2LUMA

Three-state ensemble obtained from enoes of the third immunoglobulin binding domain of protein g (gb3)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
MQYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spatial elucidation of motion in proteins by ensemble-based structure calculation using exact NOEs.
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein G
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2012-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2lumA00
2J52A 2QSDA 4HKZE 4WH4A 1GB1A 2IGDA 2IGGA 1UWXA 2PW9A 1JMLA 2JZPA 1HZ5A 2JU6X 1PGBA 5JXVA 4GLSC 1ZXHA 2EELA 1QKZA 4MACA 2PLPA 1P7EA 1HEZE 1MPEA 2GB1A 4D2KA 1PGAA 3FILB 2J53A 1Q10A 2N7JA 2NMQA 1MVKA 2IGHA 1IGCA 1HZ6A 2ZW0A 5HI1A 2GI9A 1IBXA 2RPVA 1D4BA 4HJGE 2OEDA 5BMIA 4OZAA 1C9FA 1KH0A 1GB4A 1F2RI 2KDMA 5HG2A 1P7FA 3UI3A 2LGIA 2N9KA 2PTLA 1K50A 1XF5L 1MI0A 2KWDA 1XCTL 5BMGA 2LHEA 1YNTE 2N9LA 4KGSA 2JSVX 4IKGA 1XCQL 1PGXA 2JXTA 2ONQA 1EM7A 2KQ4X 3V3XA 1F2RC 1K52A 2I2YA 1MHHE 1FCLA 1IBXB 1FD6A 2ON8A 5BMHA 4KGTA 4OZCA 4IOIE 2K0PA 1YMHE 2I38A 2QMTA 2RMMA 1FCCC 3FILA 2ZW1A 1MHXA 1IGDA 2KN4A 2LHDA 1K51A 4OZBA 5HFYA 1K53A 2KACA 4KGRA 2LUMA 3GB1A 2JWUA 5HHDG 3MP9A
chains in the Genus database with same CATH superfamily
3VVWB 2J0JA 1OTRB 3GP7A 5L95C 3D32A 2L0FA 1ET6A 1PGBA 4USAA 1NEKB 3ZGZA 1ZPSA 2NVUI 3M63B 2MRPA 4KX6B 5CHWA 3N3KB 2DZJA 4KZCA 1PGAA 4FHKA 3NRZA 2L52A 3QHTA 2N7JA 3ZVVA 1B9RA 1C4CA 5D7GA 1TYGB 3AU5A 4LNKA 4HCPB 1GOZA 2J0MA 3VUWA 1JRPA 1YX5B 2CKHB 1J7BA 1YN4A 1GG3A 4A20A 1L0YB 2DNFA 1KOTA 2IPKD 1D5XC 4AQ7A 3IXSA 2FNJB 4NNJB 3KVFB 3C19A 4NAWB 3KUDB 2HDEA 4IDIA 4RM8A 1QOAA 1XF5L 1Q1OA 4N9F4 3ZJVA 2KMCA 3ETRA 2W3SA 1C79A 1K8RB 4K81A 4BKTA 4BAXA 4YTMB 2L3ZA 4A8XC 2BYEA 1LO5D 3ZDTA 3H9DA 2DX5B 2ZNVC 4J3OD 2WXPA 1MHHE 3DHGC 3IVFA 4W9DA 1I4HA 1SE2A 5BO4B 5JHAA 1E7VA 3H7SA 2TSSA 1SE9A 2KK8A 2WQYB 2RMMA 3AEGB 3A9JA 3H8HA 3CSTA 1V5TA 3NZSA 4WQMA 1EU3A 1GUAB 1UUPA 3O65B 3L10B 1I4GA 2R2OA 4ANUA 4ANWA 2J42A 3GB1A 4KDLB 4M0WB 3ZJUA 3ML9A 1RLFA 3DBHB 3NVZA 1Q5WB 3Q8FA 1E8YA 5IAAC 1P7EA 2RDGA 4P16A 1FRRA 3MC0B 2V4LA 2YEPF 4S17A 3PS6A 1P1AA 2J53A 4WWOA 4LNOA 4IM3A 4WJOA 4IUMB 4WJNA 2GBMA 2NS5A 2LGSA 3A9KA 3BZDB 3QWZB 1D5ZC 4LK0M 2BWFA 3MHZA 1FM0D 2LJIA 1TZOA 4LCDE 1SGHA 1N5XA 1E0ZA 2DLBA 3W5VB 4P7IA 5IOIA 1P7FA 2BWES 1WX9A 2PTLA 2FE8A 2BQQA 1XCTL 2KDBA 3W1SA 4NQLB 2C9WB 3AU4A 2RD0A 2A5UA 2AWTA 2MEKA 1ET9A 2QCZA 1YOVB 1CZPA 3GS2A 1MFWA 2KVRA 1J7CA 3IG3A 3X0WA 1WRDB 1YQBA 5LXIB 2G3QB 3JSVB 2B3AA 1M94A 2FCQA 2I2YA 2XEWA 2RR9A 4FJZA 4B0MA 3OJ4B 3N9YC 3KH0A 3FKYA 4RNAA 3KWVA 2LGDA 1NI3A 4OZCA 2MP2B 3JYUA 2KWUB 4LNNA 3URYA 1UZXB 2QMTA 2W55A 2AQ1B 1FCCC 2KX0A 3E56A 2WDTB 4HLEA 4A55A 1TY2A 3ZYYX 2W54A 3RPFC 5HHDG 4WURA 3IT6B 1WJUA 5E6OA 4NPNA 2WDQB 3IBEA 2W82A 3U52E 3T3NA 3VAWA 1VZ7A 1JWUD 4RF1A 2WXOA 4W9KA 3SFDB 1V80A 2KT7A 3I57A 4GDKA 4KKJA 2JF5A 3NJTA 3SDLC 5T8IA 2KKCA 3AMZA 4GSWA 2WXFA 3VRBB 2SAKA 3NZ3A 4HROA 3OG5A 2W9NA 3VDZA 4DHZB 2O6VB 2H89B 4YSYB 2D11A 1E7PB 3RULA 3X23A 4GB9A 4I6NB 3B1LX 3DOWA 4OVVA 4US8A 4TMAB 5LNK1 3ML8A 2HE7A 2REXA 3HHMA 2INDC 2HJ1A 5C2TB 1WI0A 1V1PB 1QOBA 3DQVA 3DBSA 1D3ZA 1V8CA 2M1MA 3DBRB 2PKOA 2JWZA 4IWOA 4RGMA 3PZ7A 2KXJA 4RMAA 3L4PA 4RM9A 1JCKB 1KRHA 2KLGA 2GBRA 3RZWC 5J18A 1V2YA 3HK0A 4AJYB 1PQSA 1FXAA 2LFIA 2G9HD 2K8BA 2NCNA 2KFKA 1XLQA 3QK0A 4P6VF 2M56B 2C7MB 2BS2B 3PZ8A 5KHOA 3DHHC 4NJ6A 2FCSA 3H1UA 3FILA 3DWGC 1WGGA 1MHXA 3KWLA 4FN2A 4BFRA 2K25A 3PREA 1STEA 2C7HA 1WYWB 2IGGA 2V0GA 1ZDVA 4MJSB 4W9HA 3PHWB 4W9LA 2KMMA 3ZNID 4WWMA 2KDEB 2WYQA 1C3TA 3U30A 4D2KA 2MBOA 2BF8B 4LJOB 4WAAA 1C4PA 1TS2A 1WM3A 2BB6A 2NMQA 2ZW0A 4W9FA 1C78A 2KNBA 4CQNA 1JWAD 2WNMA 4HJGE 1E6EB 2BW2A 2KFJA 4MGIE 1BT0A 1JW9D 5IKCM 4ANVA 2WWZA 2BS4B 3UIPB 5BYQA 2Q5WD 3SR6A 5IA7A 2K6DB 4YTPB 1QQRA 4ITKA 2BVCA 1RYJA 1PFDA 3ZXRA 1V6EA 2IJ0A 2KD0A 2IO3B 4XYCA 2WU2B 5EE3A 2WXNA 2WLBA 3CIRB 4GN1A 2YEPB 1L4ZB 4NJ7A 1X1MA 2M19A 2D3GA 1RFKA 4RGOS 5AUKA 1V97A 4JPSA 2LRWA 3MFGA 4XZ4A 2FBWB 1FXIA 3AE6B 2KO3A 1WSPA 2NPTB 4IOIE 2V3NA 1V86A 2KLCA 1DOXA 4DXFA 2JRHA 2V3PA 1WM2A 2WXJA 2LHDA 2MJDA 2V1YA 5JHBA 4C4VB 4HPPA 4MGYE 3ZNGC 3GOEA 1ESFA 1I4RA 4RGTA 2KDFB 5AEKB 2NTSA 1C77A 4EEWA 1UELA 4DHZE 3PVLA 3RNAC 4GDLA 2KWVB 2MP2A 2K6QA 4J6IA 3DVGX 1NENB 1YJIA 3P4RB 3GZNI 1ENFA 3WANA 4I6LB 3SU8X 4HCNB 3ZXVA 3ZTCA 3TIXA 4YTNB 3R2TA 2OEDA 2FCMA 1E8ZA 3APFA 1C9FA 3Q8BA 1L2NA 2LGXA 3WCQA 4M01A 4XC2A 3NHEB 2AL3A 2ZPYA 4W9CA 3RZFA 4K3BA 5AZHA 1RWSA 1WGKA 2DZMA 1QF6A 3BVMA 2L32A 1L0VB 3WA0A 3Q8EA 2B76B 3RYTA 2VZKB 5JZEB 4HXDA 4MGKE 2UYZB 1FO4A 5C3JB 1PDXA 3P4PB 4ZRPA 1IBXB 3WAOA 3RT3B 4W9JA 1ZW7A 4MM3B 4R3DA 2LASA 1T0SC 4TSSA 3VTWA 3ZIMA 4EZJA 4WWPA 1ZP0B 3DWMA 4ZYNA 4NAMA 4F1SA 3BVZA 2MBQA 2ACZB 3NVWA 5G55A 3VXWA 2IO0B 2IY1B 2JWUA 2EMSA 1OQQA 3N1XC 4IW0A 1BXTA 3UF8A 2V9HA 1MG8A 5AUIA 1WXMA 1QKZA 2VRRB 2MHJA 2XN9C 4OW0A 4PK1A 4BOSC 4K3CA 3FILB 3AEBB 2WDVB 2DYOA 2RPVA 1Q0WB 5H8YE 3ZTDA 3I63C 5C23A 4ZRJA 5DPWA 2INNE 1L0XB 4A9AA 1V49A 4KSKC 4PS8A 4PYUA 5HG2A 3UI3A 4L2YA 3VRAB 3KYCD 3VTVA 3DHIC 2N9LA 1LFDA 3VH4B 3GE8C 1SE3A 1XCQL 2GOWA 2XNAC 1PYWD 1JALA 2L1AA 4DQOC 3LB8C 1WMHA 1K52A 4MJSA 1T0YA 3N1ZC 3PV1A 1H4RA 2ZZPB 4GOCA 4DDGD 1ROEA 1Y56A 2ON8A 