2LV8A

Solution nmr structure de novo designed rossmann 2x2 fold protein, northeast structural genomics consortium (nesg) target or16
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
110
structure length
110
Chain Sequence
MLLYVLIISNDKKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRKESQNIKVLILVSNDEELDKAKELAQKMEIDVRTRKVTSPDEAKRWIKEFSEEGGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Principles for designing ideal protein structures.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
molecule keywords De novo designed rossmann 2x2 fold protein
total genus 41
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lv8A00
2N3ZA 2MR6A 2L69A 2LV8A 2LVBA 4J29A 2LNDA 2LRHA 2KPOA 2LTAA 2N75A 2LR0A 5GAJA 2LCIA 2L82A 2MR5A
chains in the Genus database with same CATH superfamily
3UH0A 2YV2A 3BSFA 2GD2A 1Z0DA 3LRPA 1T10A 4EITA 5KKCA 2B7CA 2IEIA 1PKXA 5I8ZA 2JI7A 4C7JA 1JJ7A 2O0MA 1J8DA 1RWPA 2C9CA 2QD5A 2Q1UA 4OKIA 3ZIAD 1ZD3A 3ZHXA 2CZGA 5A0VA 2XXAA 1LQ2A 3OE7D 3LC7O 1HRDA 2ZVJA 1E5TA 4TTVA 1I0IA 1GZ7A 3LH5A 4YP1A 3WP1B 5BV2P 1XZMA 1D2GA 1Z08A 2FVYA 1R9GA 2QRMA 4P7BA 3CCFA 4UUAA 5IVKA 1Y42X 2PD4A 4AS2A 1T8PA 4P3NA 4EHJA 4JT2A 2AOVA 4ZAYA 1RKUA 5AMXA 1I6MA 4P22A 5EIBC 2X15A 3BQ9A 1T8RA 1LBHA 1LDNA 1SZCA 4HYTA 1JEQA 4BQNA 1C7RA 1C8KA 4EW6A 4ZN6A 1R0LA 3KELA 2BFFB 1E58A 1W5EA 4GM1A 3QXXA 1FLNA 3GJTA 3V2GA 4BB9A 1TAQA 3LXRA 4D56A 5LZ2A 1E92A 3I1JA 3BCSA 1UKZA 3V8VA 1SK9A 1YB1A 1IN6A 2YUIA 1FFXB 3BIJA 4G1BA 4W4TA 5HUQA 3N28A 3C3JA 4WA8A 1TF7A 2HIHA 2VTDA 4GMHA 5A3VA 3V3TA 4RD1A 3WNQA 1R5JA 4CLOB 1L5QA 1SCIA 3AU8A 3EZNA 4R1MA 4ZCQA 5M2QA 3RROA 2H0QA 3B6EA 2XCSB 3G2QA 1KFBB 4GPD1 5D87A 2J48A 3FDJA 1MU0A 1TA9A 1WSBA 2IUSA 3OJ0A 4AJPA 3OQIB 1T6XA 1UXIA 4YV0A 1DEXA 1TZJA 2IQ5A 1HLPA 4YP0A 2OM6A 1MMFB 3RRMA 5JHGB 4M1MA 5DM2A 1EGAA 1GPJA 5K4AA 1RABA 2W2QA 1PFYA 4RYLA 5AHRA 3T7IA 