2LV8A

Solution nmr structure de novo designed rossmann 2x2 fold protein, northeast structural genomics consortium (nesg) target or16
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
110
structure length
110
Chain Sequence
b'MLLYVLIISNDKKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRKESQNIKVLILVSNDEELDKAKELAQKMEIDVRTRKVTSPDEAKRWIKEFSEEGGSLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords De novo designed rossmann 2x2 fold protein
molecule tags De novo protein
source organism Artificial gene
publication title Principles for designing ideal protein structures.
pubmed doi rcsb
total genus 41
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lv8A00
2MR5A 2LCIA 2LR0A 2LRHA 2LVBA 2KPOA 2N3ZA 2MR6A 2LV8A 2LNDA 2L82A 2L69A 2N75A 4J29A 2LTAA 5GAJA
chains in the Genus database with same CATH superfamily
1P3JA 3LY9A 1QFYA 4WCFA 3C3XA 3R7WA 3VYUB 2QXUA 2P5YA 2YHIA 5J1SB 1FYXA 1PNTA 3BHJA 1IMJA 2O3JA 4G09A 1I33A 1WBDA 3LLSA 3RVPA 3V8RA 5HS4A 1TU4A 3JQEA 2BPOA 1BWSA 3OEED 4EVRA 3OOSA 4WLNA 4E08A 3JQ7A 1XZLA 1PGNA 1QB7A 3SSAA 2V7PA 3WK4A 4TQ9A 5MN6A 3VDXA 5LQMA 2GASA 1E1MA 2A1IA 3CN9A 3JVDA 2YFHA 3NV7A 3DMHA 2WP0A 3WL6A 1HTTA 4AZ3B 2DFNA 1KO7A 3D6VA 3H5OA 4OFZA 2JI7A 2QX8A 4PSCA 1EP2B 4DGSA 2MSDB 5JTTA 3LQQA 5T8KC 3AVVA 1ONPA 1UPBA 1G3RA 2XNDA 3PVSA 4MHOA 2YC4C 2QLBA 2WB4A 5DWQA 2EERA 1LDBA 1E9AA 3QV2A 2C8KA 2XZTA 3RJZA 3MW8A 1RQXA 5IBCA 4Y7DA 2HDHA 2Z2IA 2WHXA 5CNMA 2BF7A 3ZTWA 4X24A 5J59A 3W4KA 4RKFA 2O5CA 2A78A 3B1ZA 2XNHA 4Z0NA 2OXRA 5G3YA 2YQ4A 4EYOA 2QL7A 2FZCA 3HYLA 1XXHE 1I1HA 2XF8A 4W1SA 1DRUA 2PKYX 1IWOA 3Q98A 1TZJA 5GONB 4RV9A 3WGUA 4ZI2A 4R2XA 2B4TO 2WEKA 4WXMA 3UWDA 3ZLBA 4Y2GA 3VR5A 1R37A 2NTJA 2PX5A 4OHMA 2PKQO 1FXWF 3HY4A 1YL7A 2PXXA 4IIXA 4CIDA 4EB0A 1WOYA 5G53C 1Y9ZA 4R6XA 4RTLA 3FGPA 1CFZA 4DCVA 1LCIA 1A7JA 4YRMA 1XZEA 3TIVA 5EHZA 1ZCJA 2FWAA 3NC4A 4PGHA 1C4WA 1P62B 4W5WA 3UMVA 1IQUA 4UUAA 3V7UA 2DAPA 2XKJE 5DNUA 4I1PA 3ZE0B 2HPVA 4A8JA 3MJSA 2DWUA 2BW0A 2N75A 3T35A 1FDSA 3E9EA 5KWVA 3B3GA 4BP9A 1ZIOA 5AVUA 4FDUA 1GNPA 3R3JA 4H7KA 4TLMB 2FSFA 3HJGA 1FQWA 1ESEA 4I46A 2ONJA 5B55A 3K2QA 4HKTA 2J7PD 3DMDA 4PO3X 2JGMA 4MW9A 5DX1A 3WO0A 3ZS8A 2C8LA 3C3MA 3F96A 1NLYA 1WVIA 1E9RA 1D2HA 3I01M 4GLFA 4EGFA 1V2HE 3QOYA 2OCKA 4C4AA 1JT9A 3JSAA 5A4IS 1ADFA 2A5YB 2CNOA 1K89A 5FPYA 4JP1A 1N6HA 4ZT7A 2HA5A 4IHKA 1R2QA 4Z1MD 1UBRS 3HVUA 3LE8A 1OX4A 3FG9A 4L9AA 4QGFA 1O0CA 4ALIA 2PL9A 1GO2A 3MLBA 4HP8A 2BZ1A 4BVJA 4RWZA 2BFAA 2PTGA 3B5IA 4YONB 2ZRFA 5DYIA 3Q5GA 4JVOA 2CWDA 2Z6VA 3E9QA 4JHLA 5EMLA 1CUYA 5CFPA 1NJ1A 1UK9A 1EIWA 2O7SA 2A9QA 3H86A 1U1DA 2RI0A 4G9GA 4Q4HA 4QQRA 3WZ2A 1KIFA 1DEOA 4BDTA 2G36A 2Q29A 1HA3A 4LWZA 1JLHA 2ID8A 4JLMA 4V2UA 4ZVRA 1YU9A 1RRFA 3UK6A 3PDCA 4ZOCA 3SS7X 2I4NA 2LDBA 3GRUA 3RIGA 1SXJD 2QAGC 2ZJ3A 4ZHQF 2J32A 1ZJ4A 4TTQA 4DLVA 2X14A 3LUDA 1W25A 2H52A 1I7NA 2R8EA 2ASEA 4GPAA 3E84A 3FOFC 4HEA1 1KZ4A 3TSZA 2CVQA 4A2QA 1XQVA 2A92A 3TR5A 2PQMA 2A3NA 1P5ZB 3KT0A 5IT0A 3N58A 4J7XA 1GYQA 1RAEA 2VWHA 3A2LA 4RE5A 5J5CA 3D3JA 3TFQA 3AB8A 4CMJA 3BMOB 3ORQA 3DZGA 3CNNA 4X60A 2O0KA 4BIMA 4M21A 5DM1A 3NANA 1NU6A 3BRWD 6Q21A 1G8MA 1TXGA 3IV6A 4X9XA 2HSWA 1RYHA 2EKPA 4MROA 1QHEA 1Q92A 2R8PA 1F0PA 3QW4B 2C4MA 4HXYA 2W6IA 5CRIA 3PRYA 5LR6A 4WBNA 1C1YA 3RTDA 2WJJA 1Y6GA 1TYZA 5CA0B 2O7QA 4DJAA 1EVZA 3T5BA 2JEOA 1LJLA 4V3BA 2PVSA 1SOWA 4U7GA 4KU4A 2IZ0A 2PS1A 2VYVD 1T29A 2Z4TA 3AEUB 4J0GA 3RUHA 4DLLA 3EULA 3K70B 3RC8A 3N8IA 5JCPA 4ZKEA 1HYQA 4YX9A 5CB6A 1O97C 5ILOA 2SKEA 1AVTA 3BD9A 3P9NA 5AJZA 3VSCA 3ZNPA 4YMLA 1L5KA 2DTEA 2OO3A 3AI1A 5LBUA 4D3YA 1T35A 3SC4A 3M4XA 4K0KB 1KSGA 3NKFA 2QX4A 4HAXA 2ZJYA 1H2HA 1K5PA 2XXJA 3PNLA 1CUZA 4KGXA 4K5QA 3ROPA 3L43A 3BFJA 3NTOA 3C45A 1ZVVA 4XEUA 3QEOA 4II3A 3V1UA 1D9XA 5EP3A 4NU5A 5DCWA 3CX3A 4MQEB 4F5WA 3I6QA 3QENA 1G59A 2QSZA 3VZRA 1BMFD 1OIWA 2B5OA 3AFOA 4B45A 3MWLA 4NESA 1UFOA 1I2DA 3DWGA 2RBEA 1H5NA 3IQDB 2Q6VA 3BH7A 4ZXFA 2C61A 5J2TF 4YRQA 1J56A 1D0VA 2FEKA 4NFLA 4PZ9A 2XRZA 4M46A 4WN3A 5JSKA 2A4MA 1U0RA 4FDAA 1LK5A 2IEDA 1GDHA 4JLNA 3RYCA 4F5YA 5BV1A 4CIBA 4LSGA 2J07A 3WIOA 1G4UR 3AEKB 5AM5A 4PLPA 1THMA 3LX8A 3LW8A 3ETEA 1ONNA 3HBNA 4TTSA 4KBFA 1E2DA 2BGRA 3ICEA 4F97A 2Z8YA 1NW6A 4JQCA 4BNTA 2WVJA 2DR3A 3ZNOA 1MEEA 1NJ8A 2GYYA 3V9AA 3ROGA 1KNQA 1RM5A 5L3RA 4H2DA 1DZIA 1FDVA 3ZZMA 3RBXA 3PFHA 3HCNA 4QOFA 3UG7A 1N3BA 4IZOA 2HA3A 3GUVA 5GGXA 5IH7A 4JOBA 4CPDA 4NCIA 4Z9AA 3RFXA 4E4TA 3OIWA 5EEGA 5DGHA 2EYQA 2ZIEA 1RJ9B 2WHRA 3OOWA 2X1HA 4IOJA 3IVMA 4AO6A 3PXGA 4BRUA 2D74A 2CDCA 2CW5A 4B8YA 2PUEA 4CMKA 1ZX1A 4CI9A 3LGSA 1SKAA 2VJAA 1NI5A 4K9OA 3TZBA 1PNVA 2H57A 2PZBA 1E9DA 2J3JA 3BEOA 2R79A 2QJWA 1NIJA 1Y1TA 2IYXA 2WJ6A 3F5MA 3QEMA 3N0TA 4LGVA 4YRFA 3WJAA 5C1IA 2NPOA 4ZZ2A 4E33A 2WAAA 3GGDA 3L05A 4F8YA 3HBAA 2EP7A 3L7DA 1SD5A 4IDGA 3P9SA 5ALPA 1RE0A 3SJ7A 1YBFA 3WMEA 3QF7A 1N0VC 4YMGA 3DFUA 3LKDA 5LMUB 3PPYA 1V5FA 2ZSUA 2ZVDA 1U98A 1PEKE 3FHJA 3QA9A 4RHXA 1Z37A 4CCSA 1U3FA 5TMPA 4HSEA 4LXTA 1ISRA 3JW8A 4KQJA 4HQFA 5C1OA 3RYHA 4FE7A 3NVMB 4GPBA 4HZUB 5HFNA 3M2PA 3RGGA 3VBEA 4DDHA 1AQJA 1L5QA 2EKQA 