3Q69A 3EA6A 4WJPA 3VH3B 2JYTA 2JQRB 5IP4D 2FIDA 5IN7A 4FADA 4EOYA 1QILA 3DVNU 2LMCA 2L05A 2GLSA 1P0RA 2PMVA 4AP4C 1CQVA 4XDDA 1E7UA 2EKEC 4FHJA 3VUXA 3WAPA 5L83A 1SBBB 3I5JC 1WF9A 4HKZE 1GB1A 2QEJC 1GNUA 1WGHA 3ABVB 4KKIA 1WGDA 1SB3C 4BVUC 3EGRA 1FNUA 4IWQA 4JL9A 3VFKA 1UBQA 3EUB2 3HUIA 1TS5A 1J7AA 3RNGC 2MA9B 2IGHA 1IGCA 1NVID 2KAJA 1VRAB 4M02A 4E3CA 4MT5A 3A1QB 2CJNA 4XGAB 2MWSB 5EE9A 3OAWA 3AE4B 2JVCA 2CHWA 1F9JA 3BWUD 4AJWA 4E74A 3BK2A 4MDKE 2NPTA 1VR9A 4FULA 1E5WA 4G3XB 4RH6A 3VQIA 4GDLB 3PLUA 1DOIA 3NG0A 1GC7A 3L17A 4N59A 1MJDA 3MHSD 1G6JA 2DHZA 2SEBD 3BVGA 1C76A 3AV8A 2YVCA 2C7NB 1B1ZA 5CTRC 2QHOA 1F0ZA 3W2DA 2I1JA 4IWPA 1XEEA 4DBGA 4EE2A 2LGYA 1GPXA 2K22A 1LM8B 1FXTB 1E10A 4XE0A 2WS3B 1I7HA 1AARA 2LI5A 4JWUC 1WZ3A 5KHQA 1YD8U 4B95A 3GZNB 3AE5B 3SHQA 2KX3A 2DWQA 2L8JA 1A70A 3DBLB 5AZGA 2WXRA 1OEYJ 1K53A 1TKYA 2RSUA 4N58A 1XXGA 3IT4B 1P9DU 3DDCB 3APDA 2BGFA 1FNWA 1UWMA 2D07B 2D2QA 4ZOHC 3L13A 1ZE3D 5DPTA 1QOGA 1TT5B 1C4AA 3DVNV 3UQBA 4W9EA 1TTNA 2BKRB 1N63A 2XK5A 4URKA 2RGFA 2CU1A 3A9JB 3SD5A 3B2FA 4ICVA 2IO2B 1TJEA 1HZ6A 1IBXA 2L83A 4K7WA 4GXBA 5GXGB 3CWIA 1V81A 1XLPA 1XO3A 3QJZA 2K1FA 3APCA 1EUVB 1R4NI 1SEBD 4G50A 1SIJA 2K8CA 2QJLA 3NVVA 2HTME 1FPYA 4MSQB 4IM2A 4BZAA 5J2RA 1JRUA 3OWEB 1NI2A 3EECA 4MEMA 3AM9A 3SFEB 2ZPNA 3HVZA 3P4SB 4KSLC 1GC6A 2MBHA 2ZNVB 3W1YA 2GRIA 3AEAB 4HPLB 2N1VA 3P1MA 1UH6A 4TUUA 3L0WB 4BKSD 3WIMA 3KLSX 3Q14C 1WR1A 4BKSA 4B6WA 1VZ6A 4G0NB 3P42A 2CU3A 1I4QA 3NVYA 3AEDB 1F77A 2KJ6A 4PS7A 4MGZE 3H7PB 2N1WA 2QDFA 2MJEA 1V5OA 5FR6A 1I4PA 3U8ZA 2QSDA 2PIAA 4NAWA 1F1HA 3U4EG 1HZ5A 2O6VD 2JU6X 1SJED 2O2VB 4MACA 2RPQA 4ZRIA 1HEZE 2M8SA 4WQOB 1V1OA 3ZW3A 2KMAA 2IBIB 4MSMB 3UIOB 4XWWA 1S3SG 2MCNB 1ACCA 3RI7C 1P98A 3CMMB 2VH2A 2GI9A 1PUTA 4B9KA 5D2MB 4ICUA 1SF0A 3W5UB 1WZ0A 1WX7A 1KH0A 4TQ1A 3B2GA 4G11A 2BT6A 3AEFB 4LDTB 4RFBA 3ZQ4A 1T0RC 3TL5A 1F52A 3R66C 4WAFA 2OJRA 3FC4A 3OLMD 4M0WA 1TBEA 1JWMD 2BPSA 1FMAD 4EZKA 3RCZA 3KYDD 1DYQA 3QQ8B 4F8CB 1EM7A 1ZOYB 4IM0A 4GMVA 2JZZA 2ZVOA 3UINB 2CS4A 1T3QA 5FR3A 3L08A 1U4AA 2AQ2B 2HD5B 2KJHB 4DK5A 2RDHA 2G45B 1R4MB 3WALA 2DAFA 4LTUA 3LJ3A 3PZDA 3PSEB 2MW5A 3QIJA 1JWBD 2AQ3B 1V1PA 2CHXA 2ZW1A 3A9KB 1NYQA 2PVOD 4O1NA 4H2AA 2R61A 4REZA 3MP9A 2NBWB 3O13A 2KJRA 2FUG1 4A3PA 4ZDVA 1RAXA 2WGSA 4CO7A 3AB5A 3I9V1 2PLPA 4US9A 1BUIC 1WXSA 5G5GA 1N5WA 2K9XA 4PS3A 2BYFA 2WXKA 2R2QA 2G4DB 4ACFA 3R7RA 4C00A 2AL6A 5JH5C 3HM3A 2KQSA 3M95A 2N9EB 5CHFA 2CR5A 3RFZB 3VR9B 4K7SA 1D6EC 2DBYA 2KDIA 3R3MA 4A3OA 2N9KA 3J9CA 3MC8A 1MI0A 2O2VA 4NY0A 1YJJA 2WXIA 4M8MA 1OQYA 2NBVB 1E8WA 2LVPA 4ZYSA 2LD9A 1UNSA 3IFWB 4JWSC 1WE7A 3UQAA 4OVZA 4P1CC 2DYMA 2G4SA 3DBRI 3BIID 3PGEA 2GMIC 3BY4B 4LNIA 3Q3MC 4HRSA 4CHKA 1TS4A 1ZKHA 2N0SB 1NDDA 3KQ4A 1I42A 3RNFC 1TGZB 2KVZA 4PT5A 2KC1A 2W3RA 3TEYA 3MJ5A 2X38A 5E6NA 2KWCA 2JPHA 1WWTA 2E6XA 4ANXA 2MSED 1FFUA 2KACA 1UGMA 3HRDD 1OEYA 5EE1A 3DBHI 2IGDA 1UWXA 3AULA 1VD2A 3JSVA 2KANA 3TMPB 3ZRFA 1UGJA 2ZVNA 4DHJD 2JZ3B 3ZRCA 1IP9A 4HPMB 1XT9B 2JXXA 3EHVA 3R8BA 3DVGY 3RN9C 2N9XA 2LEKA 1YN5A 1JROA 2N9PC 1CMXB 2MBBB 1WY8A 2K8HA 5EE0A 1HTQA 4MH0E 2BBCA 3EC8A 2E3TA 4GIVA 2JT4B 1GB4A 3B9JA 4YWGG 1WH3A 2KFKB 3RNCC 3QX1A 1GAQB 3N20C 5DPSA 5CX3A 2ZCBA 1UBIA 2WX0A 1I35A 1OQRA 2YLMA 3C0RB 1WRIA 3L16A 1SIFA 2Y5CA 3Q3NC 1KLVA 3Q6BA 2PE9A 2KQ4X 3PRZA 3V3XA 1F2RC 1D5MC 4YL8A 2V3SA 4WJQA 2N4FA 2CJOA 1UD7A 4GDKB 1EF1A 1Z2MA 4RCOA 4YSXB 5BMHA 2MLBA 4XX5A 3C8YA 2K0PA 2FAZA 2UWQA 2K39A 1CK1A 3AE2B 3Q8AA 1HE8A 4E71A 2Z8LA 1E8XA 1YQ4B 3T8MA 1FFVA 5GMVA 1K51A 2I1KA 4P1BC 1YN3A 3MC9A 2PVGC 1UF0A 2L76A 3Q3JA 3EFUA 2D3BA 4W9GA 2KQ7A 1XD3B 2OHFA 1EO6A 1XLNA 1DGJA 4HJKA 2ZCCA 1JMLA 2JZPA 2EELA 4M00A 4F7ZA 5FKAC 3CF6E 1E90A 4FA6A 4A6QA 2J0KA 3NOBA 3TEZA 1AWDA 5IO9A 3JVZX 1Q10A 2D10A 2QILA 3PT2B 4XWTA 3QAQA 3PTFC 1ZDXA 3AXCA 4OZAA 3S2AA 1TIFA 2LXAA 4HDOA 1HTOA 2RDBC 1F2RI 2V4IB 3NY5A 2KDMA 3H7PA 4KIKA 2D5GA 1L6VA 5G2NA 1ZUD2 3RUIB 1VCBA 3Q3FA 1YQ3B 2JSVX 4IKGA 1N60A 1WIAA 3JW0X 4ARCA 4XDCA 1DOYA 1EU4A 3NUHB 2ONQA 2UU7A 5FK9C 2J4XA 2K3UA 5MPOA 1FCLA 2HJ8A 1MG4A 1IUEA 1WXQA 1TS3A 4JIOU 4LNFA 3ZLZA 5BYSA 1KJTA 3TJPA 5DPRA 1ZGUB 2C60A 4DDID 2IO1B 2WXLA 4OVUA 1WJNA 2L7RA 4HVBA 1XQQA 2I38A 3DBLI 4NZLB 3BYYB 1KTKA 2WXMA 2Y3AA 2LUEA 2XK5B 2VH1A 3ZO5B 5HFYA 4BBNC 4KGRA 4KV2A 3AN1A 2KC2A 1L7YA 4ZHOA 1R7SA 4WWNA 1BMLC 1HQRD 4DXGA 2FUHB 5JXVA 2WXHA 2ZEQA 1TKGA 4AS1A 3Q3OC 2HTHA 3ZJTA 2H88B 1WGRA 4JGHB 1IPGA 4AUQC 3KUCB 5E6PA 3IAS1 1YX6B 1QZEA 2GB1A 3LYYA 1WX8A 4W9IA 1VZ8A 2KTRA 2LZ6A 1ZXIA 4KDIC 2NBUA 3UGBB 2BYTA 4ZHPA 1KLUD 3VUYA 3U7DA 5BMIA 2Y5PA 3V6EB 3P2BA 4IG7B 2GBKA 3V60A 4HDQA 1WJ6A 2WU5B 3EFCA 2IYDB 4FLHA 1SJHD 2KWDA 5BMGA 2LHEA 1YJ1A 2KHWB 1PGXA 1T0QC 4M8NA 4I6PA 2C5LC 2WXGA 4NJCA 3AECB 3IAM1 3M3JA 3VHTC 5D94A 2LVQA 3Q8CA 3RD2A 1AW7A 1TZ1A 1NBFC 4IC7B 3QCAA 1RM6C 4C7YA 2NTTA 2DZKA 1L4DB 3TSSA 2Z59B 2MBEA 5J17A 1KM7A 2KN4A 4II2B 3ZDMC 1SE4A 1KF6B 5C1ZA 2QC8A 4OZBA 3VR8B 3RMKC 2PEAA 3NZUA 4TQ0A 3ZNZB 3NS8A 2MQJA 3K9PB 1XLOA 1ISNA 3V62A 3VTUA 1T5XD 1HXYD 4ARIA 2KOXA 4TKNA 5D3DA 1MPEA 3RNBC 3CSFA 1GJZA 2IY0B 4OHJA 4FXCA 3PHXB 3V61A 1AYFA 3NS1A 1WXAA 2KTRB 2GBNA 1FNVA 1EF5A 3L54A 4DWFA 3T9LA 3QA8A 2BS3B 2BTEA 2Y5BB 1S1QB 2JUOA 3GE3C 4BKGA 2JYEA 3A4RA 2VZKD 1NYRA 1QOFA 