5TARA 5G4KA 1NVMB 3QMPA 3K2BA 2HTFA 5G0UA 1CUXA 4S2UA 3CLUD 3NT4A 2IT1A 2UV8A 1X7HA 3JTMA 4FFBA 1TXGA 5EN4A 2OYCA 1ITZA 1U31A 4YMSA 1W46A 5LYYA 3W1WA 4PZ0A 1NVEA 3D6AA 1CZOA 4LXQA 1R0CA 2VJAA 4B17A 2NSDA 1CUZA 3I83A 2HJWA 5U9CA 4X62B 4MDHA 3K2IA 1E5DA 1BD4A 2VJMB 1EM6A 3TDKA 5BSHA 5IDVA 1QHNA 1XALA 2F3SA 1QOQB 3FA2A 3L93A 4M2LA 1CK4A 3H3JA 3W7VA 1VMIA 2YJZA 1MAVA 1TC2A 1VKHA 4MKHA 3MGGA 1JBKA 2QORA 4EG1A 3CSDA 3T7DA 1YI1A 2I29A 2NU7B 5KTSA 2J8ZA 2Z57A 4RTPA 2IYWA 1JYFA 1JPJA 3H1FA 1EXNA 4B2LA 2BVNA 5B1YA 3B6IA 3X2EA 2RI6A 3WBKA 7MDHA 1PG0A 3I0ZA 1AURA 3V6LA 4KIGA 2W22A 1HE8B 4EENA 2DFTA 4MKZA 2C78A 1QVWA 1HZJA 3P2YA 2CD9A 4JVMA 3E9DA 5FFFA 1VYVA 4LF5B 4CE6A 1G8FA 3MMZA 1M74A 5ALSA 4Q12A 4ZVPA 4AMYA 4D81A 4UTOA 2AIRA 3DTVD 1Z5OA 1BO6A 1R6UA 1EDBA 2BJVA 5DDIP 5A3QA 5FP0A 3LT5A 2V97A 3ZGLA 3W6PA 5IKPA 2UZ4A 5BWNA 3PCRB 4JJAA 4Q1CA 3KJQA 1T3GA 3FDZB 2P2NA 2B34A 2GJ4A 2QGNA 2QBYB 2H11A 3F9CA 1X3SA 3HSKA 2GJ8A 2ICAA 2COUA 1NI3A 2RHLA 3RSCA 4H6PA 2YNMA 4IMIB 5L3QA 3BILA 4QKQA 2UYHA 3MS2A 1CWUA 3AF5A 3HNOA 4CU5A 3WO1A 1P3JA 2XGSA 3A9VA 4K7JA 3Q9LA 2OBXA 1ZCBA 2G1UA 2G4CA 3Q7EA 4MS1A 4OYHA 3V4FA 1ZIPA 4LRXA 3V32A 1RXYA 4GSKA 4DLPA 5JD6A 3CKYA 2NTNA 4K9MA 3T8YA 4ICIA 1TZMA 3R3UA 4N5HX 2OLKA 4XX0A 5LN1A 2XAAA 1Y8RA 4IIXA 1KQPA 4KN5A 3TL2A 3U7GA 3LTNC 1CDEA 3DF7A 3RRYA 1J0BA 2J5BA 4JJZA 4KVAA 1RQGA 4I50F 2AK2A 4WZBA 5JAZA 1EUYA 2O8EA 1U3CA 3JQEA 4KGXA 4NMXB 1EH5A 4WXYB 3LLUA 4TM8A 3JRWA 4BNWA 2Y4OA 1IATA 2QAIA 4Z9XA 3V5NA 4F4DA 5C7OO 4BRSA 2B2XA 3W2GA 1P5RA 4A0HA 3MOIA 1X87A 3N5CA 3I8SA 4MQMA 5I9SA 2OQIA 1J25A 2NO6A 3FPGA 3FZQA 3ZE8A 4PFJA 1EBBA 1N9KA 4FCCA 5D6OA 4D1YA 5KNDH 3AIOA 4D9JA 1FLVA 3F74A 3KZ1E 1FRFS 3PR2B 4ZRDA 4NP6A 3L4BC 2QQGA 5EEGA 1N75A 1XJWA 5LXTB 4UOQA 4Q47A 1FTSA 4INPA 3PFIA 4DAOA 4TLLB 2GUWA 2ZIXB 1NKVA 3N05A 1IFXA 2VYVA 1JFFB 1G5QA 1P91A 3P9SA 1P7VA 3MBOA 3SZUA 2XCTB 