4JGIA 1GU7A 1CPYA 3CUVA 4HDKA 1W94A 3BMQA 4AF7A 1PTKA 5IDQA 1Z0ZA 2XUPA 1ACLA 3WLAA 1PR3A 2IHJA 1E3EA 3UWMA 2RONA 1SCQA 4F4UA 4Q1AA 4PX2A 1QQ5A 2Y1KA 1FNBA 3IMKA 3LC2O 4KL8S 4P5EA 1FRZA 1E1RA 1ZK2A 2GN0A 3OICA 1U4NA 4Y2SA 5LB2A 3ESAA 4C20A 4F4HA 3IKLA 1T9KA 2C9BA 2IOFA 1ESCA 2MSLA 2ZRMA 4YEDA 1J1IA 2P4QA 2WM8A 4KCGA 5B3JC 4FW9A 4B71A 2Q2QA 3ZV3A 1E3QA 1E5LA 2NU9B 1JILA 4REMA 2EFGA 5J47A 1S4QA 3IP8A 1CNMA 3GT0A 3EBLA 2GRJA 2A67A 3IBFA 1U8UA 3INGA 3O03A 4CVNA 1YRQA 2W2MA 4RNCA 4WOBA 1RQRA 2FXVA 3IQIX 1R0BA 3O82A 4V03A 5DISB 4B5KA 3R5TA 4PTZA 5DSXA 2BM1A 5AM0A 5H4HA 1DBWA 2JJMA 3VVLA 5AXCA 1X94A 1Z82A 4LV5B 3V4OA 3JVVA 1Q7EA 2Q3BA 4WZAB 1AB6A 4CKXA 4ZN6A 3KSAC 2EC5A 3DHVA 3IPRA 4CRWB 5C3UA 1V3QE 1DMRA 4FPXA 4E5YA 3HA2A 1L5SA 4Q3OA 1XK7A 1GQOA 1YV9A 1R0ZA 1O57A 3HLYA 5G4KB 3R75A 2QVBA 2DUWA 1EQ2A 3BSYA 1ZJYA 3IAS1 2R1TA 4PLHA 1N6IA 5TARA 1I2ZA 2LGJA 5JO0A 5A04A 4KEAA 2F8SA 1WW3A 3HUDA 4RPLA 3BFXA 5TDHA 5ICFA 1F5NA 3SM9A 5CYGA 1E89A 4FSDA 1MG0A 4G86A 3IAHA 4PS1A 3V7WA 5D3MB 3SR4A 1ZW1A 4E6PA 2VJPA 3CR8A 3I5MA 2EEPA 1KA9H 4YH1A 3TRKA 1G2QA 1CR6A 2XMZA 1VRVA 2ZGVA 2PSEA 4HGRA 3WLTA 1VB3A 4CKWA 1Z06A 1UWCA 2Z8XA 3FMFA 1E61A 4JLWA 4WERA 1H6CA 3EXG1 4RHYA 2VL7A 3AKCA 2RGDA 1RLJA 2FJPA 1R8QA 3W8DA 1RWNA 3BJZA 4KE6A 4XWAA 5LCXA 3JVEA 1VE5A 4HNSA 2H2AA 1B0AA 3E1GA 4KXVA 1PI3A 4OV6B 2B2XA 3CTPA 1V1MA 2Q28A 2JGFA 2MIIA 3HKDB 3OF3A 4IOMA 1MJHA 1WHTB 1ICIA 1RI2A 1TX4B 2ORYA 4I50F 2GMWA 4IIVA 1Z5NA 1QQTA 2EYUA 1L6IA 2GBIA 4ZC8A 1AXGA 1F2DA 4KDFA 5FCDA 1JTVA 3STTA 3CG4A 4M2LA 3KZMA 3QY0A 4RWEA 1T9BA 3PWZA 4TROA 1N5JA 1N6PA 1W93A 3A10A 3LA6A 1LC0A 2V8OA 5KYVA 5FYDA 3R0IA 5K09A 1DJLA 2NZYA 2VIIA 1N2BA 3VX3A 1XPRA 5EWMB 4MHSA 3BFKA 3A9WA 3S2GA 3U7EB 2BMJA 3VOAA 3BH6A 1OVMA 3K1AA 3LX6A 4N39A 3E03A 5FLKA 5JNRA 1Z7GA 3PGXA 1D6NA 3GMTA 2BCEA 1LI5A 1UANA 3GD7A 4D44A 4BB6A 4PBRA 3OPQA 4DAEA 4RVUA 4OQXA 4UUMA 5D7NA 5AVZA 3O8CA 4CQMA 5J2UB 4OHVA 1NXWA 4FQ7A 2AKYA 1BVYF 1T9GS 4FZVA 4OFWA 5COAA 5IC5A 3V7NA 2EG9A 4QIHA 1XNQB 4RJTA 1BS2A 4R1OA 4W1PA 4ZGBA 1NURA 3E2IA 1FFAA 1MC8A 3PPVA 4LJ5A 5TVGA 2WF5A 3FTFA 2WAMA 3IQGX 3ERCA 1YJXA 4PZZA 1WXGA 1TW3A 4R4JA 3ILHA 1WSAA 2FAXA 5JVDF 2VG8A 1OXMA 1ZUNB 5FWDA 1PZNA 1W581 3PUJA 4BLTA 3IBGA 2P68A 4PQGA 5ULLA 1M5UA 3RLIA 4UM9B 4MVJF 2FPRA 2Y0PA 3OH8A 1T6NA 1ZA1A 4MA4A 4P3OA 5FTMA 3ABQB 1XUOA 4RHFA 3DOJA 4TKZA 3R7DA 2KWIA 4DMRA 1TAUA 3RK4A 4R83A 4XB1A 5B4UA 2FOLA 4MVJH 2IU0A 5JNUA 4ZO9A 5KPJA 4EGSA 5B5SA 3C3YA 2CKMA 2LXNA 4E22A 4NBKA 5DHFA 4Y6GB 3DDSA 1S4MA 1VTKA 1WF6A 1CLUA 3VKFA 4JJEA 1R6TA 2QX7A 4P7KA 1RKUA 2ZI3A 3O8QB 3ROXA 2VPWA 2B6HA 4KBGA 4LYDA 4MS3B 3UK1A 3BXZA 5KUTA 4B17A 5HOEA 1VMDA 3ZBUA 1WUYA 4B3SB 4PE5B 3CEJA 4MP6A 5K3SA 3TX6A 3DBRB 5LOVF 4QDTA 2CLFB 2WIGA 1YS9A 1OAOA 3ZWOA 1KNXA 3FLAA 4YACA 4MULA 1F2TA 5IASA 5E9WA 2JIOA 1YQEA 1LLCA 3T9EA 4DC1A 1RBMA 2ZE8A 4TN5A 2NZVG 1Y81A 5FRDA 2Y6VA 4P38A 3RSLA 3GAFA 4TYWA 2Q1TA 4D0NA 4ZVQA 2D00A 1UADA 1SU4A 1ZLXA 4O4JB 5KI6A 3WHLA 1E5XA 3UFXB 2H0QA 2YN2A 5IW8A 2REXB 3N59A 3OP4A 4FBLA 3T9FA 1LDNA 1V16B 4TYNA 2O59A 4IGAA 1WDLA 4ZAFA 2JANA 5J4YA 2A33A 3HZHA 3PE6A 1IEXA 4OGGA 3ZN2A 2PS9A 3E05A 3LV8A 2XDWA 1HEYA 3RIYA 1X1SA 4YV2A 5D84A 1Y7TA 3AKYA 3MSXA 2NX2A 2PGNA 2VBIA 4WRRA 1U2RA 3QWAA 4G5OA 2P4UA 1ND6A 1GVNB 3CJRA 2ZBUA 1BU8A 2G1KA 3IT2A 4ER7A 3BYZA 1G8AA 1N0WA 4JLSA 4DC9A 3GLIE 4X8LA 3OQIA 4U7WA 5B1IA 3TE6A 1KI9A 1KI1A 3T7JA 2FJUA 2J0EA 1ISIA 5I7EA 2OFOA 2ODQA 2X7JA 4OK3A 4W7IA 4XQ0A 1LWNA 1XAJA 3L93A 4ENRA 2I2WA 3JQPA 4K9QA 1GZ6A 3EIEA 4QFDA 3ZGOA 4IG9A 1KI7A 3K96A 3FWPA 4OUDB 2OLEA 3ASZA 1PYOA 3BQ9A 4MJLA 3NWEA 4Z4CA 2BFMA 2DH5A 4AUKA 2N1BA 2PFGA 3QLJA 2V5AA 3VPAA 5ISMA 5SY6A 3KVRA 3HXLA 1P2UA 2Z2YA 5AVRA 3ZY5A 3FHTA 2HHLA 2UVPB 2ZWVA 2XODA 3FYHA 5HDBB 3VR2D 1OFVA 3VR2A 2I7DA 4TMVA 1HK7A 1IPEA 3JS5A 4RO0A 4Y2UA 1P9OA 4V0RA 2ZZMA 1XCJA 1L3BA 1TT5B 2EHDA 5GY7A 2EJCA 4A8JC 1KKMA 2BZ0A 1SC1A 3CQ9A 3D6NB 4C0SA 3BGVA 1G4HA 3MQ4A 2PYDA 1W29A 2C2HA 2R4QA 1Z88A 4I6GA 1LF0A 4UVGA 2CK3A 3VYRB 1TLTA 3F5FA 1G3QA 2FEMA 3AF3A 4QUAA 1WZ2A 1R0XA 3F8WA 3KPJA 5DX8A 2XNDD 4QDJA 4GMKA 4QG7A 3ZQUA 2P2LA 4EG4A 1WD7A 4LMBA 2OCGA 2RB4A 4U02A 4QARA 3WYFA 3OA0A 5JMOA 5F1KA 2RBGA 2O3TA 1ZXXA 2Z83A 4FMPA 4GYJA 4N5MA 2J5RA 421PA 5TQJA 1EKXA 4MI6A 3A4TA 4QU8A 3BE5A 2UZ3A 1NZDA 1Q0QA 3VOBA 1TRHA 2YS7A 1AIPA 4L51A 1TA0A 3KPWA 4RORA 2JJ8A 1NLMA 3HGTA 5A3VA 3TZHA 4BQEA 3QEBZ 4GGOA 2OGWA 5A4KA 2ZJBA 1LV8A 4QFMA 2P0AA 4GF5A 3T3NA 1PN3A 2VZ9A 4BU1A 4ZEWA 5B2FA 4BE9A 2UAGA 2NUAA 3E2MA 4ZA2A 1RKVA 4E5VA 3HXMA 3IESA 2V55B 3PNMA 2XOEA 5ADWA 3ZJTA 3IPLA 4DFDA 1SQFA 5D3ZA 1RBQA 1NBWB 4FEAA 3AW9A 1QTNA 5IZCC 2J6CA 2XTMA 1PZXA 5KOHA 3ZLJA 2OK8A 2ZS9A 4MCAA 4RF4A 4GW3A 1FU8A 4PHTA 1A98A 1E79D 4BE7B 1C8VB 4P7FA 4L75A 5JASA 1T24A 1DUVG 5EESA 4DAOA 1QG2A 4XLZA 1JEYA 2MR6A 1J2TA 5J2TB 3K0BA 2MT9A 5DXJA 2GTHA 2FN7A 1K66A 2EFJA 4EI8A 2NGRA 1VLJA 2WWXA 2WFLB 5BYJA 1WEKA 1YJ5A 4X44A 3KEQA 1UXOA 3QUSA 3HS3A 3WGLA 1WBBA 4AX8A 1Z15A 4HYYA 3L9WA 4FZJA 2G7MC 1VMIA 1JB9A 2H8KA 2O6HA 4J9VA 4GOJA 4WCFB 3R7WB 1FQOA 4MTLA 1BTOA 1I2AA 3JAKA 3NHLA 1QBKC 