4KVGB 4CYEA 2JY6A 3ZNHB 4WIPA 4JX1C 3TUOA 1JQ4A 1WGYA 4PYZA 1LGRA 2LRUA 4JLCA 3TBLD 3W1SC 5E6JA 3AE1B 2K5PA 3TEXA 2AEHA 4K7UA 2L0TA 3A4SC 1K50A 1N62A 2Z0EB 2WP9B 4UDUC 3V05A 1FIQA 3DCGA 2KTFA 3ZKJC 1I4XA 2AX5A 3HIZA 1LXDA 1P3QU 1VJKA 2WX1A 3ENEA 1Z5SB 1FD6A 4YT0B 1VLBA 2X8XX 1SSNA 3N32A 3PRMB 3RNEC 2FCNA 3AE3B 1HA5A 4GU2A 3H6NA 2DZIA 2J7QB 2QIEB 2LJ5A 2OOBB 3B0AA 4C7ZA 4ASWC 1OGWA 1YMHE 3IHPC 4HKQA 1IYFA 3M62B 4AOFA 4C4VA 1IGDA 3ZUNA 1M4VA 2PE6B 2M0XA 3BYTB 3B08A 5DCNA 1AN8A 3AE9B 2J52A 5TSSA 3I3TB 2NR2A 1WJ4A 2GBJA 2PW9A 1WYGA 4B0EA 4HWIB 2D3AA 2INCC 4GLSC 3V6CB 2ICIA 3BK1A 1N61A 5H92C 1TY0A 2PJHA 3N30A 2WXQA 2JRIB 4HEA1 4HK2A 3AE8B 3SEBA 4LLGM 2MH7A 4NQKE 1MVKA 2BKFA 2AYOB 2CHZA 1KLGD 1EWYC 4N6EB 1E9MA 4LJPB 2M4NA 1WE6A 5AZFA 3PLVA 4GGQA 5D3IB 3DPDA 2WDRB 3K9OB 3ALBA 4FJYA 2ZJDA 4JQWC 3QC8B 3QARA 4Q2JA 4RGNA 1WFYA 3HVDA 2L00B 3Q2AC 4LDTD 2M17A 1H8CA 2BYVE 3P4QB 4BOZB 2A4ZA 4ZRQA 5I4DA 3KW5B 2EKIA 2Z0DB 3R7QA 4FJVB 2LVOA 3FAHA 4A90A 3OJ3A 1J0GA 1WR6E 3N1YC 3A1QA 1VDVA 1KFYB 1WXVA 2G1EA 2D3CA 2LXCA 4JE3B 2DYBA 2O6VA 1R4MI 5LLIA 4TV3A 2WHIA 4KGTA 5EDSA 1TKEA 1N6ZA 3LDZE 3MTNB 3AE7B 3PO0A 5HKHA 3LXFA 1EWCA 2DAJA 3KUZA 1L6UA 1A5RA 3ECIA 1Y8RC 2MJ3A 5CHVC 2INPE 1QLBB 4WH4A 3AH7A 1CJEA 1ZXHA 3U7ZA 2LWPA 3WAMA 1J19A 4ZRKA 2KN5A 3T3OA 3AI5A 4MELA 3W9CB 3PRPB 4QAYA 4MH8A 1RRBA 2PPHA 4RF0A 5HI1A 4II3B 4C56C 2N7DA 4KIKB 1FRDA 1D4BA 4FBJB 4EZLA 4EKUA 4L1BA 1SXTA 3BINA 2IZVB 2EMTA 3HM6X 1R4NB 3PPAA 2MX2A 2XBBC 2KYWA 4YXDB 1T6BX 2LGIA 1LQBA 4EFOA 3A33B 2N7EA 1YNTE 4AWJA 1J8CA 4C80A 3TCAA 4KGSA 4K1RB 4X57B 5G5HA 2DENB 1L5PA 4BBNF 2FIFA 2JXTA 4S0RA 5LXHA 1WMHB 3E9SA 1YIWA 1QT9A 4L23A 2M0AA 4DXAB 1JWSD 3U2SC 3MJWA 3TEWA 3P63A 2ASQA 3R2IA 5TR5A 4MM3A 2KZRA 1OFFA 4DHJB 2BB5A 4KZ0A 1C1YB 1V9JA 2OJWA 3AEEB 1RFAA 5BYRA 3ONSA 1FEHA 2IDYA 4EUTA 2JX5A 4YSZB 2LUMA 5D6JB
chains in the Genus database with same CATH topology
1I4PA 1ESFA 2QSDA 4ZHOA 1I4RA 1R7SA 2PIAA 4RGTA 3GP7A 3U4EG 1BMLC 1C77A 1HQRD 1HZ5A 2NTSA 2JU6X 4DXGA 1ET6A 1PGBA 1SJED 1NEKB 2WXHA 4USAA 5JXVA 3ZGZA 1TKGA 4AS1A 4MACA 3ZJTA 2H88B 1ZPSA 1HEZE 1V1OA 3IAS1 4KX6B 3LYYA 2GB1A 1NENB 1YJIA 1PGAA 4XWWA 3P4RB 3NRZA 1VZ8A 2L52A 2N7JA 1ENFA 1ACCA 1ZXIA 1B9RA 2GI9A 1C4CA 2BYTA 5D7GA 1TYGB 1PUTA 4ZHPA 1KLUD 4YTNB 1GOZA 3R2TA 2OEDA 5BMIA 1SF0A 1JRPA 3W5UB 1J7BA 1YN4A 2Y5PA 3Q8BA 1C9FA 1KH0A 4TQ1A 1L0YB 3B2GA 2BT6A 2IPKD 1D5XC 3AEFB 3IXSA 4RFBA 4AQ7A 3ZQ4A 3WCQA 4NAWB 2WU5B 2HDEA 4IDIA 1SJHD 1QOAA 1XF5L 3FC4A 4WAFA 2KWDA 4M0WA 5BMGA 2LHEA 3ZJVA 3ETRA 1RWSA 1JWMD 1WGKA 1QF6A 1FMAD 3BVMA 2L32A 1L0VB 2W3SA 1PGXA 1C79A 3Q8EA 4YTMB 2B76B 2VZKB 1DYQA 2WXGA 4A8XC 1FO4A 4NJCA 1EM7A 3AECB 5C3JB 1ZOYB 3IAM1 1PDXA 1LO5D 3P4PB 4ZRPA 4J3OD 2WXPA 1MHHE 1IBXB 1T3QA 3Q8CA 5FR3A 2AQ2B 1I4HA 1SE2A 2RDHA 1AW7A 4MM3B 4R3DA 4TSSA 4LTUA 2TSSA 1ZP0B 1RM6C 4C7YA 3DWMA 2NTTA 2WQYB 1L4DB 3TSSA 1JWBD 2AQ3B 2RMMA 3AEGB 3H8HA 1V1PA 4NAMA 2ZW1A 3BVZA 2KN4A 1SE4A 1NYQA 1KF6B 2ACZB 4WQMA 2PVOD 1EU3A 1UUPA 4O1NA 4OZBA 3VR8B 3NVWA 1I4GA 2R61A 4H2AA 4REZA 2J42A 3GB1A 2JWUA 3MP9A 3O13A 1OQQA 1BXTA 4TQ0A 3ZJUA 2FUG1 1XLOA 3NVZA 5AUIA 3Q8FA 1T5XD 1HXYD 1QKZA 4ARIA 3AB5A 3I9V1 2PLPA 4US9A 1P7EA 2RDGA 1MPEA 5D3DA 1BUIC 4P16A 1FRRA 2XN9C 4OW0A 5G5GA 1N5WA 3MC0B 2K9XA 2YEPF 4OHJA 4FXCA 2WXKA 3FILB 2J53A 1AYFA 3AEBB 3NS1A 2WDVB 1FNVA 2DYOA 2RPVA 5H8YE 2BS3B 2BTEA 3BZDB 2JYEA 2VZKD 1NYRA 1QOFA 1D5ZC 4LK0M 3MHZA 1FM0D 2INNE 1L0XB 4WIPA 3RFZB 2LJIA 4A9AA 1TZOA 4JX1C 3TUOA 1JQ4A 3VR9B 1N5XA 1E0ZA 1D6EC 2DLBA 2DBYA 3W5VB 5HG2A 1P7FA 5E6JA 3AE1B 2K5PA 3TEXA 3UI3A 2N9KA 2PTLA 3J9CA 2FE8A 4L2YA 3VRAB 1K50A 1MI0A 1XCTL 1N62A 2WP9B 3W1SA 4UDUC 3V05A 2N9LA 1FIQA 1YJJA 2WXIA 1SE3A 1XCQL 1I4XA 2AX5A 1ET9A 2MEKA 2XNAC 1CZPA 3GS2A 1J7CA 4ZYSA 1UNSA 1PYWD 1JALA 2L1AA 4JWSC 4DQOC 3LB8C 2DYMA 4OVZA 1K52A 3BIID 1VJKA 2I2YA 4HRSA 1FD6A 4B0MA 1TS4A 4YT0B 1VLBA 1SSNA 3N9YC 1ROEA 1Y56A 2N0SB 2ON8A 3Q69A 3EA6A 3AE3B 1HA5A 3KWVA 4RNAA 2JYTA 3KQ4A 2JQRB 2QIEB 1QILA 4PT5A 1NI3A 2LMCA 4OZCA 2W3RA 3TEYA 3URYA 4C7ZA 1YMHE 2PMVA 3MJ5A 4HKQA 2X38A 2QMTA 2W55A 2AQ1B 1FCCC 1CQVA 1IGDA 1WWTA 2E6XA 1M4VA 3E56A 4XDDA 4A55A 1TY2A 1FFUA 2KACA 3BYTB 3ZYYX 2W54A 1SBBB 3RPFC 5HHDG 1AN8A 3AE9B 3HRDD 2J52A 5TSSA 5EE1A 4WURA 4HKZE 1GB1A 2IGDA 1UWXA 2PW9A 2QEJC 3IT6B 1WYGA 4B0EA 4GLSC 3ABVB 4KKIA 1SB3C 2WDQB 3EGRA 2ICIA 1FNUA 2W82A 3U52E 3T3NA 1UGJA 3BK1A 1N61A 1VZ7A 5H92C 1TY0A 1JWUD 4RF1A 2WXOA 3EUB2 3HUIA 1TS5A 1J7AA 2WXQA 3SFDB 4HEA1 3AE8B 3I57A 3R8BA 3SEBA 4KKJA 4LLGM 2MH7A 1MVKA 2IGHA 1IGCA 1NVID 2KAJA 5T8IA 1VRAB 1KLGD 3AMZA 1EWYC 4MT5A 2LEKA 1E9MA 1YN5A 2CJNA 4N6EB 1JROA 5EE9A 2WXFA 3VRBB 2SAKA 3AE4B 3NZ3A 4HROA 5EE0A 2BBCA 5D3IB 2H89B 2E3TA 4YSYB 3BWUD 1GB4A 2WDRB 1E7PB 3BK2A 3B9JA 4YWGG 1VR9A 4US8A 4TMAB 4RH6A 5LNK1 3VQIA 4GDLB 1GAQB 4Q2JA 4RGNA 3HVDA 1DOIA 4N59A 5C2TB 3P4QB 1V1PB 1OQRA 1QOBA 4ZRQA 2SEBD 3BVGA 1C76A 1WRIA 5I4DA 3AV8A 2Y5CA 2EKIA 1V8CA 2KQ4X 1B1ZA 3V3XA 2PKOA 1F2RC 1F0ZA 3W2DA 1D5MC 3FAHA 4A90A 1XEEA 4EE2A 4RGMA 3PZ7A 1GPXA 1VDVA 1KFYB 2K22A 2G1EA 3L4PA 2CJOA 1JCKB 1E10A 1KRHA 4GDKB 4JE3B 4RCOA 4YSXB 4XE0A 5BMHA 2WS3B 1I7HA 4KGTA 1FXAA 4JWUC 2LFIA 2G9HD 1TKEA 3C8YA 1XLQA 2M56B 2K0PA 3PZ8A 4P6VF 2BS2B 3AE5B 2DWQA 1A70A 