAO A;  2KUQ A;  1E5W A;  5HE0 A;  2LOZ A;  1BTK A;  4F7U P;  3TFM A;  1X86 A;  1QQG A;  2ELB A;  4TKN A;  2DN6 A;  1DBH A;  2L2I A;  2P0H A;  1J0W A;  4QJ3 B;  4KHO A;  2P8V A;  5DIF B;  1ZVR A;  2MDX A;  3MDB C;  5I2M A;  2NMB A;  1I7A A;  4WVF B;  1U2B A;  2H7E A;  4K17 A;  2K00 A;  3A58 A;  3O96 A;  3QWM A;  3DXC A;  2YVC A;  3LJU X;  2KIE A;  1X11 A;  2HTH B;  4WSF A;  4Y94 A;  2KCJ A;  5EFX A;  2RGN B;  3M1I B;  2OTX A;  5C6R A;  1QC6 A;  5C5B B;  3NWA A;  1V5U A;  5LON B;  3HSA A;  2COA A;  3VOQ A;  1AWE A;  1PLS A;  2P0F A;  1U5D A;  1Y19 B;  5DI9 B;  1EF1 A;  1U5F A;  3RCP A;  1M7R A;  5C5B A;  4K2O A;  2ZKM X;  2COD A;  2CRF A;  1WG7 A;  2DHI A;  2Z0P A;  3FEH A;  1GC6 A;  2Y8F A;  4MT7 A;  1NTV A;  1EVH A;  4QJ5 B;  1FHX A;  1WI1 A;  1BAK A;  5M4Y B;  1W1D A;  4K2P A;  2COF A;  2RVB B;  2YSZ A;  1ZC4 B;  3A98 B;  3FM8 C;  2FJU B;  2I1K A;  3TO1 A;  1P3R A;  1SGH A;  1U5E A;  2PZ1 A;  1ISN A;  2M38 A;  2I5C A;  3F5R A;  1MIX A;  2IYB A;  1PMS A;  2Z4D A;  4GN1 A;  1MK7 B;  3ZVR A;  1UNR A;  1M7E A;  1FGZ A;  1I2H A;  2Q13 A;  3P6A A;  4GOU A;  5D3Y A;  4YON A;  5D3W A;  2LYD A;  1NI2 A;  2DX1 A;  2RLO A;  2XQN M;  4DIX A;  2RNR B;  4EMO A;  2EJ8 A;  1TQZ A;  1V5P A;  2K2J A;  2GCJ A;  2QKL A;  1P5T A;  1T77 A;  2CY4 A;  3FVC A;  3GYO A;  2N23 A;  5GOW B;  1MPH A;  2NBV A;  1P6S A;  1V89 A;  1BWN A;  4HAX B;  1W1G A;  1XKE A;  3FSS A;  3ZDT A;  3SV1 A;  2YRY A;  2Z59 A;  3QBV B;  4BBK A;  2R2Y A;  2UVM A;  1SHC A;  2LG1 A;  2D9V A;  3ULC A;  3OHM B;  3HK0 A;  3NSU A;  2EMT A;  5KQ1 A;  2AL6 A;  3KSY A;  3A8P A;  4GMX B;  4ZRK A;  1XX0 A;  5FI0 A;  4NSW A;  1DYN A;  4TYZ A;  1N3H A;  1MIZ B;  2D10 A;  3DCX A;  1RRP B;  1MKE A;  4DX8 A;  4A5K A;  4F7H A;  2DYQ A;  2RRF A;  4H8S A;  1UPQ A;  2EMS A;  1K5D B;  3TVV A;  4D0N B;  3SO6 A;  4HAU B;  5KCV A;  3N7C A;  3PSC A;  4EJN A;  2DHK A;  2J0J A;  3SUZ A;  4HAV B;  5IRS A;  4HAY B;  3D8D A;  3ML4 A;  1WJM A;  1LB1 A;  2Y7B A;  1OQN A;  1GC7 A;  2KUP A;  5LOP B;  2D9Z A;  1WJ1 A;  2J0M A;  1X05 A;  2R09 A;  4CYE A;  2H7D A;  1J19 A;  2J59 M;  2DLW A;  2Z14 A;  4OSN A;  4DBB A;  1DRO A;  1U5G A;  4YL8 A;  2R0D A;  1GG3 A;  4HAW B;  5I2S A;  2KGX B;  5C16 A;  3MPX A;  4GNK B;  2DKQ A;  4KVG B;  1NTY A;  3U7D A;  2LUL A;  2DHJ A;  1Q67 A;  2DKP A;  1LW3 A;  3PEG A;  2EC1 A;  2X18 A;  3F0W A;  3DXD A;  1V5M A;  5KQ4 A;  2RSG A; 