5F5XA 4AVYA 1JLMA 4NNOA 2YY6A 5JH7F 3E48A 3L79A 2BM1A 5TGZA 2YFHA 1SNYA 3MPUA 5FA6A 4D98A 1WQ4A 1WPXA 2AJDA 2JCXA 4A8JA 2WIBA 4M9ZA 4F85A 3AZPA 1PN3A 3U3MA 5AJZA 1NMYA 1Z45A 2NZJA 1H0HA 1SHUX 3GIWA 1F0KA 3L5KA 3ESZA 1FFCA 4U2GA 3V8MA 3W8FA 1M2NA 4POAA 4FILA 1X7ZA 3M5PA 1X80A 2JKYA 2GN8A 4YJ3B 1D4FA 2ZB4A 3AHIA 2VZ0A 3GFOA 1U3WA 3L7NA 3PUKA 4M53A 1ORWA 3E3MA 3VQTA 5HKKD 5HKKA 2HCRA 4RY9A 1GGHA 2QN9A 4EECA 3MTDA 4Q21A 3MLEA 2P5YA 3RK1A 4RO0A 4UMEA 1IN7A 1YV9A 1OV6A 2YMLA 3EY4A 2YXBA 4O4JA 4O4LA 4FWTA 1MEJA 3L8GA 5AH0A 3ZWDA 4M9RA 2V4MA 4LF4B 1QRAA 3FWKA 2WQ7A 2BBWA 3DOIA 4QPCA 2Q46A 1YR9A 3FIUA 3OJLA 1UANA 3QYAA 3EY9A 3Q1KA 4RZSA 1V16B 4JROA 4B6OA 4AYWA 4COKA 1DX6A 4S24A 1NMXA 1SM4A 3D8UA 4N3CA 3PX7A 5P21A 1T3TA 3ASZA 1Z8HA 3G8AA 4J76A 6YASA 3T1TA 2Q1XA 4Q48A 2DX7A 1X1SA 3OJWA 4HB2A 4BJ1A 3ONEA 3QTTA 2R6R1 5DULA 9MHTA 3G5LA 1NNI1 1R4MA 2ZJ2A 1N78A 2M6LA 3K9WA 3DB1A 1FXWA 3WWEA 2EU8A 3D8TA 5CDTA 1DTEA 5CLHA 3SXJA 1KDRA 1MXFA 4RSHA 4C0QC 2ZPTX 5A4MS 4OREX 4K9LA 1V1MB 2R47A 3I72A 3UCEA 2C82A 2OQRA 1GR1A 3PXBA 1LX6A 2VJDA 4QYTA 1PL7A 3IQGX 3EQ7A 4O63O 1SU4A 4PONA 3O4RA 3GCDA 5JAQA 2E49A 3D8SA 1D6NA 1USUA 4V3CA 4L8GA 1JDUA 1KZGB 4ND4A 1HMPA 3H17A 5GP1A 4N4AA 3RFXA 4RKEA 5DTIA 2G76A 2O7QA 3GUYA 2I91A 3TTUA 5AUOB 2BGJA 4ID3A 3CB2A 1O94A 1SMKA 2ZBPA 4CIXA 1GTRA 1H66A 4TMWA 5ECWA 3QUTA 4F11A 4WT7A 2Z2ZA 3LA8A 2HIAA 4F56A 3R6WA 2QN6A 1FJHA 2QRZA 2WJGA 4C3OB 1BYIA 4PCAA 2YIJA 2VT2A 3PYXA 3AF0A 4H3KB 3JQAD 1L3IA 4N5MA 2VUUA 4XEHA 1RPNA 1TD1A 1TZCA 1VG8A 1UWVA 5B7GA 2HSJA 1W76A 2A1IA 2WUDA 3S8YA 1USGA 4G8JA 2DGDA 3QZUA 4GI2A 3AKYA 4WDRA 4FYKA 4GKVA 2XHZA 3R3YA 9GPBA 2PGNA 5JDIC 5K8JB 2YXDA 2BL4A 3BE5A 1NRWA 4DADA 2ZUWA 3B5IA 4WD3A 4NE7A 2JK0A 9LDTA 4K3UA 2RGBA 1REQA 3GZJA 4KPGA 3VR6D 3ESQA 1G9XA 4FGUA 4G97A 1TUBB 2ESRA 3FROA 3OZSA 1Y5LA 4Y2GA 4ECAA 1O77A 3AETB 3IAEA 3WMXA 1HI9A 4IX1A 