3AE7B 1CK1A 3FILA 3PO0A 3AE2B 3DWGC 3Q8AA 1MHXA 3KWLA 1EWCA 1YQ4B 2WXRA 2Z8LA 3LXFA 1FFVA 1K51A 1YN3A 2PVGC 1K53A 1TKYA 1L6UA 1STEA 4N58A 1XXGA 3IT4B 2MJ3A 2OHFA 1XLNA 1FNWA 1QLBB 1DGJA 1UWMA 2IGGA 2INPE 4WH4A 2V0GA 1ZDVA 1JMLA 2JZPA 3AH7A 4ZOHC 1ZE3D 1QOGA 1CJEA 1ZXHA 2EELA 3U7ZA 1C4AA 5FKAC 2KMMA 1N63A 3T3OA 3W9CB 4WWMA 4A6QA 4D2KA 3TEZA 1AWDA 1C4PA 1TS2A 3B2FA 2BB6A 1Q10A 4MH8A 1TJEA 2NMQA 1HZ6A 2ZW0A 4RF0A 5HI1A 1IBXA 4C56C 2L83A 1C78A 4CQNA 2QILA 1JWAD 4XWTA 1FRDA 2WNMA 4HJGE 5GXGB 1D4BA 1E6EB 2BW2A 3CWIA 1XLPA 4L1BA 1SXTA 1XO3A 1JW9D 1ZDXA 4OZAA 2BS4B 1SEBD 5BYQA 2Q5WD 3SR6A 1F2RI 2V4IB 1SIJA 2QJLA 3NVVA 2KDMA 2HTME 4YXDB 1T6BX 2D5GA 4YTPB 1L6VA 1QQRA 4ITKA 1ZUD2 1RYJA 2LGIA 1PFDA 3OWEB 2IJ0A 3AM9A 3SFEB 1YQ3B 1YNTE 4C80A 4KGSA 2JSVX 4IKGA 1N60A 5G5HA 5EE3A 2WU2B 2WXNA 2WLBA 1L5PA 3HVZA 3CIRB 2JXTA 3P4SB 4ARCA 4XDCA 3E9SA 1EU4A 2YEPB 3NUHB 1DOYA 1QT9A 4L23A 2M0AA 1L4ZB 2ONQA 5FK9C 1JWSD 2J4XA 2K3UA 3U2SC 3TEWA 5MPOA 2GRIA 3AEAB 1FCLA 2M19A 1RFKA 3P63A 4RGOS 5AUKA 3R2IA 3P1MA 1IUEA 1V97A 4JPSA 1OFFA 1WXQA 2BB5A 1TS3A 3MFGA 3KLSX 2FBWB 1FXIA 3AE6B 5BYSA 1WSPA 1VZ6A 4IOIE 2V3NA 1DOXA 2WXLA 3AEEB 3P42A 4DXFA 5BYRA 2I38A 2CU3A 1I4QA 2V3PA 1FEHA 4NZLB 3BYYB 1KTKA 2WXMA 2WXJA 3NVYA 3AEDB 1F77A 2Y3AA 2IDYA 2LHDA 2MJDA 2JX5A 5HFYA 4YSZB 2LUMA 4KGRA 3AN1A 2MJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J52 A;  2QSD A;  4HKZ E;  4WH4 A;  1GB1 A;  2IGD A;  2IGG A;  1UWX A;  2PW9 A;  1JML A;  2JZP A;  1HZ5 A;  2JU6 X;  1PGB A;  5JXV A;  4GLS C;  1ZXH A;  2EEL A;  1QKZ A;  4MAC A;  2PLP A;  1P7E A;  1HEZ E;  1MPE A;  2GB1 A;  4D2K A;  1PGA A;  3FIL B;  2J53 A;  1Q10 A;  2N7J A;  2NMQ A;  1MVK A;  2IGH A;  1IGC A;  1HZ6 A;  2ZW0 A;  5HI1 A;  2GI9 A;  1IBX A;  2RPV A;  1D4B A;  4HJG E;  2OED A;  5BMI A;  4OZA A;  1C9F A;  1KH0 A;  1GB4 A;  1F2R I;  2KDM A;  5HG2 A;  1P7F A;  3UI3 A;  2LGI A;  2N9K A;  2PTL A;  1K50 A;  1XF5 L;  1MI0 A;  2KWD A;  1XCT L;  5BMG A;  2LHE A;  1YNT E;  2N9L A;  4KGS A;  2JSV X;  4IKG A;  1XCQ L;  1PGX A;  2JXT A;  2ONQ A;  1EM7 A;  2KQ4 X;  3V3X A;  1F2R C;  1K52 A;  2I2Y A;  1MHH E;  1FCL A;  1IBX B;  1FD6 A;  2ON8 A;  5BMH A;  4KGT A;  4OZC A;  4IOI E;  2K0P A;  1YMH E;  2I38 A;  2QMT A;  2RMM A;  1FCC C;  3FIL A;  2ZW1 A;  1MHX A;  1IGD A;  2KN4 A;  2LHD A;  1K51 A;  4OZB A;  5HFY A;  1K53 A;  2KAC A;  4KGR A;  2LUM A;  3GB1 A;  2JWU A;  5HHD G;  3MP9 A; 
#chains in the Genus database with same CATH topology
 3VVW B;  2J0J A;  1OTR B;  3GP7 A;  5L95 C;  3D32 A;  2L0F A;  1ET6 A;  1PGB A;  4USA A;  1NEK B;  3ZGZ A;  1ZPS A;  2NVU I;  3M63 B;  2MRP A;  4KX6 B;  5CHW A;  3N3K B;  2DZJ A;  4KZC A;  1PGA A;  4FHK A;  3NRZ A;  2L52 A;  3QHT A;  2N7J A;  3ZVV A;  1B9R A;  1C4C A;  5D7G A;  1TYG B;  3AU5 A;  4LNK A;  4HCP B;  1GOZ A;  2J0M A;  3VUW A;  1JRP A;  1YX5 B;  2CKH B;  1J7B A;  1YN4 A;  1GG3 A;  4A20 A;  1L0Y B;  2DNF A;  1KOT A;  2IPK D;  1D5X C;  4AQ7 A;  3IXS A;  2FNJ B;  4NNJ B;  3KVF B;  3C19 A;  4NAW B;  3KUD B;  2HDE A;  4IDI A;  4RM8 A;  1QOA A;  1XF5 L;  1Q1O A;  4N9F 4;  3ZJV A;  2KMC A;  3ETR A;  2W3S A;  1C79 A;  1K8R B;  4K81 A;  4BKT A;  4BAX A;  4YTM B;  2L3Z A;  4A8X C;  2BYE A;  1LO5 D;  3ZDT A;  3H9D A;  2DX5 B;  2ZNV C;  4J3O D;  2WXP A;  1MHH E;  3DHG C;  3IVF A;  4W9D A;  1I4H A;  1SE2 A;  5BO4 B;  5JHA A;  1E7V A;  3H7S A;  2TSS A;  1SE9 A;  2KK8 A;  2WQY B;  2RMM A;  3AEG B;  3A9J A;  3H8H A;  3CST A;  1V5T A;  3NZS A;  4WQM A;  1EU3 A;  1GUA B;  1UUP A;  3O65 B;  3L10 B;  1I4G A;  2R2O A;  4ANU A;  4ANW A;  2J42 A;  3GB1 A;  4KDL B;  4M0W B;  3ZJU A;  3ML9 A;  1RLF A;  3DBH B;  3NVZ A;  1Q5W B;  3Q8F A;  1E8Y A;  5IAA C;  1P7E A;  2RDG A;  4P16 A;  1FRR A;  3MC0 B;  2V4L A;  2YEP F;  4S17 A;  3PS6 A;  1P1A A;  2J53 A;  4WWO A;  4LNO A;  4IM3 A;  4WJO A;  4IUM B;  4WJN A;  2GBM A;  2NS5 A;  2LGS A;  3A9K A;  3BZD B;  3QWZ B;  1D5Z C;  4LK0 M;  2BWF A;  3MHZ A;  1FM0 D;  2LJI A;  1TZO A;  4LCD E;  1SGH A;  1N5X A;  1E0Z A;  2DLB A;  3W5V B;  4P7I A;  5IOI A;  1P7F A;  2BWE S;  1WX9 A;  2PTL A;  2FE8 A;  2BQQ A;  1XCT L;  2KDB A;  3W1S A;  4NQL B;  2C9W B;  3AU4 A;  2RD0 A;  2A5U A;  2AWT A;  2MEK A;  1ET9 A;  2QCZ A;  1YOV B;  1CZP A;  3GS2 A;  1MFW A;  2KVR A;  1J7C A;  3IG3 A;  3X0W A;  1WRD B;  1YQB A;  5LXI B;  2G3Q B;  3JSV B;  2B3A A;  1M94 A;  2FCQ A;  2I2Y A;  2XEW A;  2RR9 A;  4FJZ A;  4B0M A;  3OJ4 B;  3N9Y C;  3KH0 A;  3FKY A;  4RNA A;  3KWV A;  2LGD A;  1NI3 A;  4OZC A;  2MP2 B;  3JYU A;  2KWU B;  4LNN A;  3URY A;  1UZX B;  2QMT A;  2W55 A;  2AQ1 B;  1FCC C;  2KX0 A;  3E56 A;  2WDT B;  4HLE A;  4A55 A;  1TY2 A;  3ZYY X;  2W54 A;  3RPF C;  5HHD G;  4WUR A;  3IT6 B;  1WJU A;  5E6O A;  4NPN A;  2WDQ B;  3IBE A;  2W82 A;  3U52 E;  3T3N A;  3VAW A;  1VZ7 A;  1JWU D;  4RF1 A;  2WXO A;  4W9K A;  3SFD B;  1V80 A;  2KT7 A;  3I57 A;  4GDK A;  4KKJ A;  2JF5 A;  3NJT A;  3SDL C;  5T8I A;  2KKC A;  3AMZ A;  4GSW A;  2WXF A;  3VRB B;  2SAK A;  3NZ3 A;  4HRO A;  3OG5 A;  2W9N A;  3VDZ A;  4DHZ B;  2O6V B;  2H89 B;  4YSY B;  2D11 A;  1E7P B;  3RUL A;  3X23 A;  4GB9 A;  4I6N B;  3B1L X;  3DOW A;  4OVV A;  4US8 A;  4TMA B;  5LNK 1;  3ML8 A;  