4M7OA 2WMOB 4HNGA 1NLUA 2P79A 2F67A 3E7WA 3DZKA 1NF2A 4NMMA 2BSQA 4FT2A 3PRKE 1JFRA 4RMJA 1TUGA 3QU4A 2WE8A 1EFKA 4IW3B 1PF7E 4YRJA 4JOQA 1PL7A 3A37A 5TV2A 3P4XA 1YCDA 2B8NA 2HQBA 2HRBA 2QUHA 3BL6A 4OYHA 1IXZA 3Q6IA 1L8QA 3EEYA 1TEVA 1XU4A 2ZXEA 1QH9A 3OVMA 1VL2A 1E1QD 1JW9B 3QEJA 2HLPA 4G0ZA 4E3WA 1IIBA 3JD4A 1TIKA 3JD2A 2II6A 3LECA 1NLFA 5KX5A 4N5HX 3AETA 4UULA 2E48A 3GDOA 2BMDA 4CFSA 4M8KA 5HP4A 3B7PA 1RKBA 1W49A 3MS4A 4GEKA 4ETMA 2FKNA 4C7OB 1QFXA 5JXIA 1AKWA 2VH1A 3KZVA 1M6NA 4XWGA 2AJ8A 3DDUA 1QZXA 3AGQA 3HEBA 4YV1A 3KB6A 4KVGA 3UH0A 1Y4DE 3SIXA 1CRPA 3MIIA 3WOVA 4L5BA 3QPCA 3I9JA 3P9QA 2C4WA 1ZU5A 2HTFA 4HRAA 1L5ZA 1M1YA 4V0NA 1B1AA 2FWPA 3GEMA 4PPQA 4A7PA 4C6TB 1QDEA 5A5GA 3LK7A 1DU4A 1Q6YA 1V6AA 1K2WA 2DWOA 2VPPA 3NBQA 4QG3A 3C1TA 1YBHA 2OXEA 3FZQA 4AECA 3CVYA 2P6RA 2D2VA 4PPNA 3PT9A 2XB4A 4FYXA 3A7EA 1KOFA 2OV6A 3HB5X 4PICA 2YUIA 4KQWA 5JCJA 4BMCA 2HX1A 1VJGA 1C9KA 2IXGA 3QHPA 1F8UA 4P86A 5FO0A 4BVBA 4ECEA 3KD3A 3UHJA 1QXSA 3U7GA 3ZY6A 2Q9CA 3N2IA 5KTYA 1KETA 3U5TA 4CQLB 1N9GB 1U5AA 4LTDA 2I4RA 3OFNA 2FRVA 1XQ1A 2OQIA 3OZUA 1F4PA 3OPYA 4M1OA 5CEEA 1XNHA 3H1FA 2HT1A 4KPFC 4JLBA 4PIVA 3IQWA 3OOEA 1E5QA 1KSFX 3BSSA 3IUSA 3KQUA 4MYDA 4TQUS 3D8TA 4RFSB 3EEIA 3A6LA 1NYTA 1QIJA 1R4MA 4NG4A 1XRPA 1G5TA 4NQRA 3SYNA 5ELXA 1CRZA 1J90A 3TSCA 1YFJA 3FYUA 2B37A 4QOGA 4S1OA 1GZSA 5KU7A 1CUJA 4HEA6 4HT3B 2HF8A 1HMPA 2FZGA 5A2GA 3QEKA 1DAFA 1LQUA 2PU7A 4F1WA 5KZMB 3T7DA 5J9FA 1NQ5A 5EKXA 1XP5A 2QGZA 4XD2A 3EQ8A 3IAEA 4Z51A 3KZCA 5IBPA 3UMFA 5B7NA 1RWMA 3R3ZA 5H9WA 5KSOA 3DSRA 3JXEA 3J7TA 4RYDA 4ZQIA 5F9HA 3FE2A 3UF0A 2R00A 4L15A 1KI4A 1TM7E 3N7TA 1IBKB 5IFLA 5EIBC 4ER3A 4ZVNA 2I6TA 2HADA 3VPXA 2B8WA 1CS0A 4CV1A 1Z7EA 1RI1A 4Q4JA 1PK8A 4J29A 2VVTA 4FKMA 3B38A 1JWLA 4JI8B 2HCJB 3FYUC 4C0BA 3LLCA 3R9IA 3GJTA 4BP8A 3MF4A 1S3FA 1HNNA 1OH7A 3CM0A 1VLHA 4IHQA 4G25A 3RASA 1HQDA 3R2JA 4S1TA 1HT2E 4R51A 3RF7A 1P1IA 3UXMA 3BL5A 1VECA 4EUEA 4G5QA 5C7IO 2V65A 2IYLD 3O4HA 1KSHA 3VZQA 5MFPA 3R44A 2GD6A 1UJMA 1A9OA 1EESA 1FCJA 1M6HA 2ATVA 2ARKA 3GBSA 2GJ8A 1ZJ5A 3E70C 3E9CA 3QSGA 4FYHA 2AFIE 3KOMA 1FYFA 4QJBA 4YJKA 3GLFE 3GLGB 1UC8A 4DUPA 1ZL0A 2FV8A 1BQ3A 2FLWA 3PNOA 4GI5A 4IOLA 3A6FA 4FEGA 5FAKA 4RESA 5JVDB 3UV6A 3V00A 1SHJA 2P2NA 1DT3A 1XQYA 2ZJOA 3N39C 3PFGA 4BO2A 2IE8A 2SCUA 2O54A 3OIFA 3L0PA 4FYVA 1EZ1A 3LM8A 4FMDF 4HWOA 4YJ3F 3TNFA 2B5WA 5LQAA 3CLUD 1LPOA 4HNQA 5AKZA 3N2NA 2PT7A 5ITWA 3B7WA 3TW8B 3TTSA 2C2ZA 4J0CA 1G21B 4JFAA 4B4OA 5K4HA 1QHHB 1B6RA 3WVNA 3ZZ0A 4NFHA 5J2UF 1WHTA 2Q0QA 2IYFA 2VJKA 3AMVA 1G64A 1CR2A 4TV8A 2CBZA 1ST3A 2CCGA 1GQRA 4MV9A 1KK2A 2SKDA 1YDHA 1H9CA 2XZDA 3FAZA 1SUEA 1OGIA 2OQRA 1E99A 4RY2A 1Z45A 1XZNA 4AN1A 2QN1A 3IE2A 1SQ0A 2H2WA 4PSVA 2XMPA 4MUXA 3I8XA 1FLVA 3GLKA 1E5DA 2J33A 2YV4A 5TPWB 2B8EA 1PKXA 1QS0B 1Z33A 2WKWA 3K70C 1U63A 3ANYB 1EFCA 4PW0A 4FB5A 2O14A 4KI7A 3KKQA 1I3CA 1R0LA 2JI9A 1DKNA 1HRDA 3FKQA 4M89A 3T99A 1Y4ZA 1G19A 2LIVA 3EXHC 2WWRA 4BLUA 1SU7A 1YIDA 2PMWB 4RQAA 3IO3A 3PFCA 1Z4LA 4XLLA 4D9IA 1FBTA 4NICA 2YYSA 1GARA 5ADVA 2TS1A 4MW5A 4ESVA 1X77A 1ZWLA 2DKNA 3A2NA 1N1MA 4HDCA 5BWNA 2BZSA 3DDOA 4CIWA 4RTMA 4XX1A 3WWCA 4H18A 4RA6B 4Z4GA 4J91A 5DTIA 2WJAA 3X1ZA 1HX7A 2H7CA 1NVFA 2XJ9A 5JT1A 5KYYA 3CURA 1PEAA 1DG3A 3DLCA 3JASB 3V48A 5F98A 4LQLA 1B8OA 2PLAA 5BWMA 4O5AA 1RKXA 2EW8A 3HKEA 1GNLA 2CL5A 2IZ1A 5GGYA 3QWHA 4TLCA 3HVRA 1KZ9A 1PW5A 3Q1KA 1P7CA 2C57A 7MHTA 2XAUA 4CG1A 2AXQA 1P17A 1EFPA 1MN6A 1Y3BE 3EOBI 2XSZD 4NEHB 3CNOA 3ODGA 1JTFA 2X1MA 3C1AA 4MPJA 3REOA 2DWPA 1XVIA 2O2ZA 3H8JA 4IIEA 4FDLA 5EYPA 5I7OA 3WP1B 3RSZA 1IWBB 1YOVA 5TVKA 2YASA 4F3CA 4QVKA 1CU1A 3K1TA 2RHHA 2R6HA 4WMLA 3S2YA 1VA5A 3U7HB 1CY8A 4NZPA 4F7DA 3FSJX 4G0VA 5ALKA 1GGHA 2CLDX 3BA1A 4XWKA 2E4WA 2JASA 4RGYA 2WILA 1XXLA 2I78A 4LVCA 4AIRA 3KJFA 5LUBA 2IE0A 3H13A 2GJKA 3K4PA 1WA5A 2FHSA 3Q7EA 5EIAA 5EJMA 3EYAA 4K05A 5IX8A 4B8WA 1ZQ1A 3OCWA 2WZBA 5I6DA 2RE8A 5A4JA 1E1CB 1MA0A 5JCOC 2NV6A 1RAFA 3B1XA 1Q1BA 4B7CA 5J23A 2JLUA 3OQOA 4TMFA 8OHMA 3KU1A 1GITA 2WF8A 3JYLA 1DBRA 2CDBA 4RK4A 4UHEA 3T94A 1H3EA 3CSDA 1YAHA 3HCCA 3P4YA 3RO7A 1JYEA 4B76A 1ADYA 5D3KA 1NYLA 2OHJA 3PD1A 1TKRA 4F56A 3K16A 3U3XA 3WGJA 1EBFA 3SKVA 4JDUA 2ZRBA 5HBRA 2D0PB 4W99A 5DBGA 1PUXA 5T41A 3DLHA 3UPTA 1ISPA 1JGTA 2Q5FA 4AMBA 4C3UA 4FUQA 1G0NA 5FPQA 3QOWA 3VYSB 1RVV1 4G5YA 3H4MA 5JC1A 1GUYA 3GRZA 4AM8A 3CS3A 2J5KA 3FHCB 3K0FB 4PS0A 2RIRA 3V46A 5KYUB 1G20A 3IUNA 4P93A 4BATA 1V43A 5GVSA 1SC6A 2VP9A 4AMYA 2G5TA 1L5LA 1JQBA 5KKAA 5HQ3A 3IS3A 4WASA 2ZITA 1BX1A 1MABA 2ATEA 3LJKA 3ZCUA 5LLDA 1H93A 1YR3A 3P0RA 3WWDA 3AVWA 1Q14A 2WSMA 2VQFB 2H5IA 4QRIA 3AEZA 2JH9A 1VLLA 3QW2A 2D1FA 3HVKA 1DT5A 4M9UA 4MUJA 3IP7A 3U37A 2W2NA 2IHBA 3I5UA 3OCJA 3TCKA 1KFEB 1ORIA 3FNFA 1RQGA 3I0ZA 3LO5A 1B6SA 2YOHA 4CJXA 2ZBGA 1SK8A 1J21A 2DFPA 3RQIA 3SHWA 1CULC 2F17A 1JAHA 3O2SB 4KQXA 2QSYA 3BRCA 4BNXA 4HG2A 2HMVA 2VPIA 5L3VA 2CXXA 1UP7A 5FV7A 2EFCB 4NIMA 4MLZA 3ZKWB 2AW5A 2BKAA 4TMWA 1POXA 1L7RA 1S2GA 2QP4A 4KQ2A 4HD8A 5CLLA 1PJRA 3Q41A 4ENSA 5CG2A 3W4JA 3BMNA 3GFVA 4EFDA 1OBVA 4F71A 3HPQA 2FXIA 1M1ZA 2WM2A 3FB4A 2ODEA 3HI6A 