3JAWB 1ODIA 3LY7A 4CCWA 2ZZNA 1OROA 4YDQA 3G5MA 2HEGA 1Y0BA 1ZRMA 1D8TA 5I3CA 1GQSA 1O08A 3ESYA 3EMBA 4IJKA 3R0XA 3DBVO 3E4CA 4M0FA 4QNNA 3TLKA 4AUEA 1GQOA 4G1CA 5LP6B 2ZR0A 3M6FA 2GVZC 2M6SA 2X8WA 5FBKA 3V4ZA 2EKDA 3UMMA 1D03A 1PGQA 1GCOA 1M2JA 1XRRA 2C9BA 2Q50A 4FBLA 1ABBA 4UNSA 1OZ0A 4XLTA 2Q5FA 3DDZX 3QUQA 3AJDA 2H52A 3JQFA 4KUEA 1X1RA 2VBGA 1F6DA 5CM8B 4DLBA 3THYB 5TMDA 4YK7A 2R7NA 1R64A 5KTOA 1KJ8A 3L8FA 3Q72A 3PXEA 3ZJYA 1TIPA 1AKNA 3E8MA 3CMCO 1D4OA 3FHLA 5C7LO 4B76A 4TV9F 1SD1A 4R9UC 2EL9A 5JIBA 4URUR 4YAJA 4U0KA 4L3WA 1EM8A 1YVDA 1SKYB 2XE6A 3D6HA 1GQYA 1SWWA 3PX3A 1JEYA 4QC2A 3VZRA 5ALPA 5C51B 4G41A 1GG5A 1ISGA 1RLTA 2OFWA 2QL9A 1GTL1 1IVYA 3ONWA 5JTTA 3TLAA 1VP3A 2GN0A 3TOSA 5JMOA 4DV7B 1XEAA 3COYA 3ELWA 3JQCA 1KO1A 2MMCA 3PNOA 1A2KC 2AHRA 4A6PA 3LI2A 1XRQA 2H2DA 1L9KA 1YL7A 3BDIA 3GCWA 1P8JA 4Y98A 3FCXA 4PTLA 5CHYA 1MB9A 3ZQUA 1VSVA 1L2TA 4RYDA 3EGEA 2GLUA 1QBGA 4EOGA 3I39X 2Z3VA 2K87A 4EG6A 1IE3A 3B13B 3SHOA 4KXVA 1NT2A 3RUCA 1O2DA 3Q41A 1MC5A 4WXPA 3PNBA 1KU0A 2RHGB 3GJ0A 5CURA 1KYZA 3H86A 1EK6A 1R27A 3QKTA 1SEPA 2GN2A 2B8EA 3I09A 4HWKA 2I6GA 4L02A 4MUXA 1W36D 5D3MB 3L06A 3FF1A 3CLVA 1T9CA 2HWKA 2N3ZA 4IUDS 4FYXA 1BEEA 1K08A 4FGKA 4GZ6A 3V7WA 3UHOA 3DQPA 1EQUA 2EG9A 3KKOA 3OM9A 1UJ5A 1ESCA 3DGFC 3MT0A 1EGQA 3ND7A 5F2NA 3NOOA 1WXGA 4MRPA 1C9DB 1FS4A 3RYTC 3QLVA 4LPKA 4AX8A 1HUQA 3K6KA 4OHUA 2G08A 4K05A 2OKGA 2PMKA 3N8IA 4EYOA 3OQPA 2F8TA 3STVA 1NN3A 4BEBA 5BV0A 2Q0XA 4MP6A 1UFVA 1QV7A 5LFAA 4IHJB 1SO8A 3P2KA 2PUGA 2WHXA 3PNPA 1TX4B 2HUNA 3FVVA 3PRJA 4GEKA 3MJTA 2PFKA 4GQAA 3DBRA 1QKJA 4Y1RA 5KTRA 2QU7A 1DBIA 1IXYA 2JLRA 3MWKA 2FLWA 4Q15A 2ZVQX 1LCIA 3VKFA 2C7OA 2V5AA 2IUYA 4GLBA 3GJZA 1HT0A 1RQ7A 1VL5A 1Z2AA 2HA4A 2PUHA 4MICA 4ENVA 4AW9A 3RVOA 3TGWA 1VL1A 2I4IA 5AVOA 2JFXA 4I5FA 4DFDA 2ZYTX 2X9NA 2IYVA 5KCMA 4CF3A 3IP1A 1U81A 1Z6XA 2RG1A 5LA6F 4NCBA 3T7RA 1T2AA 