2HE7 A;  2REX A;  3HHM A;  2IND C;  2HJ1 A;  5C2T B;  1WI0 A;  1V1P B;  1QOB A;  3DQV A;  3DBS A;  1D3Z A;  1V8C A;  2M1M A;  3DBR B;  2PKO A;  2JWZ A;  4IWO A;  4RGM A;  3PZ7 A;  2KXJ A;  4RMA A;  3L4P A;  4RM9 A;  1JCK B;  1KRH A;  2KLG A;  2GBR A;  3RZW C;  5J18 A;  1V2Y A;  3HK0 A;  4AJY B;  1PQS A;  1FXA A;  2LFI A;  2G9H D;  2K8B A;  2NCN A;  2KFK A;  1XLQ A;  3QK0 A;  4P6V F;  2M56 B;  2C7M B;  2BS2 B;  3PZ8 A;  5KHO A;  3DHH C;  4NJ6 A;  2FCS A;  3H1U A;  3FIL A;  3DWG C;  1WGG A;  1MHX A;  3KWL A;  4FN2 A;  4BFR A;  2K25 A;  3PRE A;  1STE A;  2C7H A;  1WYW B;  2IGG A;  2V0G A;  1ZDV A;  4MJS B;  4W9H A;  3PHW B;  4W9L A;  2KMM A;  3ZNI D;  4WWM A;  2KDE B;  2WYQ A;  1C3T A;  3U30 A;  4D2K A;  2MBO A;  2BF8 B;  4LJO B;  4WAA A;  1C4P A;  1TS2 A;  1WM3 A;  2BB6 A;  2NMQ A;  2ZW0 A;  4W9F A;  1C78 A;  2KNB A;  4CQN A;  1JWA D;  2WNM A;  4HJG E;  1E6E B;  2BW2 A;  2KFJ A;  4MGI E;  1BT0 A;  1JW9 D;  5IKC M;  4ANV A;  2WWZ A;  2BS4 B;  3UIP B;  5BYQ A;  2Q5W D;  3SR6 A;  5IA7 A;  2K6D B;  4YTP B;  1QQR A;  4ITK A;  2BVC A;  1RYJ A;  1PFD A;  3ZXR A;  1V6E A;  2IJ0 A;  2KD0 A;  2IO3 B;  4XYC A;  2WU2 B;  5EE3 A;  2WXN A;  2WLB A;  3CIR B;  4GN1 A;  2YEP B;  1L4Z B;  4NJ7 A;  1X1M A;  2M19 A;  2D3G A;  1RFK A;  4RGO S;  5AUK A;  1V97 A;  4JPS A;  2LRW A;  3MFG A;  4XZ4 A;  2FBW B;  1FXI A;  3AE6 B;  2KO3 A;  1WSP A;  2NPT B;  4IOI E;  2V3N A;  1V86 A;  2KLC A;  1DOX A;  4DXF A;  2JRH A;  2V3P A;  1WM2 A;  2WXJ A;  2LHD A;  2MJD A;  2V1Y A;  5JHB A;  4C4V B;  4HPP A;  4MGY E;  3ZNG C;  3GOE A;  1ESF A;  1I4R A;  4RGT A;  2KDF B;  5AEK B;  2NTS A;  1C77 A;  4EEW A;  1UEL A;  4DHZ E;  3PVL A;  3RNA C;  4GDL A;  2KWV B;  2MP2 A;  2K6Q A;  4J6I A;  3DVG X;  1NEN B;  1YJI A;  3P4R B;  3GZN I;  1ENF A;  3WAN A;  4I6L B;  3SU8 X;  4HCN B;  3ZXV A;  3ZTC A;  3TIX A;  4YTN B;  3R2T A;  2OED A;  2FCM A;  1E8Z A;  3APF A;  1C9F A;  3Q8B A;  1L2N A;  2LGX A;  3WCQ A;  4M01 A;  4XC2 A;  3NHE B;  2AL3 A;  2ZPY A;  4W9C A;  3RZF A;  4K3B A;  5AZH A;  1RWS A;  1WGK A;  2DZM A;  1QF6 A;  3BVM A;  2L32 A;  1L0V B;  3WA0 A;  3Q8E A;  2B76 B;  3RYT A;  2VZK B;  5JZE B;  4HXD A;  4MGK E;  2UYZ B;  1FO4 A;  5C3J B;  1PDX A;  3P4P B;  4ZRP A;  1IBX B;  3WAO A;  3RT3 B;  4W9J A;  1ZW7 A;  4MM3 B;  4R3D A;  2LAS A;  1T0S C;  4TSS A;  3VTW A;  3ZIM A;  4EZJ A;  4WWP A;  1ZP0 B;  3DWM A;  4ZYN A;  4NAM A;  4F1S A;  3BVZ A;  2MBQ A;  2ACZ B;  3NVW A;  5G55 A;  3VXW A;  2IO0 B;  2IY1 B;  2JWU A;  2EMS A;  1OQQ A;  3N1X C;  4IW0 A;  1BXT A;  3UF8 A;  2V9H A;  1MG8 A;  5AUI A;  1WXM A;  1QKZ A;  2VRR B;  2MHJ A;  2XN9 C;  4OW0 A;  4PK1 A;  4BOS C;  4K3C A;  3FIL B;  3AEB B;  2WDV B;  2DYO A;  2RPV A;  1Q0W B;  5H8Y E;  3ZTD A;  3I63 C;  5C23 A;  4ZRJ A;  5DPW A;  2INN E;  1L0X B;  4A9A A;  1V49 A;  4KSK C;  4PS8 A;  4PYU A;  5HG2 A;  3UI3 A;  4L2Y A;  3VRA B;  3KYC D;  3VTV A;  3DHI C;  2N9L A;  1LFD A;  3VH4 B;  3GE8 C;  1SE3 A;  1XCQ L;  2GOW A;  2XNA C;  1PYW D;  1JAL A;  2L1A A;  4DQO C;  3LB8 C;  1WMH A;  1K52 A;  4MJS A;  1T0Y A;  3N1Z C;  3PV1 A;  1H4R A;  2ZZP B;  4GOC A;  4DDG D;  1ROE A;  1Y56 A;  2ON8 A;  3Q69 A;  3EA6 A;  4WJP A;  3VH3 B;  2JYT A;  2JQR B;  5IP4 D;  2FID A;  5IN7 A;  4FAD A;  4EOY A;  1QIL A;  3DVN U;  2LMC A;  2L05 A;  2GLS A;  1P0R A;  2PMV A;  4AP4 C;  1CQV A;  4XDD A;  1E7U A;  2EKE C;  4FHJ A;  3VUX A;  3WAP A;  5L83 A;  1SBB B;  3I5J C;  1WF9 A;  4HKZ E;  1GB1 A;  2QEJ C;  1GNU A;  1WGH A;  3ABV B;  4KKI A;  1WGD A;  1SB3 C;  4BVU C;  3EGR A;  1FNU A;  4IWQ A;  4JL9 A;  3VFK A;  1UBQ A;  3EUB 2;  3HUI A;  1TS5 A;  1J7A A;  3RNG C;  2MA9 B;  2IGH A;  1IGC A;  1NVI D;  2KAJ A;  1VRA B;  4M02 A;  4E3C A;  4MT5 A;  3A1Q B;  2CJN A;  4XGA B;  2MWS B;  5EE9 A;  3OAW A;  3AE4 B;  2JVC A;  2CHW A;  1F9J A;  3BWU D;  4AJW A;  4E74 A;  3BK2 A;  4MDK E;  2NPT A;  1VR9 A;  4FUL A;  1E5W A;  4G3X B;  4RH6 A;  3VQI A;  4GDL B;  3PLU A;  1DOI A;  3NG0 A;  1GC7 A;  3L17 A;  4N59 A;  1MJD A;  3MHS D;  1G6J A;  2DHZ A;  2SEB D;  3BVG A;  1C76 A;  3AV8 A;  2YVC A;  2C7N B;  1B1Z A;  5CTR C;  2QHO A;  1F0Z A;  3W2D A;  2I1J A;  4IWP A;  1XEE A;  4DBG A;  4EE2 A;  2LGY A;  1GPX A;  2K22 A;  1LM8 B;  1FXT B;  1E10 A;  4XE0 A;  2WS3 B;  1I7H A;  1AAR A;  2LI5 A;  4JWU C;  1WZ3 A;  5KHQ A;  1YD8 U;  4B95 A;  3GZN B;  3AE5 B;  3SHQ A;  2KX3 A;  2DWQ A;  2L8J A;  1A70 A;  3DBL B;  5AZG A;  2WXR A;  1OEY J;  1K53 A;  1TKY A;  2RSU A;  4N58 A;  1XXG A;  3IT4 B;  1P9D U;  3DDC B;  3APD A;  2BGF A;  1FNW A;  1UWM A;  2D07 B;  2D2Q A;  4ZOH C;  3L13 A;  1ZE3 D;  5DPT A;  1QOG A;  1TT5 B;  1C4A A;  3DVN V;  3UQB A;  4W9E A;  1TTN A;  2BKR B;  1N63 A;  2XK5 A;  4URK A;  2RGF A;  2CU1 A;  3A9J B;  3SD5 A;  3B2F A;  4ICV A;  2IO2 B;  1TJE A;  1HZ6 A;  1IBX A;  2L83 A;  4K7W A;  4GXB A;  5GXG B;  3CWI A;  1V81 A;  1XLP A;  1XO3 A;  3QJZ A;  2K1F A;  3APC A;  1EUV B;  1R4N I;  1SEB D;  4G50 A;  1SIJ A;  2K8C A;  2QJL A;  3NVV A;  2HTM E;  1FPY A;  4MSQ B;  4IM2 A;  4BZA A;  5J2R A;  1JRU A;  3OWE B;  1NI2 A;  3EEC A;  4MEM A;  3AM9 A;  3SFE B;  2ZPN A;  3HVZ A;  3P4S B;  4KSL C;  1GC6 A;  2MBH A;  2ZNV B;  3W1Y A;  2GRI A;  