4FFBB 1T5BA 1QIHA 3DCNA 4JY7A 4WT7A 2E6UX 1LVGA 3HB9A 3QWFA 1XDGA 1TVMA 1JPVA 2ECQA 3FRHA 2QL5A 2V7EA 3KZKA 4WNYA 4DA7A 2E3JA 4NAVA 4L28A 2C92A 1MT0A 2I7TA 4Q9HA 4WNAB 2DQSA 3OX2A 3EUFA 4KQHA 1E0AA 2P6MA 1ISGA 1RADA 2F59A 3EVCA 4S3MA 3K1AB 3QFSA 4OQQA 4BECA 121PA 1LPSA 1TAQA 2UUAB 1OW3B 4PSDA 5GV7A 1FUUA 3ZYCA 5IABA 4HRXA 1K6MA 3W5IA 4WXRA 3JALB 2X58A 3M2TA 2WSSD 4P7BA 5ARDA 2PY6A 2QEQA 2R87A 3WP0A 3F1KA 1QRTA 5DCYA 3Q5DA 2V7UA 4KACA 5KVSA 4D9NA 2CKDA 4TSFD 3RRFA 5AVVA 1TJ5A 3LLMA 1PJAA 1U3UA 2JLZA 1Q83A 5CYPA 1WPXA 1WXHA 4ENTA 3N9IA 4CCYA 3M6AA 2IU6A 4GOXA 1EFUA 2NVOA 4HS4A 2CNLA 4MDFA 2JATA 4JMPA 1ECGA 4ILEA 2HSZA 3H9UA 2OFXA 4JNCA 4OOFA 5DLEA 3ZTYA 5D1NA 3VI4B 4DBLE 3L46A 5FPKA 3IA7A 4LKRA 1TMOA 4R2WA 5B2ZA 5FUQA 1T5DX 2RGNA 5CU7A 2ZVPX 1H1TA 1ZYUA 1QH8B 2V1UA 5KTMA 4LYYA 1R4NA 2R7MA 4H7HA 4GP9A 1R0WA 2P1RA 3QVOA 2XXAA 3TX2A 1OGYA 3DDWA 4R2IA 1XN4A 5DGCA 5DK4A 4EOGA 1BFKA 3H2YA 3QXCA 5JSZA 1USVA 1MEJA 3OKCA 2GO7A 1NY6A 4MGEA 4XZ3A 3K09C 3T7EA 1ST2A 2BGIA 2R6AA 3AT1A 3TD6A 1MTOA 5CG1A 5EZ6B 3A1NA 5L7YA 2HHJA 3ICCA 5ALNA 4ZQEA 2FKAA 3JQFA 4F1JA 4L7VA 3LMKA 4D56A 3F6BX 4H17A 1GPBA 3EWIA 1SVIA 3K0FA 3L06A 1FP4A 5EP4A 3IIKA 1N5MA 3KQWA 3S5JA 3OKPA 1P2DA 1T13A 1SUAA 2Q6TA 2FN8A 4K3VA 3L0ZA 1XKTA 4TTVA 1YK0A 1MX1A 1ISMA 3HSSA 4LBYA 3O4RA 5HX7A 2ZWMA 1GFSA 2WSBA 5JNVA 1VG8A 2Q9AA 1A9XB 3R6WA 4HDMA 1NZFA 3I45A 4BASA 3ZDEA 4ZAGA 1G7RA 1M7HA 5K6RA 5LMZA 1G42A 1Q12A 1A2OA 4E5PA 3H0KA 4ABYA 1TE2A 3HKBB 4J0QA 3HCRA 4JUIA 4MA5A 3U4DA 3ABSB 4R0VA 4G0YA 1H5UA 2W2XA 3FYCA 1JVNA 3LP8A 1MQAA 5IJWA 3FVTA 4HF7A 4EI2A 2Y2VA 3LC7O 3ER9A 3OY7A 3R9XB 1PRYA 2ZRJA 4QTUB 1MXHA 1AY0A 1PD1A 4B40A 3K6RA 1R00A 4IX9A 5CB4A 5IJXA 2XT9A 4YRAA 4EMSA 4EA9A 5EERA 4WGFA 4HR7A 4I5FA 4J4HA 2HMUA 3KK0A 1OX4B 1NN1A 1SXHA 1UKAA 2MHCA 4UNPA 4DWWA 4BO0A 3LGXA 5BOVA 2ANBA 4GMHA 4BRWA 3PR2B 5H9VA 2EZ9A 5K0GA 1N33B 1EHIA 1RI5A 2R1ZA 1XTRA 2VNJA 2R7AA 3G8BA 3AL2A 1Z38A 4LCEA 5GQSA 3EGDA 1YOVB 3EA4A 4RIEA 3WK9A 3PUXA 2O2EA 4CIVA 4JWKA 5I9IA 1GADO 4OY3A 4XVCA 1ZR4A 2IZ5A 3ENQA 2C95A 2WU8A 3OTWA 3NNNA 1UAYA 4IQ8A 2BGGA 2O8FA 1PP4A 3IDZA 4YY3B 3PQ3A 2W6OA 1T1RA 1BC5A 1ODJA 4OQLA 4TXLA 3MGBA 5TS3A 5KC9A 4ZO8A 1SXJB 2C58A 2N46A 3GUHA 3I92A 3KVVA 4R16A 4ALKA 5BYKA 3RVDA 3QX3A 4QASA 2COUA 2GHQA 4NQZA 3S2IA 3SR3A 1GVHA 2J0UA 5H70A 1E7SA 1JVSA 1Y5RA 3EA0A 2XMSA 3BE6A 1P2BA 3C15C 1UBKS 3ECSA 3H1EA 4KTVE 4XIYA 4D3DA 2A5JA 5A9SB 4C06A 1YS1X 1V5IA 1LLUA 2YJ3A 1VOTA 1ZD5A 3KL2A 1PQ4A 3GPBA 3FVVA 4XVRA 3NTQA 2FG6C 3GH3A 2XA1A 2YIDA 1B2RA 2Z4RA 3EBPA 4ODIA 4UVEA 4XDYA 3NP9A 3TIIA 3VNAA 1E6WA 3T3EA 3ZXYA 2OVBA 4NYMR 1DE0A 5G02A 4DYDA 3T5PA 5J4HA 2WV9A 4YALA 2D1QA 5BRJA 1FMTA 4ZJZA 1XEAA 1IRXA 3IUEA 1GTL1 4AJ4A 4ZTZB 4I81A 4IILA 4GG1A 2HJRA 3I8SA 4PYLA 4M55A 3EQZA 3QMPA 4DSOA 1JQ3A 4V0KA 2QTTA 3FCXA 5UKDA 5K7SA 1QBGA 3L4BA 3EZ6A 1YCHA 5TPWA 4UNSA 4CV2A 2BYTA 4RH1A 4UVIA 1XDBA 3G2JA 1GZHB 1EUZA 2R66A 4M1QA 2C4KA 4YI5A 1C0LA 3T1VA 9LDBA 1T36B 1W4ZA 1FTNA 2ZJ8A 4ZQBA 2QU8A 2ZM6B 3MTJA 3G13A 4DJJA 1QAOA 5JATA 1FX1A 4I2NA 4QSHA 2PEYA 3G8AA 4PIPA 5FBWB 4XW2A 5HDQA 2I6UA 4TRRA 5E1DA 2PVPA 2AHOA 2ZOSA 4Q6BA 3O4FA 3F6YA 4AJHA 1RAGA 4FLFA 5DP1A 2QGFA 3E61A 3LUBA 3A4YA 4IEIA 2VCEA 3IELA 2YYZA 3R7BA 3PSAA 2VP6A 3F9RA 4COOA 3NC0C 1CUUA 3OBIA 4PR0A 2XNJA 1ZD9A 3RVKA 4ZZ1A 2Q4DA 3NRJA 1H2RS 4GQIA 1MHTA 4JI7B 1JQKA 3HCEA 4RPJA 2PZFA 4UREA 1UKEA 4EX7A 4N0QA 1ENZA 1E77A 3L7CA 2C7OA 2NG1A 4PYNA 5B1HA 1DKRA 1B3RA 1OLXB 1YC2A 4IEEA 2DUNA 4UARA 4R8SA 4Z4QA 3PGMA 1E7WA 2C20A 2H5EA 4BNDA 1WTCA 4UUBA 2PM8A 1X15A 3A4IA 3WJ1A 3GN1A 1CE8A 1VLZA 4HATA 2A59A 4A9AA 4EFLA 1JJBA 3MS7A 4DQXA 5I9TA 3C16C 4ZDIA 5HIIA 1G4AE 2QOEA 2V0NA 2AH5A 2QAJA 1RXSA 2ZBFA 3CEHA 3LDFA 1EVLA 2JCSA 3LSYA 3OCYA 4IIFA 4LC1A 2P35A 4DSUA 1Z4KA 2QRVB 2VDKB 3MAAC 4LS3A 4WY5A 3BEDA 4PYRA 4E07A 3G0IA 2NZ8A 3DXFA 1X7XB 3MXTA 3QBDA 5FLYA 3GPCA 4NBNA 3T0FA 1RZ3A 1I6KA 2EL9A 4DRXB 1UWKA 1KWGA 1Q22A 2NU7A 4RPCA 5A03A 3I0MA 3OTIA 3UUGA 2QW0X 4GPTA 3IDSA 3HVIA 2F1HA 3OSUA 4PBSA 3FYDA 2WWFA 4DNQA 1U2QA 1IQ0A 3BCSA 3LG2A 4NBSA 4XUCA 3UW3A 3DD1A 2JCYA 2VQSA 4V0ME 2VQ6A 2ECFA 2W7TA 4B3BA 1E60A 4OCZA 5A3SA 3NLLA 3UXEA 5JPCA 1TKBA 3FI9A 5AQ1A 2XCUA 1RHKA 4PLYA 5EVJA 1BRTA 1EFTA 1JFFB 3OT1A 5IH3A 1Z36A 3G0DA 3ZJYA 2XQVA 3ZZUA 1DIAA 3C14C 2V3VA 2O0JA 4LNUB 3OETA 5KSZA 1IEVA 4N3AA 4XDZA 3LBFA 1N2XA 2HQOA 3AUYA 2YHBA 4FN5A 3WNCA 3AL3A 5LQJA 4S35A 1PR5A 1V11B 1G41A 1RWWA 3MILA 4RAOA 4ZVOA 1ZPDA 4M0KA 4JQSA 2CF5A 1I4TD 4UEWA 1KZ1A 2CNBA 4OGWA 1VJ0A 4WN9A 1J7JA 6CHYA 5IYZA 4W9RA 2OHXA 2WC1A 1F5SA 1N9GA 4QLBA 3M6UA 4P4SA 3U7QB 1O0BA 2VJQA 2ZUBA 2XXAB 2YICA 2ZROA 1OIXA 1UODA 4J0IA 4M0EA 2Q99A 1R6UA 1KI2A 1U7ZA 4GSLA 4X91A 1CUFA 2RHCA 1C4OA 8GPBA 1SVMA 4OTZA 1MGOA 3AWIA 4LNHA 3L82B 1T3LA 1YH3A 4JBHA 2Q49A 1BDBA 2GVZC 4LYEA 1DAOA 1ICEA 3ROQA 2Q07A 1YR9A 4C6TA 1M1YB 4DMKA 1WCYA 4XSHA 2FE1A 2FEXA 2GUWA 3BBPA 3HUTA 3P5BA 4P5DA 5AKKA 3MQ2A 4JI5B 2WWVD 3WMFA 3K09A 1TYCA 2MSKA 3C6KA 4HNUA 3OZIA 1ZH0A 1H2AS 4DIKA 4HNVA 3KQNA 4QGSA 4DNOA 3MN1A 1OB2A 5LP6B 3PGJA 1JV2B 1GTMA 1X70A 3HXPA 3HJBA 4X63A 3T7RA 3P9CA 