#chains in the Genus database with same CATH homology
 2I1J A;  3P7Z A;  2YT0 A;  3PVU A;  2D9Y A;  1FB8 A;  4KHA A;  4A6K A;  2Z0O A;  4DXA B;  4GZU A;  2K2U A;  3U8Z A;  3HQC A;  2LKO A;  1Z87 A;  3PZD A;  2W2X D;  1V88 A;  5HE2 A;  4KAX B;  4ZRJ A;  3KY9 A;  5JP4 A;  4EKU A;  1BTN A;  2BCJ A;  2Z0Q A;  1XOD A;  4PNK A;  2COC A;  1OMW A;  1EGX A;  3D8E A;  2L1C A;  2NZ8 B;  1V61 A;  2AEH A;  5FI1 A;  5D3X A;  4DX9 0;  4B6H A;  3AU4 A;  1FHW A;  1RJ2 A;  4HB2 B;  1K5G B;  2D11 A;  3BJI A;  3VIA A;  4IAP A;  1DDM A;  2UZS A;  3IVF A;  2OQB A;  2DFK A;  2G35 A;  1TJ6 A;  2MWN B;  1TXD A;  2YS3 A;  4XWX A;  2GCL A;  3CXB B;  4HAZ B;  2VRW B;  1W1H A;  3A8Q A;  5DH9 B;  1KZG A;  1H10 A;  4GMV A;  2YF0 A;  2V76 A;  3PVW A;  3UZT A;  1FGY A;  1WVH A;  4KHB B;  2IFS A;  1XCG A;  2W2X C;  5CLL B;  3PP2 A;  3ULB A;  2DX5 A;  1KI1 B;  2DYN A;  3KRX A;  2ROZ B;  4Z2N A;  4P7I A;  4A6F B;  4CHJ A;  1PFJ A;  1ZM0 A;  3OAN A;  2YS5 A;  3V5W A;  4IOY X;  5CLQ B;  2P0D A;  4CHM A;  3ODW A;  3AU5 A;  4ZRI A;  5D27 A;  2YT1 A;  3AJ4 A;  2ELA A;  2LOX A;  2W2W A;  4A6F A;  2QKM A;  3PG7 A;  3ODX A;  2YS1 A;  5L81 A;  4HAT B;  3X23 A;  2GS0 A;  4MK0 A;  3PVL A;  2D4Q A;  1U27 A;  5HE1 A;  1ZSQ A;  4MY6 A;  2ROV A;  3BIN A;  1MAI A;  2ADZ A;  5JHG A;  2JP2 A;  4Z2M B;  2N0Y A;  2J0K A;  1X1G A;  2MKR A;  3ODO A;  3SNH A;  5JHH A;  2CY5 A;  2E2X A;  5D3V A;  2M14 A;  4HDQ A;  5HE3 A;  1DDV A;  5DHF B;  2D9W A;  3TW1 A;  4C0A A;  2CAY A;  5J3Y A;  3SYX A;  1B55 A;  1ZC3 B;  2ZPY A;  1UPR A;  1FHO A;  2DTC A;  3TCA A;  4WJ7 A;  4PQ0 A;  3HW2 B;  3DXE A;  2VKI A;  3WA0 A;  1DDW A;  2GJY A;  1Y5O A;  3KRW A;  5J3Q A;  1NU2 A;  1WGQ A;  1UNQ A;  2MFQ A;  1IRS A;  4HDO A;  1EAZ A;  2RUK B;  2Y8G A;  3T06 A;  3GYP A;  3WYF B;  4IFS A;  2D9X A;  4GXB A;  4F7G A;  4A6H A;  5C79 A;  1XD4 A;  3D8F A;  1AQC A;  1UEF A;  3CIK A;  5DHA B;  3QIJ A;  5J3T A;  4HB0 B;  1U29 A;  3G9W A;  2I5F A;  1WGU A;  4HB3 B;  1MK9 B;  1FOE A;  1KZ7 A;  2D2Q A;  2FJL A;  2DA0 A;  4GPT B;  4HHV A;  4K81 A;  5JLJ B;  1OY2 A;  4L6E A;  2UZR A;  4NY0 A;  2HE7 A;  1H4R