3AEA B;  4HPL B;  2N1V A;  3P1M A;  1UH6 A;  4TUU A;  3L0W B;  4BKS D;  3WIM A;  3KLS X;  3Q14 C;  1WR1 A;  4BKS A;  4B6W A;  1VZ6 A;  4G0N B;  3P42 A;  2CU3 A;  1I4Q A;  3NVY A;  3AED B;  1F77 A;  2KJ6 A;  4PS7 A;  4MGZ E;  3H7P B;  2N1W A;  2QDF A;  2MJE A;  1V5O A;  5FR6 A;  1I4P A;  3U8Z A;  2QSD A;  2PIA A;  4NAW A;  1F1H A;  3U4E G;  1HZ5 A;  2O6V D;  2JU6 X;  1SJE D;  2O2V B;  4MAC A;  2RPQ A;  4ZRI A;  1HEZ E;  2M8S A;  4WQO B;  1V1O A;  3ZW3 A;  2KMA A;  2IBI B;  4MSM B;  3UIO B;  4XWW A;  1S3S G;  2MCN B;  1ACC A;  3RI7 C;  1P98 A;  3CMM B;  2VH2 A;  2GI9 A;  1PUT A;  4B9K A;  5D2M B;  4ICU A;  1SF0 A;  3W5U B;  1WZ0 A;  1WX7 A;  1KH0 A;  4TQ1 A;  3B2G A;  4G11 A;  2BT6 A;  3AEF B;  4LDT B;  4RFB A;  3ZQ4 A;  1T0R C;  3TL5 A;  1F52 A;  3R66 C;  4WAF A;  2OJR A;  3FC4 A;  3OLM D;  4M0W A;  1TBE A;  1JWM D;  2BPS A;  1FMA D;  4EZK A;  3RCZ A;  3KYD D;  1DYQ A;  3QQ8 B;  4F8C B;  1EM7 A;  1ZOY B;  4IM0 A;  4GMV A;  2JZZ A;  2ZVO A;  3UIN B;  2CS4 A;  1T3Q A;  5FR3 A;  3L08 A;  1U4A A;  2AQ2 B;  2HD5 B;  2KJH B;  4DK5 A;  2RDH A;  2G45 B;  1R4M B;  3WAL A;  2DAF A;  4LTU A;  3LJ3 A;  3PZD A;  3PSE B;  2MW5 A;  3QIJ A;  1JWB D;  2AQ3 B;  1V1P A;  2CHX A;  2ZW1 A;  3A9K B;  1NYQ A;  2PVO D;  4O1N A;  4H2A A;  2R61 A;  4REZ A;  3MP9 A;  2NBW B;  3O13 A;  2KJR A;  2FUG 1;  4A3P A;  4ZDV A;  1RAX A;  2WGS A;  4CO7 A;  3AB5 A;  3I9V 1;  2PLP A;  4US9 A;  1BUI C;  1WXS A;  5G5G A;  1N5W A;  2K9X A;  4PS3 A;  2BYF A;  2WXK A;  2R2Q A;  2G4D B;  4ACF A;  3R7R A;  4C00 A;  2AL6 A;  5JH5 C;  3HM3 A;  2KQS A;  3M95 A;  2N9E B;  5CHF A;  2CR5 A;  3RFZ B;  3VR9 B;  4K7S A;  1D6E C;  2DBY A;  2KDI A;  3R3M A;  4A3O A;  2N9K A;  3J9C A;  3MC8 A;  1MI0 A;  2O2V A;  4NY0 A;  1YJJ A;  2WXI A;  4M8M A;  1OQY A;  2NBV B;  1E8W A;  2LVP A;  4ZYS A;  2LD9 A;  1UNS A;  3IFW B;  4JWS C;  1WE7 A;  3UQA A;  4OVZ A;  4P1C C;  2DYM A;  2G4S A;  3DBR I;  3BII D;  3PGE A;  2GMI C;  3BY4 B;  4LNI A;  3Q3M C;  4HRS A;  4CHK A;  1TS4 A;  1ZKH A;  2N0S B;  1NDD A;  3KQ4 A;  1I42 A;  3RNF C;  1TGZ B;  2KVZ A;  4PT5 A;  2KC1 A;  2W3R A;  3TEY A;  3MJ5 A;  2X38 A;  5E6N A;  2KWC A;  2JPH A;  1WWT A;  2E6X A;  4ANX A;  2MSE D;  1FFU A;  2KAC A;  1UGM A;  3HRD D;  1OEY A;  5EE1 A;  3DBH I;  2IGD A;  1UWX A;  3AUL A;  1VD2 A;  3JSV A;  2KAN A;  3TMP B;  3ZRF A;  1UGJ A;  2ZVN A;  4DHJ D;  2JZ3 B;  3ZRC A;  1IP9 A;  4HPM B;  1XT9 B;  2JXX A;  3EHV A;  3R8B A;  3DVG Y;  3RN9 C;  2N9X A;  2LEK A;  1YN5 A;  1JRO A;  2N9P C;  1CMX B;  2MBB B;  1WY8 A;  2K8H A;  5EE0 A;  1HTQ A;  4MH0 E;  2BBC A;  3EC8 A;  2E3T A;  4GIV A;  2JT4 B;  1GB4 A;  3B9J A;  4YWG G;  1WH3 A;  2KFK B;  3RNC C;  3QX1 A;  1GAQ B;  3N20 C;  5DPS A;  5CX3 A;  2ZCB A;  1UBI A;  2WX0 A;  1I35 A;  1OQR A;  2YLM A;  3C0R B;  1WRI A;  3L16 A;  1SIF A;  2Y5C A;  3Q3N C;  1KLV A;  3Q6B A;  2PE9 A;  2KQ4 X;  3PRZ A;  3V3X A;  1F2R C;  1D5M C;  4YL8 A;  2V3S A;  4WJQ A;  2N4F A;  2CJO A;  1UD7 A;  4GDK B;  1EF1 A;  1Z2M A;  4RCO A;  4YSX B;  5BMH A;  2MLB A;  4XX5 A;  3C8Y A;  2K0P A;  2FAZ A;  2UWQ A;  2K39 A;  1CK1 A;  3AE2 B;  3Q8A A;  1HE8 A;  4E71 A;  2Z8L A;  1E8X A;  1YQ4 B;  3T8M A;  1FFV A;  5GMV A;  1K51 A;  2I1K A;  4P1B C;  1YN3 A;  3MC9 A;  2PVG C;  1UF0 A;  2L76 A;  3Q3J A;  3EFU A;  2D3B A;  4W9G A;  2KQ7 A;  1XD3 B;  2OHF A;  1EO6 A;  1XLN A;  1DGJ A;  4HJK A;  2ZCC A;  1JML A;  2JZP A;  2EEL A;  4M00 A;  4F7Z A;  5FKA C;  3CF6 E;  1E90 A;  4FA6 A;  4A6Q A;  2J0K A;  3NOB A;  3TEZ A;  1AWD A;  5IO9 A;  3JVZ X;  1Q10 A;  2D10 A;  2QIL A;  3PT2 B;  4XWT A;  3QAQ A;  3PTF C;  1ZDX A;  3AXC A;  4OZA A;  3S2A A;  1TIF A;  2LXA A;  4HDO A;  1HTO A;  2RDB C;  1F2R I;  2V4I B;  3NY5 A;  2KDM A;  3H7P A;  4KIK A;  2D5G A;  1L6V A;  5G2N A;  1ZUD 2;  3RUI B;  1VCB A;  3Q3F A;  1YQ3 B;  2JSV X;  4IKG A;  1N60 A;  1WIA A;  3JW0 X;  4ARC A;  4XDC A;  1DOY A;  1EU4 A;  3NUH B;  2ONQ A;  2UU7 A;  5FK9 C;  2J4X A;  2K3U A;  5MPO A;  1FCL A;  2HJ8 A;  1MG4 A;  1IUE A;  1WXQ A;  1TS3 A;  4JIO U;  4LNF A;  3ZLZ A;  5BYS A;  1KJT A;  3TJP A;  5DPR A;  1ZGU B;  2C60 A;  4DDI D;  2IO1 B;  2WXL A;  4OVU A;  1WJN A;  2L7R A;  4HVB A;  1XQQ A;  2I38 A;  3DBL I;  4NZL B;  3BYY B;  1KTK A;  2WXM A;  2Y3A A;  2LUE A;  2XK5 B;  2VH1 A;  3ZO5 B;  5HFY A;  4BBN C;  4KGR A;  4KV2 A;  3AN1 A;  2KC2 A;  1L7Y A;  4ZHO A;  1R7S A;  4WWN A;  1BML C;  1HQR D;  4DXG A;  2FUH B;  5JXV A;  2WXH A;  2ZEQ A;  1TKG A;  4AS1 A;  3Q3O C;  2HTH A;  3ZJT A;  2H88 B;  1WGR A;  4JGH B;  1IPG A;  4AUQ C;  3KUC B;  5E6P A;  3IAS 1;  1YX6 B;  1QZE A;  2GB1 A;  3LYY A;  1WX8 A;  4W9I A;  1VZ8 A;  2KTR A;  2LZ6 A;  1ZXI A;  4KDI C;  2NBU A;  3UGB B;  2BYT A;  4ZHP A;  1KLU D;  3VUY A;  3U7D A;  5BMI A;  2Y5P A;  3V6E B;  3P2B A;  4IG7 B;  2GBK A;  3V60 A;  4HDQ A;  1WJ6 A;  2WU5 B;  3EFC A;  2IYD B;  4FLH A;  1SJH D;  2KWD A;  5BMG A;  2LHE A;  1YJ1 A;  2KHW B;  1PGX A;  1T0Q C;  4M8N A;  4I6P A;  2C5L C;  2WXG A;  4NJC A;  3AEC B;  3IAM 1;  3M3J A;  3VHT C;  5D94 A;  2LVQ A;  3Q8C A;  3RD2 A;  1AW7 A;  1TZ1 A;  1NBF C;  4IC7 B;  3QCA A;  1RM6 C;  4C7Y A;  2NTT A;  2DZK A;  1L4D B;  3TSS A;  2Z59 B;  2MBE