3VTAA 2VT6A 5JCJD 4L27A 3HB1A 1FMFA 4B6GA 2WA1A 2PMEA 2QHXA 2OTCA 3OQ1A 1RM4A 3EXHB 4AD8A 1P9LA 4EYGA 1RJGA 4LCJA 2JGEA 4YC7A 3RD5A 4GI2A 5A7HA 2AE1A 3AUSA 2XYVA 1NAHA 3HBFA 1A5SB 2MINB 3EA5A 4ZVMA 3SOPA 1P6XA 4Z1MA 3VPCA 5EQFA 1OU4A 2TECE 3A6GA 4AS1A 2E85A 4EUKA 1ZD2P 4GVPA 2FUNB 2EP5A 2X0DA 1N2IA 3UAXA 2VRWA 3KCNA 4RVFA 1G63A 4DXHA 2F1IA 1AQNA 4QHTA 2RGRA 4ZVLA 3HGMA 4F9GA 1NIPA 2E49A 3DUWA 4DV3B 3IODA 1GSAA 1N6NA 3ZBQA 2A94A 5AH0A 5H3LA 4D6YA 3G7UA 2HQ1A 4ZGWA 2R751 5LD2C 5HFAA 1K6EA 1QHIA 1T2UA 2RG1A 4MRAA 3ZDZB 4DT1B 1ID8A 1OVGA 5HKOA 4RPKA 2Z56A 4O1MA 1P3Y1 3HYTA 5KBYA 1GAEO 2DPYA 1JEYB 4YT8A 1J8FA 1HL3A 3LHIA 4OKSA 5LA6F 4CM8B 2FCRA 5DHPA 1M0EA 2DY1A 1I3MA 2QJFA 1VFPA 1EBBA 4DKJA 2C5EA 4AW9A 1V45E 1TIBA 3V8NA 3QJGA 1TYAE 1N7IA 1UMKA 4C0XA 1HLPA 2DT5A 2HR1A 1EZ4A 1SKQA 3PXUA 1U5CA 4HGQA 4D98A 1Q6ZA 5KYUA 4PAQA 5K20A 3D9QX 3EAGA 3KHUA 3UO8B 5LFAA 4CKEA 2IKSA 4MB0A 1JG1A 3HFSA 2P8JA 1XK6A 4Q39A 3PXEA 3G2HA 4KOAA 1IXYA 3VC1A 3M6LA 1IUOA 2DSNA 1EP3B 1KBQA 1Z47A 3G5UA 4AZ3A 2FDXA 3NC1C 1H85A 4XTCS 4DCUA 4YASA 5EMJA 1E66A 2BWJA 2R5FA 1TL7C 2XMQA 2YHAA 2B4AA 4I9UA 1ISHA 3FWHA 4TOIA 1QX3A 4PZUA 1VRCA 7REQB 4RU1A 1U2GC 4R2JA 2D8MA 4YDRA 4C89A 4BDSA 3WWYA 1UMDB 1YHZA 1GCAA 1ZM3A 2VQDA 2AOVA 2LRHA 4HDRA 4KC0A 4PZEA 5ECWA 3OJCA 1K9VF 1DIOB 3DTVB 4QA9A 1Y5MA 5LYJF 4WCDA 1GQSA 3EXEA 3ANTA 1PZMA 5L7TA 2I6XA 3MWGA 4DQLA 2AG1A 1R10A 1YDEA 8ATCA 1E0DA 4HFRA 3AR8A 4QDZA 1MQSA 5AXBA 3S1AB 1NKSA 5F5LA 4AO7A 1TK3A 4C5CA 1MZVA 4B3HA 2PSHA 3FNHA 1T5OA 3Q40A 3B2NA 4GLBA 4JT8A 1QHSA 1QVRA 1Z4QA 4DSAA 2IIBA 2FMUA 1SU6A 5B1EA 2WYOA 2V6FA 4WKNA 2JB9A 5ALFA 3VI3B 3W04A 2YCLA 2OR3A 3SVZA 1QB8A 5HM8A 1SCJA 5J43A 3SWWA 4H4DA 4UVHA 1KFKB 1MNAA 1R88A 4R2LA 1D2RA 4CW7A 4KDEA 4TTAA 3JTMA 2Q2WA 3NFYA 2IEAA 2KMLA 3CVOA 5CM2Z 3RU7A 2IYQA 3IIIA 4B4KA 4KB5A 4ETNA 4HFMA 3M4NA 1XA3A 4QPCA 4B80A 1S2IA 2P3SA 4FGKA 2QQ0A 3FPKA 2R62A 4G81A 1OI3A 4JGBA 4JD5A 1LI4A 5ALRA 3G0HA 2CHGA 5FTWA 4AJPA 2IOYA 5KSYA 4G0OA 4Q3BA 4X7RA 3KLBA 1C7EA 3VKWA 4N3GA 4Z99A 5CW1A 1O5IA 1UJ4A 4O3FA 4MRPA 4RA6A 4AS3A 4YMHA 4TMYA 3T4XA 3E5MA 4EHFA 3G7SA 1WNFA 5AHXA 4ZWNA 4G1FA 1JSXA 3BJIC 3KR2A 3SYKA 3L4JA 1RXVA 2AFHA 4WXYB 3WL8A 4GX5A 2HQSA 3BXXA 1KQNA 4BOYA 1P4HA 2P5SA 3HKCA 1HTWA 1R5JA 5IU6A 2IYVA 3A36A 1JKXA 3AU8A 3KKMA 3LRPA 4F38A 5LKAA 3FDZB 2BF4A 1SC9A 1YBMA 2CLSA 4G67A 2VDPB 3TPCA 5HKAA 4OO3A 3U4HA 3JQGB 4JBXA 3ETNA 4P80A 1QO7A 4OSOA 2FTKE 4X1YA 3TVDA 4ABTA 1XZGA 1U0TA 3FFAA 3K9LA 1FF9A 2A2ZA 3ZU5A 2VS1A 4COKA 4DV5B 3Q9NA 3FVRA 2WNSA 3EXIA 4MDEA 4MS1A 2ZBQA 3REQB 3OLVA 4BQIA 4NH4A 3RVLA 3T7IA 4F3RA 1WU8A 2L42A 3N8DA 3WWZA 3L1UA 1UBFA 4RYLA 5HOQA 1P1KA 3ONFA 3SQDA 2AWNA 4CDRA 4ZVKA 3T0IA 1FTYA 4EVQA 2V7QA 4CKEB 3OZSA 5ALEA 3F0TA 1OC2A 1VPLA 4M0FA 3O74A 3B6ZA 1PQWA 2FSPA 2WKQA 2ZT8A 4LDRA 5FUBA 3GZNA 1W4CA 3T7AA 2WAOA 1JI3A 1HMYA 2CBXA 2J45A 1X3LA 2PWZA 4UZEA 3VR3D 2AF3C 4KQ1A 4MCHA 1W52X 3PJFA 4N47A 4H7DA 4CMGA 1UXHA 1QC5B 3DC7A 2DWQA 2BUAA 4NWIA 5BMVA 6AT1A 1HO3A 1T8UA 1P5FA 3CONA 4WK4B 5FOTA 4PLGA 2OXCA 4EL5A 4HZIA 1SHZA 4KIWA 5FNVA 5IXSA 3OQMA 1MORA 3LUJA 1EFAA 5J63A 2IZ6A 5CDSA 4I8XA 4E30A 2VTBB 5HKBA 3NHJA 4WOKA 5DCUA 1ABBA 1U9CA 3MK31 1RWXA 3B8EA 5LQRA 3UZUA 2J46A 1KZ6A 3P0HA 3PHBE 3RC3A 1DO2A 4PG7A 1WMAA 4QNMA 4Y6SA 2DKFA 5EIOA 3RABA 4FDMA 1A5TA 2G08A 5T67A 4U2KA 5JQGA 3PQ8A 1NVWQ 3BDVA 3EDRA 3O94A 2QQ5A 4O1IA 5FTJA 1HL7A 1VJTA 2GSDA 4CM3A 5A0TA 3C5HA 1BXZA 1DPFA 3GJ8A 4C4TA 5BW6B 3DBHA 3SSOA 3AI3A 4R1QA 5I7SA 3B1VA 3G2IA 3QG5A 1UQUA 1QANA 2HMYB 4DZRA 5JR3A 4DMHA 3UPUA 1LFDB 4M88A 3X43A 1QR2A 2X2FA 3C7KA 1ZI9A 1NN0A 3QF4B 3U80A 3NWOA 4IDAA 3V8PA 4B3JA 4MI9A 2X9VA 1T91A 3CA8A 4DR1B 4WW0A 2GPSA 4GKAA 3I9NA 1OXBB 1AM4D 3PRHA 2OCIA 2NLOA 1ODKA 4R8LA 5E4TA 2ZJFA 3NBZC 5ALVA 1PBNA 2V4MA 4G97A 5BUQA 1ZQ9A 2VT2A 3KCQA 4PNHA 4PTLA 4ZFNA 5JJKA 3HLKA 1H2BA 2R5WA 1QO9A 1NKVA 2E87A 1WZNA 3AC0A 1KO5A 2LE0A 1LSOA 2BFEA 2CLHB 4PG5A 3HJFA 1WOMA 2KB0A 4Y2YA 1DFHA 5EA2A 1JXAA 4HPJB 5IT9A 1LX7A 3A6HA 1R6VA 4B09A 4DMGA 1DRJA 4KLAA 1J0EA 4OXYA 5CXUA 2QQFA 3NTUA 2QT1A 1AO0A 4ZT3A 3C3CA 2NO4A 1TF7A 1DUSA 1EX1A 1ZA2A 1NG9A 2F3UA 3QNUA 1VG9B 1KXJA 1JG4A 1QIMA 4FGWA 4FW8A 4JB0A 3DE2X 2QE6A 4LIPD 2HBRA 3HDYA 3E23A 2UZIR 4J16A 4V38A 3COVA 1EVKA 5FBKA 1WXFA 2W48A 2YMQA 1D6SA 2CL6X 3KUDA 3R3SA 3NFRA 3A1SA 3M81A 4G1BA 4HH4A 3TO5A 4BWYA 1SUPA 1RWBA 3H18A 3OX1A 1ESDA 3RS7A 3TIXB 2VOJA 3IDQA 4WK0B 2VJYA 2WTAA 2FWJA 2VHEA 2WIBA 3WGNA 1U2TA 4KR2A 3LNCA 4BB9A 1JBKA 1CJUC 2FFRA 3GRFA 4D9BA 4I3FA 3VHQA 1G0OA 5CDYA 4GP6A 3THXA 3C5WP 4G56A 4GBMA 3ZU2A 2PR2A 4RH3A 3DZDA 1GPJA 1Z7YA 2IT1A 3PUVA 3K6JA 4H59A 2OM6A 3GLSA 3ILYA 5TPZD 2KSQA 3CNQS 4Q3LA 1VXOA 4O8CA 2EJWA 4BFTA 4GOOD 3NORA 4TYMA 4DCTA 2HPAA 4V1CI 3BUSA 4RL6A 1QGED 2DM6A 1G17A 3A7DA 1Z63A 1E9EA 3Q87B 2BEVB 3N1UA 3MTAA 4C07A 2IHVA 2ZUSA 3DT8A 4HAZA 1K7FB 5JG7A 1E2JA 1NBOA 1NMXA 1W5FA 2VYVA 3H3JA 3LYLA 1I4DD 4NK4A 4Q37A 1XO1A 2H00A 1X86B 2XWBF 4LHWA 3V4LA 3FFXA 2C5SA 4IP0A 3FDXA 1S8FA 2AD1A 3SYLA 1C7FA 2GXSA 4JLVA 1QTRA 4H7JA 2XWQA 2FETA 2NU7B 4FX2A 2ZVJA 4Z9BA 4I1UA 3PVCA 4BL5A 3OTGA 2AMLA 