A;  1XR0 B;  3KZ1 A;  1X1F A;  4HB4 B;  2VSZ A;  1UNP A;  1FAO A;  1E5W A;  5HE0 A;  2LOZ A;  1BTK A;  4F7U P;  3TFM A;  1X86 A;  1QQG A;  2ELB A;  4TKN A;  2DN6 A;  1DBH A;  2L2I A;  2P0H A;  1J0W A;  4KHO A;  2P8V A;  5DIF B;  1ZVR A;  2MDX A;  3MDB C;  2NMB A;  1I7A A;  4WVF B;  1U2B A;  2H7E A;  4K17 A;  2K00 A;  3O96 A;  3QWM A;  3DXC A;  2YVC A;  3LJU X;  1X11 A;  2HTH B;  4WSF A;  4Y94 A;  2KCJ A;  5EFX A;  2RGN B;  3M1I B;  2OTX A;  5C6R A;  1QC6 A;  5C5B B;  1V5U A;  5LON B;  2COA A;  3VOQ A;  1AWE A;  1PLS A;  2P0F A;  1U5D A;  1Y19 B;  5DI9 B;  1EF1 A;  1U5F A;  3RCP A;  1M7R A;  5C5B A;  4K2O A;  2COD A;  2CRF A;  1WG7 A;  2DHI A;  2Z0P A;  3FEH A;  1GC6 A;  2Y8F A;  4MT7 A;  1NTV A;  1EVH A;  1BAK A;  1FHX A;  1WI1 A;  1W1D A;  4K2P A;  2COF A;  2RVB B;  2YSZ A;  1ZC4 B;  3A98 B;  3FM8 C;  2I1K A;  3TO1 A;  1P3R A;  1SGH A;  1U5E A;  2PZ1 A;  1ISN A;  2M38 A;  2I5C A;  3F5R A;  1MIX A;  2IYB A;  1PMS A;  4GN1 A;  1MK7 B;  3ZVR A;  1UNR A;  1M7E A;  1FGZ A;  1I2H A;  2Q13 A;  3P6A A;  5D3Y A;  4YON A;  5D3W A;  2LYD A;  1NI2 A;  2DX1 A;  2RLO A;  2XQN M;  2RNR B;  4EMO A;  2EJ8 A;  1TQZ A;  1V5P A;  2K2J A;  2GCJ A;  2QKL A;  1P5T A;  2CY4 A;  3GYO A;  2N23 A;  5GOW B;  1MPH A;  1P6S A;  1V89 A;  1BWN A;  4HAX B;  1W1G A;  1XKE A;  3FSS A;  3ZDT A;  3SV1 A;  2YRY A;  3QBV B;  4BBK A;  2UVM A;  1SHC A;  2LG1 A;  2D9V A;  3ULC A;  3HK0 A;  3NSU A;  2EMT A;  5KQ1 A;  2AL6 A;  3KSY A;  3A8P A;  4GMX B;  4ZRK A;  1XX0 A;  5FI0 A;  4NSW A;  1DYN A;  4TYZ A;  1N3H A;  1MIZ B;  2D10 A;  1RRP B;  1MKE A;  4DX8 A;  4A5K A;  4F7H A;  2DYQ A;  4H8S A;  1UPQ A;  2EMS A;  1K5D B;  3TVV A;  4D0N B;  3SO6 A;  4HAU B;  5KCV A;  3N7C A;  3PSC A;  4EJN A;  2DHK A;  2J0J A;  3SUZ A;  4HAV B;  4HAY B;  3D8D A;  3ML4 A;  1WJM A;  1LB1 A;  2Y7B A;  1OQN A;  1GC7 A;  2KUP A;  5LOP B;  2D9Z A;  1WJ1 A;  2J0M A;  1X05 A;  2R09 A;  4CYE A;  2H7D A;  1J19 A;  2J59 M;  2DLW A;  1DRO A;  4DBB A;  1U5G A;  4YL8 A;  2R0D A;  1GG3 A;  4HAW B;  2KGX B;  5C16 A;  3MPX A;  2DKQ A;  4KVG B;  1NTY A;  3U7D A;  2LUL A;  2DHJ A;  1Q67 A;  2DKP A;  1LW3 A;  3PEG A;  2EC1 A;  2X18 A;  3F0W A;  3DXD A;  1V5M A;  5KQ4 A;  2RSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...