A;  5J17 A;  1KM7 A;  2KN4 A;  4II2 B;  3ZDM C;  1SE4 A;  1KF6 B;  5C1Z A;  2QC8 A;  4OZB A;  3VR8 B;  3RMK C;  2PEA A;  3NZU A;  4TQ0 A;  3ZNZ B;  3NS8 A;  2MQJ A;  3K9P B;  1XLO A;  1ISN A;  3V62 A;  3VTU A;  1T5X D;  1HXY D;  4ARI A;  2KOX A;  4TKN A;  5D3D A;  1MPE A;  3RNB C;  3CSF A;  1GJZ A;  2IY0 B;  4OHJ A;  4FXC A;  3PHX B;  3V61 A;  1AYF A;  3NS1 A;  1WXA A;  2KTR B;  2GBN A;  1FNV A;  1EF5 A;  3L54 A;  4DWF A;  3T9L A;  3QA8 A;  2BS3 B;  2BTE A;  2Y5B B;  1S1Q B;  2JUO A;  3GE3 C;  4BKG A;  2JYE A;  3A4R A;  2VZK D;  1NYR A;  1QOF A;  4KVG B;  4CYE A;  2JY6 A;  3ZNH B;  4WIP A;  4JX1 C;  3TUO A;  1JQ4 A;  1WGY A;  4PYZ A;  1LGR A;  2LRU A;  4JLC A;  3TBL D;  3W1S C;  5E6J A;  3AE1 B;  2K5P A;  3TEX A;  2AEH A;  4K7U A;  2L0T A;  3A4S C;  1K50 A;  1N62 A;  2Z0E B;  2WP9 B;  4UDU C;  3V05 A;  1FIQ A;  3DCG A;  2KTF A;  3ZKJ C;  1I4X A;  2AX5 A;  3HIZ A;  1LXD A;  1P3Q U;  1VJK A;  2WX1 A;  3ENE A;  1Z5S B;  1FD6 A;  4YT0 B;  1VLB A;  2X8X X;  1SSN A;  3N32 A;  3PRM B;  3RNE C;  2FCN A;  3AE3 B;  1HA5 A;  4GU2 A;  3H6N A;  2DZI A;  2J7Q B;  2QIE B;  2LJ5 A;  2OOB B;  3B0A A;  4C7Z A;  4ASW C;  1OGW A;  1YMH E;  3IHP C;  4HKQ A;  1IYF A;  3M62 B;  4AOF A;  4C4V A;  1IGD A;  3ZUN A;  1M4V A;  2PE6 B;  2M0X A;  3BYT B;  3B08 A;  5DCN A;  1AN8 A;  3AE9 B;  2J52 A;  5TSS A;  3I3T B;  2NR2 A;  1WJ4 A;  2GBJ A;  2PW9 A;  1WYG A;  4B0E A;  4HWI B;  2D3A A;  2INC C;  4GLS C;  3V6C B;  2ICI A;  3BK1 A;  1N61 A;  5H92 C;  1TY0 A;  2PJH A;  3N30 A;  2WXQ A;  2JRI B;  4HEA 1;  4HK2 A;  3AE8 B;  3SEB A;  4LLG M;  2MH7 A;  4NQK E;  1MVK A;  2BKF A;  2AYO B;  2CHZ A;  1KLG D;  1EWY C;  4N6E B;  1E9M A;  4LJP B;  2M4N A;  1WE6 A;  5AZF A;  3PLV A;  4GGQ A;  5D3I B;  3DPD A;  2WDR B;  3K9O B;  3ALB A;  4FJY A;  2ZJD A;  4JQW C;  3QC8 B;  3QAR A;  4Q2J A;  4RGN A;  1WFY A;  3HVD A;  2L00 B;  3Q2A C;  4LDT D;  2M17 A;  1H8C A;  2BYV E;  3P4Q B;  4BOZ B;  2A4Z A;  4ZRQ A;  5I4D A;  3KW5 B;  2EKI A;  2Z0D B;  3R7Q A;  4FJV B;  2LVO A;  3FAH A;  4A90 A;  3OJ3 A;  1J0G A;  1WR6 E;  3N1Y C;  3A1Q A;  1VDV A;  1KFY B;  1WXV A;  2G1E A;  2D3C A;  2LXC A;  4JE3 B;  2DYB A;  2O6V A;  1R4M I;  5LLI A;  4TV3 A;  2WHI A;  4KGT A;  5EDS A;  1TKE A;  1N6Z A;  3LDZ E;  3MTN B;  3AE7 B;  3PO0 A;  5HKH A;  3LXF A;  1EWC A;  2DAJ A;  3KUZ A;  1L6U A;  1A5R A;  3ECI A;  1Y8R C;  2MJ3 A;  5CHV C;  2INP E;  1QLB B;  4WH4 A;  3AH7 A;  1CJE A;  1ZXH A;  3U7Z A;  2LWP A;  3WAM A;  1J19 A;  4ZRK A;  2KN5 A;  3T3O A;  3AI5 A;  4MEL A;  3W9C B;  3PRP B;  4QAY A;  4MH8 A;  1RRB A;  2PPH A;  4RF0 A;  5HI1 A;  4II3 B;  4C56 C;  2N7D A;  4KIK B;  1FRD A;  1D4B A;  4FBJ B;  4EZL A;  4EKU A;  4L1B A;  1SXT A;  3BIN A;  2IZV B;  2EMT A;  3HM6 X;  1R4N B;  3PPA A;  2MX2 A;  2XBB C;  2KYW A;  4YXD B;  1T6B X;  2LGI A;  1LQB A;  4EFO A;  3A33 B;  2N7E A;  1YNT E;  4AWJ A;  1J8C A;  4C80 A;  3TCA A;  4KGS A;  4K1R B;  4X57 B;  5G5H A;  2DEN B;  1L5P A;  4BBN F;  2FIF A;  2JXT A;  4S0R A;  5LXH A;  1WMH B;  3E9S A;  1YIW A;  1QT9 A;  4L23 A;  2M0A A;  4DXA B;  1JWS D;  3U2S C;  3MJW A;  3TEW A;  3P63 A;  2ASQ A;  3R2I A;  5TR5 A;  4MM3 A;  2KZR A;  1OFF A;  4DHJ B;  2BB5 A;  4KZ0 A;  1C1Y B;  1V9J A;  2OJW A;  3AEE B;  1RFA A;  5BYR A;  3ONS A;  1FEH A;  2IDY A;  4EUT A;  2JX5 A;  4YSZ B;  2LUM A;  5D6J B; 
#chains in the Genus database with same CATH homology
 1I4P A;  1ESF A;  2QSD A;  4ZHO A;  1I4R A;  1R7S A;  2PIA A;  4RGT A;  3GP7 A;  3U4E G;  1BML C;  1C77 A;  1HQR D;  1HZ5 A;  2NTS A;  2JU6 X;  4DXG A;  1ET6 A;  1PGB A;  1SJE D;  1NEK B;  2WXH A;  4USA A;  5JXV A;  3ZGZ A;  1TKG A;  4AS1 A;  4MAC A;  3ZJT A;  2H88 B;  1ZPS A;  1HEZ E;  1V1O A;  3IAS 1;  4KX6 B;  3LYY A;  2GB1 A;  1NEN B;  1YJI A;  1PGA A;  4XWW A;  3P4R B;  3NRZ A;  1VZ8 A;  2L52 A;  2N7J A;  1ENF A;  1ACC A;  1ZXI A;  1B9R A;  2GI9 A;  1C4C A;  2BYT A;  5D7G A;  1TYG B;  1PUT A;  4ZHP A;  1KLU D;  4YTN B;  1GOZ A;  3R2T A;  2OED A;  5BMI A;  1SF0 A;  1JRP A;  3W5U B;  1J7B A;  1YN4 A;  2Y5P A;  3Q8B A;  1C9F A;  1KH0 A;  4TQ1 A;  1L0Y B;  3B2G A;  2BT6 A;  2IPK D;  1D5X C;  3AEF B;  3IXS A;  4RFB A;  4AQ7 A;  3ZQ4 A;  3WCQ A;  4NAW B;  2WU5 B;  2HDE A;  4IDI A;  1SJH D;  1QOA A;  1XF5 L;  3FC4 A;  4WAF A;  2KWD A;  4M0W A;  5BMG A;  2LHE A;  3ZJV A;  3ETR A;  1RWS A;  1JWM D;  1WGK A;  1QF6 A;  1FMA D;  3BVM A;  2L32 A;  1L0V B;  2W3S A;  1PGX A;  1C79 A;  3Q8E A;  4YTM B;  2B76 B;  2VZK B;  1DYQ A;  2WXG A;  4A8X C;  1FO4 A;  4NJC A;  1EM7 A;  3AEC B;  5C3J B;  1ZOY B;  3IAM 1;  1PDX A;  1LO5 D;  3P4P B;  4ZRP A;  4J3O D;  2WXP A;  1MHH E;  1IBX B;  1T3Q A;  3Q8C A;  5FR3 A;  2AQ2 B;  1I4H A;  1SE2 A;  2RDH A;  1AW7 A;  4MM3 B;  4R3D A;  4TSS A;  4LTU A;  2TSS A;  1ZP0 B;  1RM6 C;  4C7Y A;  3DWM A;  2NTT A;  2WQY B;  1L4D B;  3TSS A;  1JWB D;  2AQ3 B;  2RMM A;  3AEG B;  3H8H A;  1V1P A;  4NAM A;  2ZW1 A;  3BVZ A;  2KN4 A;  1SE4 A;  1NYQ A;  1KF6 B;  2ACZ B;  4WQM A;  2PVO D;  1EU3 A;  1UUP A;  4O1N A;  4OZB A;  3VR8 B;  3NVW A;  1I4G A;  2R61 A;  4H2A A;  4REZ A;  2J42 A;  3GB1 A;  2JWU A;  3MP9 A;  3O13 A;  1OQQ A;  1BXT A;  4TQ0 A;  3ZJU A;  2FUG 1;  1XLO A;  