4KJXA 3EEFA 2EW1A 3H9JA 2XMGA 4FOOA 2H17A 4WAUA 2AMYA 2BT4A 4TTJA 3KUUA 4WFQA 4QOJA 4YBZA 2W2PA 4OBWA 4YCJA 3NOVA 4JJZA 4X71A 3GA5A 3M3PA 1IN4A 4Y3UA 3EJ6A 4BNJA 4AQYB 1MCZA 5KVVA 3JYHA 1NNSA 1NW8A 2RH4A 3AEYA 1Q77A 3I0NA 3PUZA 4R1TA 2YVAA 4R81A 4R41A 4UCFA 3W0LB 4EPWA 2P9EA 3ZQ4A 5LZ7A 1SUIA 4CQNA 4B32A 3ZDRA 4CODB 1G2IA 4D4KA 1DADA 4F2PA 1IN1A 3WLJA 4ML3A 1AZSC 1CZKA 3IEPA 1A8IA 2C4VA 3TBHA 1M8FA 5DLDA 5LVAA 4QECA 4G65A 1U94A 3RYHB 5E0OA 5FWXA 3WHKA 1VKZA 2DFKB 4JP2A 3L7BA 3OFVA 4GPZA 3WA6A 5F77A 3D3QA 3ECAA 5LB4A 1Q0TA 3X1MA 4JQZA 5LXTB 5F76A 2PKRA 4IUDS 4QJIA 3B6MA 2OHGA 4N48A 1A8SA 1J2EA 2YC2C 5KOHB 1T5SA 1ZK0A 3TTYA 4Y1RA 5JJ5A 1I7QB 4RD2A 4D57A 3FIUA 2PKWA 4TN1A 1EXVA 3K9BA 3RQSA 1E7RA 2Y1WA 1OYWA 3FSGD 5EJ5A 3ZVMA 3LH5A 4AG3A 3EASA 1JQDA 1O96A 3BG5A 3OM0A 4YAWA 4CZ2A 2DR2A 1B14A 1ZI8A 2JFNA 2JVJA 1CVIA 5D6NA 4RXMA 2MYNA 2X8LA 2W2KB 1KH2A 1M34B 1NVUQ 3BWXA 3RR2A 2FZEA 5BVHA 5C8YF 1B4DA 3QKUA 4JDPA 3H9EO 3PKJA 1AUXA 2ETXA 3TTTA 2A35A 4YWJA 3X3HA 1SY7A 4IQGA 3DXXA 3UJ3X 1U0FA 5JSQA 4EPTA 3E9NA 4F21A 1GPNA 1OA0A 2VDLB 1EWVA 2B1JA 4D6XA 3RPEA 1NQOA 3G2NA 4UNIA 3R3HA 1HE5A 1T0HB 4M6WB 3RADC 4FOLA 4EHAA 1N6RA 2PQ2A 1U7OA 1KO1A 4DRZA 3IAXA 3JRWA 3MEQA 1W4RA 2JHGA 1NMSA 2ZIUB 4BNFA 2C7BA 4G8JA 5JYDA 3K1YA 5FBLB 1LXCA 3AB3A 3BCHA 4UFPA 1P72A 1R6AA 1D7AA 1JXQA 2I7XA 2DGDA 5M5BA 5F9MA 4YP6A 2XGJA 2G9VA 2R47A 3PTLA 4YRCA 1VZ3A 4M1TA 4MUAA 1C1HA 1JEEA 3CJQA 3OZBA 4GVXA 4KXLA 4OHBA 3R7SA 2B8JA 2IXFA 3KHKA 2VUUA 4NYJR 1JQ5A 2UVPA 3KWLA 3TXAA 3C7AA 3TOSA 1W6RA 2P2YA 3ET5A 2EQBA 1GL6A 3KQPA 3NJRA 3SP1A 3WQSB 2I87A 2BDUA 5EJ4A 4U6QA 5LOVA 2QD3A 1ZMTA 5HZGA 3P9RA 3GELA 4C0QC 3GLFA 4C5BA 5ED4A 3X1DA 4MXDA 4D9GA 4CGZA 1G66A 2ZBEA 1AA9A 2O8FB 4IUCS 1HM5A 1FFGA 1Y3AA 4EUSA 3AR4A 2PCLA 2VWPA 2DHDA 3G8CA 4UU0A 5L3QB 4MQEA 1XPUA 1TTTA 5ER9A 1XZJA 2QTZA 3COWA 3SICE 3BT7A 1IIRA 1T9DA 2QE7A 3D4LA 1KS9A 3OLZA 1BN6A 3IVAA 3DQQA 1YR1A 3C41J 3RVBA 1DVRA 3QH4A 4QKQA 1U2EA 2WWWA 1Q50A 3B51X 1LPAB 3C3PA 1GUZA 3HB7A 2JF0A 2YNMA 3KBBA 2IUUA 3WLEA 4MPPA 2ZBRA 1JUDA 1Y63A 5HWSA 3F6PA 5HUJA 4Q3AA 2YMPA 1LGYA 2WTXA 1R3DA 3CT6A 3LKBA 4ZT5A 2W93A 3B36A 5LBTA 4IVPA 2PZKA 2AC7A 2XWJI 3HDGA 3DFFA 1UWLA 1O95D 4M9ZA 1M1NB 1GTG1 2R68A 1A72A 2VATA 3G6KA 4LYJA 4XJTA 3UFXA 1AV6A 2XECA 1A4UA 3EAQA 5AOVA 2VRBA 1KJJA 4QOHA 5LYJB 2QLMA 4XWWA 4I1IA 4OL0A 3UCXA 4DYHA 2FW8A 2XUFA 5AQEA 2X7HA 4O2AB 1KRHA 2ZI9A 3WLNA 3UQYS 4EYQA 1E58A 1R6BX 1DAEA 2R11A 4I1RA 1ZRNA 1IAQA 3RIXA 1N5KA 4FDVA 1BE8A 2XUIA 1IUKA 4DGQA 1N77A 3IOEA 3HVJA 4RK5A 4DB4A 1AE1A 2G07A 1RKQA 4EGQA 3O4GA 1QYRA 2GPTA 1U65A 1JXMA 3TJRA 4LZJA 5HW0A 5KB3A 4YAOA 3GHYA 3F5QA 1D6JA 4YAEA 4C6SA 3EVEA 1E3LA 1RHUA 2XRYA 3NXKA 4AY2A 3AIMA 3LHSA 4GX2A 1QORA 3FJOA 2WOJA 3OIVA 3QXSA 1YJQA 4YPFA 4HNAA 4CMBA 5C2JB 5EN4A 5LD2B 5AJHA 2LVBA 1DC4A 5E1OA 4EAQA 2ZSIA 1ZMRA 3IT0A 1P1JA 1EWTA 4HFNA 2AUNA 5T4HA 4FOSA 4IDDA 4DEXA 3LQRA 3ANXA 4E03A 5JEDA 1DQYA 2O8CA 1L7XA 2QZZA 3FGOA 4LBVA 4YCSA 5LNK1 4OGFA 3FUCA 2Q21A 1HEIA 4U7DA 1O54A 2GZMA 2XOXA 1F2UA 1QG4A 1U8TA 2HRZA 1RVDA 2NOAA 4RIGA 5HF9A 5K3CA 3ZPXA 3IBSA 4PC3A 5DHAA 3MT0A 1J0CA 2OGUA 5B53A 2VFAA 1QH8A 3BAFA 2X9QA 2Z2ZA 1AKQA 3GVCA 3D8BA 3W7AA 5HJEA 4OP2A 3PB3A 1CB0A 1T4CA 3TIFA 4F5ZA 5EKDA 1K0FA 2XOKA 5LQCA 3ZJ4A 2G71A 1I5RA 3B1FA 1OH5A 3ESCA 3PWKA 3H8SA 3N2KB 2G4LA 3M3HA 3RT1A 5FJIA 3FTDA 3EIQA 3R3XA 5I9BA 4MPRA 3GUYA 2C1EA 1JJVA 4QODA 3HCFA 3JV7A 1EXNA 5U4XA 3DV0B 3DYBA 3R3VA 2I4MA 3KKEA 4OJMX 4N3CA 3F7MA 2B7CA 3H0EA 3HDTA 4FYIA 3KPYA 1O95C 2QRQA 4LZAA 3MCTA 1HNZB 3O7MA 4P7JA 1ZDMA 3BGDA 3CLSD 4JKIA 4LYGA 4NX2A 3RUEA 4KXMA 4CETA 2EQ5A 2HBQA 4ILKA 4K88A 1CVRA 1J8MF 2WDPA 4LUCA 2PS0A 4R6WA 2I4OA 4WSOA 3RK1A 2BBWA 4HAWA 5HPYB 4GWKA 1UPTA 1RHJA 2Z3ZA 4CM9A 1AMUA 3P45A 2VDQB 1JDVA 3O6VA 3N2LA 1DBQA 2C97A 3NHAA 4S1VA 1M54A 2O8NA 4WXPA 3DF7A 4BEVA 2GN4A 1KJZA 4C0AC 4FC6A 3D43A 4EECA 5AKJA 3AUJB 3UWPA 4FHDA 4OMUA 2XY4A 3QKTA 4W6QA 1G8HA 3L18A 4B2LA 3SS9X 4ND7A 4P9NA 2ZB8A 4ACBA 1G5FA 1T8YA 2XNKA 5DKFA 5EUQB 4PX5A 3NH9A 3I58A 3EG9A 1VYTA 2ZRLA 3AO0B 1XAHA 3MWEA 4CM6A 2XVZA 5HNKA 4MRMA 2BBOA 3AV3A 2JLBA 3AF2A 1AXRA 2PA3A 5HS6A 3EWSA 4HWRA 4RFVA 3OJWA 3AOEC 3D6AA 1Z7BA 4ENVA 1V47A 2XQFA 2PH1A 3G49A 3OEYA 4GL4A 1RP7A 2B6NA 5E6UB 3UY4A 3THYB 4JU9A 1BYUA 1YD7A 1F0NA 2PANA 3OPVA 3QVKA 4L8VA 4FKBA 4II2A 2VSQA 2YWJA 4LXXA 4EKNB 3SNHA 3BCUA 5JFOA 4I4CA 4HLCA 1OC4A 3C3EA 3VC7A 1AG9A 2H1WA 4M22A 4OXIA 4B35A 4F3TA 1IMOA 3VHXB 4BZZA 3JYPA 4FMCB 1XCOA 2YW9A 3DOIA 1ZS9A 5FIUA 3KR1A 4AQ7A 3U17A 5EZ5A 4ESHA 1TDJA 5KTTA 2HJWA 4LNAA 1L7VC 1NQWA 2CVHA 1OYVA 1FYWA 2PRIA 3QQPA 4KGZA 1NF8A 3OX3A 2IELA 3BOSA 4B3MB 5EXPA 4DV0B 3ONEA 3KTAA 4WDRA 4NV0A 4FGUA 2ZJ0A 3BERA 3NT4A 1DJQA 4YCBA 1QFMA 3HJAA 4P81A 3ZD7A 4B3XA 1E6MA 1J2YA 5F5XA 4H7PA 3RG2A 2QLFA 3QQ5A 3STVA 3DUFB 5T4FA 4CLOA 1KYTA 1MR3F 4GX1A 2FFAA 1KMQA 3AKDA 2G7ZA 1T3SA 4W5JA 1OTXA 2EIHA 2G0NA 3ZYZA 3GRYA 1H6DA 1TM2A 3N2EA 1YUMA 5BY2A 2ZDQA 1E3WA 2BN4A 1RQLA 3ORRA 2HB6A 5LQUA 5DI9A 3JQ7B 4F2HA 1U0EA 2C0CA 4QGHA 3E7XA 1A4IA 1QHXA 1UBNA 4NOKA 1YL5A 4RTJA 2R60A 3AZQA 2NXJA 5JD4A 