3IBFA 3VNBA 2DBQA 3NVMB 1L5HB 3U3KA 1G18A 5BVHA 5EGSA 5CIYA 5EQFA 1IJFA 3CLTD 3DL2A 3WISA 4B6EA 1NBAA 2FF7A 3HKEA 4CLRB 5FTJA 3LAWA 1UJNA 3OOYA 4KP7A 3T3HA 3KE8A 4E12A 9ABPA 1D2AA 1DOAA 3AIMA 3VR6H 1YS2X 2ET6A 1UJMA 2ZWPA 4HLNA 4BOYA 4ZYXA 4RQUA 2RHWA 4M0LA 4DCOA 1SVOA 1Y1SA 2VC2B 3FMOB 4HUTA 3AB3A 3IESA 1HFWA 3ASYA 5FNVB 3JQ7B 1XN4A 2PKCA 3NTOA 1LFDB 1MW8X 4TL9A 5DLYA 3C3KA 2H18A 5CU7A 2CFRA 4KWHA 3GJ7A 2YFQA 1WCIB 5AW7A 3OT5A 3RIHA 4EBBA 2JIZA 3EA4A 3ED5A 1RWVA 2FPRA 1PFWA 3LG2A 3WDSA 2AB0A 4DM7A 1PSWA 3G1WA 5BRNA 1LRJA 5K6RA 3TCKA 3ZH9B 1F20A 4AP9A 3QLUA 4E0BA 3K5HA 4FU0A 3WLSA 2H4FA 3FWNA 4BZZA 5EZ6B 3LOQA 5IH3A 3TIVA 5K3CA 4FOSA 3IJEB 3JSAA 3WYFA 8ABPA 5DCUA 3G0HA 1W75A 5EWLA 4ILKA 4XJXA 3FRHA 5IBQA 4BYMA 5C8XA 2PV0A 1OI4A 4L0MA 3IT3A 4I99A 5FCDA 3P26A 2H17A 4KDRA 4MS4A 4F38A 1E4YA 5F73A 1IOWA 3T3GA 1E4EB 1QO0D 4RIEA 3D1LA 2ZBGA 3RT7A 4N40A 3TPZA 2QUJA 4D4MA 2P90A 3WI7A 3FFXA 3L7BA 1P2SA 5K0JA 4G65A 3MSCA 1WCV1 1U1FA 3CIOA 2HBYA 3UV3A 5CAEA 4MZDA 4MR8A 4Z8YA 4JT4A 4LYAA 2WZQA 4LJ9A 5JEDA 1U4SA 4WOKA 3Q98A 4IILA 2BFDB 1HORA 2CLHB 2Z4SA 3LDUA 5IJZA 1M8JA 3IP6A 5C8YB 3RAPR 2XBUA 3WGKA 1HT3A 2JGIA 3NG1A 1B8OA 3GWGA 1BXRB 3DDOA 3RV4A 1SXQA 2FGJA 3GGCA 3X1ZA 5CDHA 2I6TA 3QM1A 5JUWA 3HRIA 2BFEB 1MO6A 3BL6A 5FADA 4HNSA 1TRKA 1OFVA 1PX2A 1TVKB 4Z0TA 3MFQA 1VJ5A 4YDHB 3AVQA 4FK8A 3H7IA 3ZS9A 3KQYA 2DLCX 1EGVB 3NJRA 1S1CA 2V7TA 1PDWA 2CSXA 2NT4A 1N92A 2ID8A 4UTVA 2FPMA 1RYMA 3R2JA 3UH1A 2RAVA 3VGJA 1II0A 3TNFA 4CGZA 1N5OX 1FNSA 2AX4A 1P1RA 1HE2A 2Q3FA 4PYMA 4MCHA 1OKKA 1YHZA 3ABOB 1J0CA 1WZNA 4IFBA 2Q6IA 4XW2A 2HNKA 1OBVA 3DMDA 1PYOA 3AUUA 4D4GA 1DE0A 3D31A 5IHPA 4RWZA 5DGTA 4ZANA 4Q0MA 4HRVA 3SFVA 2OCKA 2XD4A 3LGXA 4FFPA 4G9BA 2FPOA 4R54A 4F3CA 2C8LA 2D4HA 2IDJA 3CR3C 3NVDA 4JKIA 4ZOLB 4E88A 3HI6A 2X2OA 4ZMRA 2ROQA 1FQJA 1IZ9A 1XPJA 1KMNA 3SGLA 3AHFA 4AY3A 2RGCA 3UA4A 4FGWA 