3NVZ A;  5AUI A;  3Q8F A;  1T5X D;  1HXY D;  1QKZ A;  4ARI A;  3AB5 A;  3I9V 1;  2PLP A;  4US9 A;  1P7E A;  2RDG A;  1MPE A;  5D3D A;  1BUI C;  4P16 A;  1FRR A;  2XN9 C;  4OW0 A;  5G5G A;  1N5W A;  3MC0 B;  2K9X A;  2YEP F;  4OHJ A;  4FXC A;  2WXK A;  3FIL B;  2J53 A;  1AYF A;  3AEB B;  3NS1 A;  2WDV B;  1FNV A;  2DYO A;  2RPV A;  5H8Y E;  2BS3 B;  2BTE A;  3BZD B;  2JYE A;  2VZK D;  1NYR A;  1QOF A;  1D5Z C;  4LK0 M;  3MHZ A;  1FM0 D;  2INN E;  1L0X B;  4WIP A;  3RFZ B;  2LJI A;  4A9A A;  1TZO A;  4JX1 C;  3TUO A;  1JQ4 A;  3VR9 B;  1N5X A;  1E0Z A;  1D6E C;  2DLB A;  2DBY A;  3W5V B;  5HG2 A;  1P7F A;  5E6J A;  3AE1 B;  2K5P A;  3TEX A;  3UI3 A;  2N9K A;  2PTL A;  3J9C A;  2FE8 A;  4L2Y A;  3VRA B;  1K50 A;  1MI0 A;  1XCT L;  1N62 A;  2WP9 B;  3W1S A;  4UDU C;  3V05 A;  2N9L A;  1FIQ A;  1YJJ A;  2WXI A;  1SE3 A;  1XCQ L;  1I4X A;  2AX5 A;  1ET9 A;  2MEK A;  2XNA C;  1CZP A;  3GS2 A;  1J7C A;  4ZYS A;  1UNS A;  1PYW D;  1JAL A;  2L1A A;  4JWS C;  4DQO C;  3LB8 C;  2DYM A;  4OVZ A;  1K52 A;  3BII D;  1VJK A;  2I2Y A;  4HRS A;  1FD6 A;  4B0M A;  1TS4 A;  4YT0 B;  1VLB A;  1SSN A;  3N9Y C;  1ROE A;  1Y56 A;  2N0S B;  2ON8 A;  3Q69 A;  3EA6 A;  3AE3 B;  1HA5 A;  3KWV A;  4RNA A;  2JYT A;  3KQ4 A;  2JQR B;  2QIE B;  1QIL A;  4PT5 A;  1NI3 A;  2LMC A;  4OZC A;  2W3R A;  3TEY A;  3URY A;  4C7Z A;  1YMH E;  2PMV A;  3MJ5 A;  4HKQ A;  2X38 A;  2QMT A;  2W55 A;  2AQ1 B;  1FCC C;  1CQV A;  1IGD A;  1WWT A;  2E6X A;  1M4V A;  3E56 A;  4XDD A;  4A55 A;  1TY2 A;  1FFU A;  2KAC A;  3BYT B;  3ZYY X;  2W54 A;  1SBB B;  3RPF C;  5HHD G;  1AN8 A;  3AE9 B;  3HRD D;  2J52 A;  5TSS A;  5EE1 A;  4WUR A;  4HKZ E;  1GB1 A;  2IGD A;  1UWX A;  2PW9 A;  2QEJ C;  3IT6 B;  1WYG A;  4B0E A;  4GLS C;  3ABV B;  4KKI A;  1SB3 C;  2WDQ B;  3EGR A;  2ICI A;  1FNU A;  2W82 A;  3U52 E;  3T3N A;  1UGJ A;  3BK1 A;  1N61 A;  1VZ7 A;  5H92 C;  1TY0 A;  1JWU D;  4RF1 A;  2WXO A;  3EUB 2;  3HUI A;  1TS5 A;  1J7A A;  2WXQ A;  3SFD B;  4HEA 1;  3AE8 B;  3I57 A;  3R8B A;  3SEB A;  4KKJ A;  4LLG M;  2MH7 A;  1MVK A;  2IGH A;  1IGC A;  1NVI D;  2KAJ A;  5T8I A;  1VRA B;  1KLG D;  3AMZ A;  1EWY C;  4MT5 A;  2LEK A;  1E9M A;  1YN5 A;  2CJN A;  4N6E B;  1JRO A;  5EE9 A;  2WXF A;  3VRB B;  2SAK A;  3AE4 B;  3NZ3 A;  4HRO A;  5EE0 A;  2BBC A;  5D3I B;  2H89 B;  2E3T A;  4YSY B;  3BWU D;  1GB4 A;  2WDR B;  1E7P B;  3BK2 A;  3B9J A;  4YWG G;  1VR9 A;  4US8 A;  4TMA B;  4RH6 A;  5LNK 1;  3VQI A;  4GDL B;  1GAQ B;  4Q2J A;  4RGN A;  3HVD A;  1DOI A;  4N59 A;  5C2T B;  3P4Q B;  1V1P B;  1OQR A;  1QOB A;  4ZRQ A;  2SEB D;  3BVG A;  1C76 A;  1WRI A;  5I4D A;  3AV8 A;  2Y5C A;  2EKI A;  1V8C A;  2KQ4 X;  1B1Z A;  3V3X A;  2PKO A;  1F2R C;  1F0Z A;  3W2D A;  1D5M C;  3FAH A;  4A90 A;  1XEE A;  4EE2 A;  4RGM A;  3PZ7 A;  1GPX A;  1VDV A;  1KFY B;  2K22 A;  2G1E A;  3L4P A;  2CJO A;  1JCK B;  1E10 A;  1KRH A;  4GDK B;  4JE3 B;  4RCO A;  4YSX B;  4XE0 A;  5BMH A;  2WS3 B;  1I7H A;  4KGT A;  1FXA A;  4JWU C;  2LFI A;  2G9H D;  1TKE A;  3C8Y A;  1XLQ A;  2M56 B;  2K0P A;  3PZ8 A;  4P6V F;  2BS2 B;  3AE5 B;  2DWQ A;  1A70 A;  3AE7 B;  1CK1 A;  3FIL A;  3PO0 A;  3AE2 B;  3DWG C;  3Q8A A;  1MHX A;  3KWL A;  1EWC A;  1YQ4 B;  2WXR A;  2Z8L A;  3LXF A;  1FFV A;  1K51 A;  1YN3 A;  2PVG C;  1K53 A;  1TKY A;  1L6U A;  1STE A;  4N58 A;  1XXG A;  3IT4 B;  2MJ3 A;  2OHF A;  1XLN A;  1FNW A;  1QLB B;  1DGJ A;  1UWM A;  2IGG A;  2INP E;  4WH4 A;  2V0G A;  1ZDV A;  1JML A;  2JZP A;  3AH7 A;  4ZOH C;  1ZE3 D;  1QOG A;  1CJE A;  1ZXH A;  2EEL A;  3U7Z A;  1C4A A;  5FKA C;  2KMM A;  1N63 A;  3T3O A;  3W9C B;  4WWM A;  4A6Q A;  4D2K A;  3TEZ A;  1AWD A;  1C4P A;  1TS2 A;  3B2F A;  2BB6 A;  1Q10 A;  4MH8 A;  1TJE A;  2NMQ A;  1HZ6 A;  2ZW0 A;  4RF0 A;  5HI1 A;  1IBX A;  4C56 C;  2L83 A;  1C78 A;  4CQN A;  2QIL A;  1JWA D;  4XWT A;  1FRD A;  2WNM A;  4HJG E;  5GXG B;  1D4B A;  1E6E B;  2BW2 A;  3CWI A;  1XLP A;  4L1B A;  1SXT A;  1XO3 A;  1JW9 D;  1ZDX A;  4OZA A;  2BS4 B;  1SEB D;  5BYQ A;  2Q5W D;  3SR6 A;  1F2R I;  2V4I B;  1SIJ A;  2QJL A;  3NVV A;  2KDM A;  2HTM E;  4YXD B;  1T6B X;  2D5G A;  4YTP B;  1L6V A;  1QQR A;  4ITK A;  1ZUD 2;  1RYJ A;  2LGI A;  1PFD A;  3OWE B;  2IJ0 A;  3AM9 A;  3SFE B;  1YQ3 B;  1YNT E;  4C80 A;  4KGS A;  2JSV X;  4IKG A;  1N60 A;  5G5H A;  5EE3 A;  2WU2 B;  2WXN A;  2WLB A;  1L5P A;  3HVZ A;  3CIR B;  2JXT A;  3P4S B;  4ARC A;  4XDC A;  3E9S A;  1EU4 A;  2YEP B;  3NUH B;  1DOY A;  1QT9 A;  4L23 A;  2M0A A;  1L4Z B;  2ONQ A;  5FK9 C;  1JWS D;  2J4X A;  2K3U A;  3U2S C;  3TEW A;  5MPO A;  2GRI A;  3AEA B;  1FCL A;  2M19 A;  1RFK A;  3P63 A;  4RGO S;  5AUK A;  3R2I A;  3P1M A;  1IUE A;  1V97 A;  4JPS A;  1OFF A;  1WXQ A;  2BB5 A;  1TS3 A;  3MFG A;  3KLS X;  2FBW B;  1FXI A;  3AE6 B;  5BYS A;  1WSP A;  1VZ6 A;  4IOI E;  2V3N A;  1DOX A;  2WXL A;  3AEE B;  3P42 A;  4DXF A;  5BYR A;  2I38 A;  2CU3 A;  1I4Q A;  2V3P A;  1FEH A;  4NZL B;  3BYY B;  1KTK A;  2WXM A;  2WXJ A;  3NVY A;  3AED B;  1F77 A;  2Y3A A;  2IDY A;  2LHD A;  2MJD A;  2JX5 A;  5HFY A;  4YSZ B;  2LUM A;  4KGR A;  3AN1 A;  2MJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...