3CKYA 4Q4DA 4C08A 2O8DA 2RGWA 1I3NA 5MN4A 4EJSA 1KO4A 2GM9A 2HY7A 3AONB 4FFWA 3PF9A 3TCNA 2I3BA 4JLOA 5GZ6A 5IMBA 4C01A 1PQPA 4PQFA 1K92A 5AW2A 1N75A 1YZTA 3A27A 3EF1A 4RCZA 1MJNA 1GUFA 4XCVA 3CCFA 5DTJA 1II8A 1CF2O 4FTWA 4JYBA 3L8HA 1HRKA 4PQYA 1Y3CE 4EF4A 4ACAA 3PX2A 1M74A 1CUEA 2XB6A 3FLBA 3TOZA 3GXOA 3H11A 3AM4A 4QVIA 1G21E 4YN3A 2NU8B 1EVQA 1C7ZA 4N0MA 4FR2A 2F1KA 4MWDA 4Z4HA 5LXTA 1ORHA 1V1JA 4URFA 3ZHSA 5F7OA 2YJTD 1AS0A 1KIAA 5ENZA 1BEUB 4GAEA 1MP0A 1XAIA 1Z7WA 2P7IA 2E5LB 1XZIA 4NZNA 2P9TA 4URHA 1FSFA 3BDAA 1GUBA 2A9RA 2EOAA 3BSWA 3QPBA 4BQRA 4O3MA 1PU2A 3RS0A 2A57A 2WYVA 4U2FA 4OP3A 5AKYA 4R3WA 3I9MA 3UC5A 3K05A 2P3LA 3UWSA 2PGOA 2FX3A 3PDWA 3QKIA 4HWKA 3LX5A 5HTOA 4DJEC 4XM2A 1GHTA 1CUAA 1KMHA 1CJKC 2ROQA 3OIDA 6LDHA 4JBIA 4TT3A 5E6SA 3WGIA 3IP3A 4GD3Q 3EZ2A 3DCJA 1B16A 3EWNA 1QO0D 5BRAA 5B3AA 4BFSA 3AVXA 4IGKA 4LJ4A 2EZ4A 2WHQA 2I1QA 4N5IX 4LZPA 1KORA 1L4UA 4J6EA 3DE4X 3O2JA 1E6LA 4S2EA 1U5BB 2PGLA 2CVFA 3KR0A 3LBIA 2X15A 4L5JA 2MYPA 1DV1A 1B76A 1XHEA 3L7NA 4E0BA 4ER6A 3NONA 5CT5A 5MFZA 3COZA 2K7FA 1LDEA 1QS0A 3E8MA 2QM3A 1BX3A 2GI4A 2WMDA 4KAJA 4M83A 1MB9A 1NKTA 3PGA1 3GG9A 3LUCA 1SIUA 4L3VA 3RS4A 3NOQA 1YA6A 3LTEA 1PX0A 2JGAA 3V1KA 4DLBA 2NO1A 2ZJAA 3UMCA 4C1NA 2HA2A 1CZUA 1XEFA 3EGXA 3CMCO 4GXRA 1ECFA 2X5KO 1OJ7A 3G0GA 4B47A 3HRHA 4EELA 1JR3E 1RSZA 1HDYA 2FG5A 3IUYA 2PYZA 1JMYA 5AVTA 1AKTA 1U8AA 3ULKA 3I83A 2QP9X 1X3SA 2IBTA 4EHIA 2YWCA 1JSLA 1V7ZA 4G6ZA 2RH5A 4MB6A 3CR7A 4W63A 2J0VA 3JQBC 2HIHA 6YASA 4ZK6A 1YASA 2YNMD 5JAQA 5SY9A 2DX7A 2VTDA 4XSVA 2QRHA 3DNPA 3JWIA 4UUQA 4GPIB 4BS9A 5AUNB 1XR3A 3RYCB 2O8EB 4ZJYA 3O8DA 4G5GA 1EU1A 3BIJA 4AWAA 1BA2A 1WB6A 2FEOA 5DPMA 2C77A 1WQ4A 1V9LA 5EZYA 1ZBQA 1VFNA 5KPDA 5JVDA 4HH0A 3HL4A 4UEKA 4QXRA 4GEGA 2AG6A 3N2GB 3VAYA 3AOGA 4NULA 5F9FA 2W6CX 3R3UA 4N7BA 3K8YA 2HIMA 4N3BA 2Y93A 4ZIRB 5L3SB 3STUA 5EJAA 4LX8A 4K8RB 3PICA 4IBOA 2PMCA 5JUWA 2I6GA 2OB2A 5F2KA 2EZTA 2J59A 1BQEA 1WV0A 4GOKA 4MR7B 2A5FA 2WTUA 2BZGA 4QYIB 3D4IA 1O2DA 4BJ5A 2C3OA 2B2CA 2JFQA 3IFSA 4MUYA 4N6OA 4JR2A 4C9BA 3RAPR 2QVXX 2ZZNA 1GSOA 3GYBA 3I2FA 3GP8A 2B7LA 2I8AA 2QI9C 2F64A 2I34A 1R5OA 4JBYA 4B2IA 1N9KA 2WRZA 5AVXA 2BUBA 3DO5A 2ZJ1A 1V7PC 4OAPA 1DJMA 1H3NA 3AY0A 1N6OA 3D4NA 1ZNYA 4MB2A 3UBMA 3W8NA 2X9LA 2XB9A 3TI7A 3T1HB 4GFDA 1TQ4A 1V9SA 3TSOA 3I1YA 5IVHA 2H54A 3SZLA 3KEFA 1DLJA 3V4SA 5LC1A 4Y6PA 3WKDA 1KBOA 3OAAA 1QPGA 1QUEA 2PWBA 4KQMA 5KNBD 3J81k 1Y9EA 3KEGA 1DGQA 2PDAA 4YGYA 4WBNB 4BJHB 3NIFB 5CXQA 2QTBA 2SBTA 2IX3A 3AL0C 2NQ8A 3C5VA 1NHGA 4HEHA 4N6NA 4EJMA 5JYEA 2XCRB 2OOSA 3ZXIA 1E4VA 4UEOA 1C8BA 1PNRA 4GX0A 1CZOA 2BH2A 5GONF 1V8DA 3V1LA 2O4CA 3SN6A 4GM0A 1GG9A 1NV9A 2DBQA 2RHBA 1OI7A 3RSQA 1D03A 3ED1A 4FNAA 4HAIA 3KJGA 1BCRB 2O0HA 4RVNA 2Z57A 4LDNA 1S2NA 2Z5GA 4ZICA 2M6LA 3TSWA 1TVCA 2G1AA 3OPYB 2ZIGA 3N3AC 1QCZA 3L07A 2JI8A 2B83A 3OTQA 4PVCA 5FLEX 5E38A 5TEVA 1FE8A 2YJZA 1HLFA 1X92A 4O1HA 1GZ5A 1H1LB 3QELA 3IVGA 3D3KA 2GZ2A 4JITA 5I01A 2V5VA 2R6ZA 4BLPA 3NI2A 3AXSA 4BWVA 2YJGA 1KKLA 3SMQA 3ETHA 2O8EA 1HT1E 1V4VA 1GPWB 3FLMA 5KYKA 4PO9A 2FPXA 1YC5A 3MERA 4LC0A 4U6SA 5FWYA 4B84A 1U6IA 1YZLA 2Y2UA 4LYHA 4BQQA 2R4TA 3HR4A 4ERNA 1FSSA 1GRCA 4QYMA 4KMMA 1BMTA 3U3MA 4IH1A 1KSJA 3JQ9A 1NXPA 5SZHB 1AT1A 4I99A 5HK9A 2VAWA 2COKA 4IGEA 2B99A 3BB3A 4BQFA 5LKRA 5IN4A 3E4DA 2VPQA 4XFKA 5CXXA 3V4RA 5AW9A 1Z0AA 2Q50A 1KDPA 4MS1B 3REQA 3ZQ6A 4WBSA 2GF9A 5DN6D 1Z5GA 1MXFA 3B52X 1XLUA 4L3WA 1A4XA 2X6TA 3V8QA 4NENB 3DDHA 1XMPA 3ESZA 1XRMA 5JWHA 2YTZA 3RJMA 3R5KA 2XA2A 1QPBA 1W87A 2C3YA 3ZHOA 1HOTA 3D6FA 1N5RA 2ZLBA 2QX6A 4R9SA 4DLAA 3FPBA 2IV7A 5ILGA 3BWEA 2X23A 4QOEA 5LYYA 1P2GA 1PEYA 1ZOIA 2YQZA 5L3ZA 4IRMA 3AWDA 3RFFA 2VNAA 1TMKA 2H1OA 2RKOA 2FPSA 3A3PA 3NNSA 3AR2A 4WX2B 1PIWA 2AIRA 3W2GA 2H4HA 1EK5A 3BVPA 3DKVA 1WKBA 5J1TB 3JY6A 1ZSYA 3L0BA 3N2ZB 2WI8A 4IHJF 5AKHA 2HU8A 4TXNA 2NW6A 2VAMA 1I51A 1XTUA 2BE7A 3A9UA 2P67A 1QVWA 3MYRA 1F38A 4FYPA 1WTAA 2VRCA 3VHRA 4UXHA 1NVGA 3F8TA 4BN5A 3S27A 1C41A 1JLLA 4RVDA 3G9XA 3MB5A 5ECYA 4CEHA 3IUMA 4XOIA 5J58A 3AHGA 2H65A 4J4BA 2RC5A 2R0QC 3RAFC 2M9MA 2I33A 3GP5A 2A7XA 2FWRA 3QX9A 3V7YA 4DSNA 2H7YA 1D07A 1E2MA 1SB8A 2YV1A 5JJIA 2H59A 3ZE2B 1SVLA 2VRCD 3IKVA 3T1NA 4RLSA 5DNCA 2BFCA 3RODA 3VDMA 5JBNA 2QYHA 1SPXA 2HHAA 1XRLA 1F8FA 5K01A 2A1TS 2VYQA 1Z4PX 4MA0A 3EPLA 4D4IA 3H87A 1NQUA 1SXJC 4ZZIA 4MQFA 1Y8CA 2P9ZA 2LKDA 4X94A 1EDDA 3LHKA 5CURA 4CFYA 4BX2A 5GP1A 4BNHA 4X6LA 1AHHA 2YV2A 4JH0A 3F73A 5CVUA 4X1KA 3W5VA 3S1AA 3WHIA 3F2VA 3SHVA 1X9IA 8ABPA 3KM0A 2PL3A 4LK2A 6REQB 4XTRA 5C1BA 2YWDA 5EMKA 1N4DA 4I9FA 2C1XA 4TKLA 3RROA 1QWOA 1NN5A 1UMBA 2DPGA 2NTVA 1YS7A 2F4NA 2OVFA 2E4UA 2R8XA 4GLJA 4A92A 4N01A 3JZMA 2DETA 4BFYA 3OKFA 3T12A 3RK0A 7REQA 2GTIA 4YXWA 3ND8A 1NYQA 1NONA 1E3IA 1SUWA 3AHJA 2ZDGA 2HFKA 1ZJJA 2ENUA 2JHAA 3KSDO 4Q93A 3GZJA 3S5UA 4RDHA 4XRGA 4GR4A 1CKEA 2J08A 2Y0BA 5JI2E 1FZTA 3RTCA 5DSTA 3U7JA 5DYWA 3ELDA 4OIFA 4RANA 1J33A 4RABA 2QG9A 2YHIB 4BKMA 3AVYA 3E2PA 3ESBA 3PQ2A 3D1LA 3IX7A 4IXNA 3HBMA 4UTPA 2JKZA 3SF8A 3V34A 4ER0A 2IS2A 3EMKA 2X3YA 2GCPA 1WB5A 2QRNA 2XJ4A 3MWKA 3OEWA 3QVUA 3VGPA 5KKNB 1PWZA 1P91A 1Q19A 2QTNA 3DFKA 2IWRA 2YKGA 1SBYA 1KI6B 2JBHA 1X7WA 5REQA 2E4AA 3IIMA 4CM8A 4JI6B 2GM3A 2JCVA 2PMBA 2QLLA 2GILA 4I19A 2HA6A 5EIXA 2W4QA 4IICA 1AC5A 2HU2A 3WRXA 4BLOA 1G60A 4EYSA 3BWBA 5L95A 2VTKA 1FC0A 3NAGA 4F4IA 1KYVA 3HRKA 2ZRDA 2OAGA 1LSSA 4X3OA 5KCZA 1PYDA 5L51A 3E8SA 4JI0B 1QCYA 2E4ZA 2IZZA 2GEFA 2XGMA 1FDRA 1SUSA 4G4JA 4H3HB 2GAIA 4MGKR 5ALYA 1KOLA 4J0JA 1UQRA 2VQEB 4AK9A 2DJ5A 3AG5A 4AO8A 2C1ZA 2PA0A 5M2QA 4F60A 4KLNA 5FWAA 3HHEA 4CEJB 1DDOA 5EOVA 1I3KA 1N0IA 5CK5A 5DULA 1ECLA 4CL3A 2YR0A 3U49A 4ENWA 4PHHA 4URUR 3VH1A 3FWZA 4IF4A 3WSVA 5IWCA 1NF9A 5IBRA 2Y1DA 1R18A 2NYUA 1ZINA 2FMTA 4FGZA 1AK1A 3PQ7A 4BZWA 1ZNZA 3IHTA 2QZ4A 1R9GA 4QFCA 1WLYA 3OLCX 4REQB 3VOTA 1UZUA 4LY6A 4MLCA 2CDRA 2X40A 3ZTTA 4GDFA 3IT1A 4JEMA 1GU0A 2O3RA 2H3EA 1EG7A 1TU0A 2ZRIA 1NLZA 2ERCA 4JXXA 1QR6A 2QIOA 1GTJ1 4OSEA 2QTHA 1H4TA 1T1JA 2SKCA 3BB1A 3GA0A 1K6XA 3D3WA 5ANRB 3VTKA 4D6PA 3C8UA 4BRZA 5FUYA 4DEYA 3HTXA 3N28A 3ZJUA 2DULA 4D5GA 3OE7D 2VDWB 5H59A 5TLSA 5A1TA 5TQ0A 1E9SA 4HNRA 2VNHA 2QN3A 2HBZA 3PUKA 3RVQA 2GXQA 3F7NA 1ATIA 1VDZA 2ATCA 3EBOA 3OZEA 4G0PA 1XL1A 4H1HA 1M2WA 2J6BA 3CLRD 5KJCA 2QLNA 3WIDA 1IXRC 1F60A 3X1YA 4D3SA 4YCNA 4W7SA 3VU1A 3KQKA 1IHXA 5F3WB 4Z0PA 1HC7A 2J30A 5C1PA 3JQCA 1FPQA 1S8AA 1BH6A 3H6KA 1TF2A 4DBLC 2Q3EA 3WLFA 2CJPA 2WT8A 1U90A 1TI7A 1QVAA 2P1ZA 3AUFA 3SSNA 4YYZA 4CLRA 5HF8A 5JNLA 2FMIA 3WL5A 4BAGA 3NVDA 2F6RA 4LDAA 5LP1A 4IINA 1V39A 3GNQA 3RT9A 1UEIA 1ZJZA 2WJPA 4OHCA 2JKVA 3P2KA 2DKOA 4ER5A 2P2GA 1V25A 3RV4A 1SA0B 1ZD8A 4FMDB 4FMCF 4J1NA 2D62A 3B85A 4AG6A 2AOUB 5C0OE 4MNTA 5IYZB 5CDHA 1Z13A 3AJ8A 1TW2A 1MFPA 3OZFA 3RS5A 2JNWA 1M2JA 3CH4B 1WWKA 1QF6A 4RA9A 3PZBA 1US8A 2J8ZA 4MI1A 2YWEA 2RKWA 3U60B 5AJVB 1CF9A 1R4AA 4XWYA 3NHMA 4RSMA 4KVZA 1PT8A 5EXDA 1ZXBA 1V6CA 1RPJA 4F3NA 1KR5A 1QVZA 4QQKA 3ASUA 1LV7A 1L2TA 1QJCA 3A4LA 5ALIA 5JISA 2QQEA 2VSXA 2PRSA 4R2KA 3I5YA 3M5DA 1U8ZA 1O94C 3NGXA 1N7HA 1UFQA 3W9UA 4NP6A 4CF6A 1O6ZA 1EFRD 3N86A 4UBIA 4DDKA 2WIKA 5CITA 3OU6A 3R0XA 1PGJA 4CMIB 1YDMA 1M1NA 3H19A 3K2IA 1PLLA 2EX1A 3LS2A 2ACVA 1L8OA 3NCHA 2O57A 4IOKA 3MC1A 1A1SA 1JAYA 1MV5A 1UCFA 2XGGA 3PJEA 4CMEA 1SBNE 5HGXA 2DHRA 2P75A 1SZJG 2JDID 2QBYA 1OMOA 2RGUA 3TSAA 2J3DA 4LSZA 5ALLA 3SC2B 3LUGA 2ECKA 1UXKA 1U1FA 2C42A 3BHMA 1W76A 1FNNA 4D5EA 4A8HA 1VI2A 3W6NA 1JHDA 2VHWA 3L9XA 4LPSA 3GFQA 4QYIA 2HHHB 2JIZD 4EY7A 1WB9A 2CZGA 4LJ8A 2G5PA 5EHNA 1IEWA 3WGYA 3TLXA 1R8YA 5H80A 3VV2A 1NBIA 3A4NA 5L3QA 1NNI1 2NQ2C 5G0VA 3LL7A 3CZ5A 1DKLA 1OI2A 4EJSC 2ZUWA 3BWMA 1NVEA 3C3BA 1JPNA 1PS8A 1AUVA 1AUQA 1YIAA 3I2GA 4IJMA 4XYLA 2V9ZA 5G1NA 8LDHA 5HJ2A 2J67A 3MA0A 3D1VA 3L4EA 2OZEA 4ALJA 4YQFA 2I71A 3FXAA 1UR5A 2J4CA 2ORVA 3NJ8A 4OREX 2ZIXB 1I4LD 4X92A 3TLCA 5D3MA 3GH1A 3PIDA 2GZHA 1R5BA 1TQ2A 2WU4A 5CLIA 1L0BA 1V41E 4XJXA 1JFLA 3V8VA 2G6BA 3K0CA 1N8TA 3D31A 1UEXC 1WMFA 3G82C 3T3HA 2ZWOA 2GS9A 3R74A 4BAZA 3AJ9A 3NM4A 2QYSA 4RXTA 2XD9A 1QK3A 4P5PA 2PKCA 2FN9A 2I99A 3QKRB 2C07A 4RD1A 4YMSA 5TQ2B 5FNVF 3CTMA 5BNZA 1YIOA 5HVNA 1QTQA 3GJ5A 4Z8XA 1JDBB 2OOKA 1Y3FE 4A8TA 5F1YA 3D54D 1QFZA 1VHTA 5B7PA 1FUEA 5BN1A 4Y0AA 3A05A 3ZXXA 5K0EA 1X1DA 3RG8A 2GHRA 2HXYA 2JCGA 2NO5A 2WV7A 3D6UA 3IE0A 4TWIA 4D3ZA 2FYTA 3EEBA 1RZRD 4XUEA 4M6WA 1ZP6A 2EU8A 4MRSA 4OK6A 1MO6A 2VDJA 1O9GA 2AYXA 2PX0A 3G2OA 3TB4A 3DT9A 2J0SA 2Q41A 4RZXA 4CI0B 4F06A 3RC7A 1RPZA 4YAJA 5EIEA 2EX0A 3IUPA 1U9IA 2C7GA 1HI9A 3B12A 3ENNA 3TQOA 4RQTA 4C4YA 2HWYA 1Z8NA 4HB3A 3K9FC 4UATA 3A0RB 2WIAA 4A15A 1VMAA 1IK4A 1M34A 2JGDB 2QRJA 3DE7X 2NM0A 3JTEA 2DH6A 4EB6A 4XPIB 4P58A 4LECA 1R1DA 3G2MA 5TIIA 2M98A 2LKCA 1Z2DA 1K27A 4KH0A 5NULA 2WFAA 5FL7D 5IAJA 4J7AA 3TLAA 1TM5E 2QRZA 3IP1A 4U63A 1F7VA 1E2KA 1QQ6A 2C99A 4J9UE 4NMWA 4Q5IA 2OQVA 2X5JO 4CM5A 1JIJA 1O6CA 3RT7A 1CYEA 3QE4A 1DQRA 4D26A 1GFIA 2XUJA 4OEHA 4E11A 3ELYA 3L2OB 5IDXA 1BIFA 2UUOA 1VMEA 3WRWA 4L4RA 3R40A 1XGKA 4YBRA 4DA0A 4HLNA 2CGEA 3ISVA 1L8XA 4K6OA 4E14A 1YQWA 4KRGA 4F04A 4EW6A 1X1EA 1B15A 2YBDA 4I50B 4TXHA 2VNSA 5ALUA 1IZ0A 1U31A 2WJIA 4G1EB 2CXUA 4B4WA 4NPCA 5KU1A 2IUTA 2IJGX 1C9DB 4OHUA 4XQEA 3EY9A 2FQQA 3F3MA 4G8BA 2LZ0A 2XDAA 1G98A 4BYGA 1I7LA 2CNNA 3CLUC 4MP3A 1AMNA 5FFNA 4Z86A 2OZLB 2R9VA 5D86A 3DVAA 1EFVA 3QUAA 1WS6A 1X9HA 2BDEA 2O07A 3PDJA 3Q0TA 1R66A 4M0UA 3VSDA 2VWQA 2W8BA 1K06A 4RS4A 4RS3A 4TSFA 4F85A 2FB9A 3KQLA 4P3YA 4MPDA 2GBLA 1NMZA 2AVNA 4XVQA 2WMYA 4JYAB 1UQTA 3WZMA 3M5WA 1DUIA 4KYTA 4Q0MA 1CJBA 1DDGA 1ACMA 2OBFA 2ZBPA 1G7TA 3JAWA 3AM1A 3H9BA 1X1TA 3GNLA 4CTKA 1WY7A 5A0VA 1OFHA 1H22A 2OCXA 3CINA 4UAGA 4QU0A 1U4SA 1UDAA 3PNKA 2EBHX 3QU7A 4PXYA 2FRXA 3JQAA 1AKMA 2P9BA 4FOTA 4LA4A 4DA9A 4FHEA 3A6KA 1L5OA 1FP6A 2QAGA 3HKBA 3FDIA 5EE5B 3QYJA 3TTWA 3O3CA 4BKPA 3IPCA 3F6EX 1NJGA 2P27A 2AA3A 3ML1A 3FTCA 4DBVO 2Q3JA 3NGLA 5TR9A 2P6OA 4PLFA 4EKGA 3Q7IA 5ADUS 4NECA 2XH8A 4BEBA 1JBQA 1R8SA 2JBAB 1TKAA 3A6JA 3OC0A 4KYVA 3I5XA 4DREA 1JPUA 1JRLA 4I4TB 3V42A 3QXGA 2BM0A 5FFFA 1GPAA 2FPGA 4MKXA 3ZWNA 4ZCPA 5BP7A 5T6BA 1LJ8A 3D0OA 1A5AB 1CQWA 2XQKA 3NIWA 1NXXA 1OA1A 2H1LA 3TM4A 5K4AA 4G07A 1VI6A 4FS8A 2MTBA 4DMFA 1Y6QA 2G06A 3D8SA 1V4BA