4ZT2A 3TG8A 3F98A 4UVEA 3EXEA 4N3NA 3KK0A 3VR4D 3WKAA 4RJLA 4TXMA 5THKA 4KRXA 3JQGA 5FO1A 1SKQA 3QPDA 4WEQA 1XNQB 2PSJA 1OI7A 4OMDA 1OGYA 2QT0A 2YYYA 4QGBA 2YC4C 4IZIA 1ECJA 4NMMA 4URZR 4BO8A 4RVOA 1YIAA 1ZM9A 3TK1A 1V9LA 1I6KA 1XFDA 2P6UA 4ALJA 6ABPA 3ZVNA 2EXXA 1JT2A 3VHQA 2EFEB 3ZE0B 4ERXA 4DDUA 1AO3A 2RHDA 2XMQA 4MQ5A 2XNJA 1D0VA 1OHHA 1TCBA 3AU9A 4PPQA 3UJBA 3NBXX 3DAOA 4ADSG 3ZJVA 4IQGA 3R6GA 5DX1A 2FI1A 1VKZA 4MCIA 5FH9A 2QAJA 2VDNB 1V26A 2OA0A 3VZDA 1AGRA 1R0SA 3GRCA 2PL9A 1RZ3A 4J1TC 4AD8A 3U0VA 3WRWA 4F8EA 1B42A 4IIVA 5A0FA 2SBTA 4HKTA 3W8DA 5AJXA 4RH1A 3GMSA 2HMWA 1MB2A 4MWOA 4FW9A 2VAPA 4MV6A 2IHZA 1MO4A 2Q2VA 3CR8A 3DW1X 1HDXA 4XDZA 5KJ6A 5KU7A 2JI8A 3E18A 4F60A 1E6KA 1NW9B 2VWGA 3IO3A 4NBLA 1KOGA 1CCWA 3HB5X 3C3YA 5IDXA 1OYYA 4LJKA 4XWKA 2BMAA 1O94D 1ZU4A 2X4IA 1EB8A 3DTVA 5JANA 1FNNA 3C3DA 1EE2A 5FKJA 3ZHBA 4KJXA 4DVGA 3ZE2B 2YW9A 1EWTA 2FPIB 4P3KA 1MZPA 1XCBA 4KNYA 4RVUA 1Y1PA 4W7HA 1CHDA 4OTZA 4QNRA 4ZK2A 2ECFA 3CPSA 1RI1A 1GKYA 1KSHA 2A9QA 2QVBA 4LQ4A 2K2WA 4UUMA 2C2KA 3I2HA 4G89A 1KYYA 4JJFA 3DCNA 3N2KA 3KLPX 4IF6A 4R6XA 4X91A 4Y6PA 3TO5A 5HP4A 1RE1A 5K4GA 1G8AA 4E1AA 3ZVRA 5KWEA 2VRCA 2IYOA 1PV2A 1UEIA 2C3OA 2F1KA 1J2YA 2Q5EA 4R7ZA 4E22A 3LCCA 1BHSA 4LY0A 4A3SA 2C7PA 1GSAA 4BFWA 4ZOCA 3O8BA 3UC5A 3UFXB 1QGED 5JECA 1OA0A 1SB8A 3BH7A 3IAUA 3SC3A 3A25A 5B6IA 3LPLA 3HYLA 1L7OA 2VAXA 5DYNA 4GUDA 3G6KA 4O1MA 1ZUNB 4QGFA 2H00A 1WS6A 2CBZA 3WLTA 2I7VA 3KYBA 2O3UA 4K5QA 1TGYA 1UADA 2ZDHA 4BXOB 3GJ4A 3CN7A 1JG2A 4HAIA 2G36A 5LQDA 3KPWA 1LNQA 3ZZUA 4GI7A 4O1IA 4EQ6B 4ETWA 2UYYA 3V7YA 5TS2A 1ODKA 2WKRA 2GZMA 4HOYA 4CM9A 3IMCA 4PCVA 1U0FA 1DLIA 3IOEA 5DIFA 2H29A 3JD1A 2QD4A 1YRHA 3IA7A 3A1UA 3JALA 2G7ZA 3NUQA 4KV7A 4W6QA 2ZWIA 2Q62A 3DVRX 4HUJA 4YFVA 2IH2A 4II2A 5B3LA 4GG1A 2MR6A 3C3PA 4O0LA 1XHLA 3HLYA 3EXHB 2VXBA 1EJ2A 1GTG1 1MJGA 1JDBC 1NVDA 3A9RA 3VPDA 2WAXA 2EBUA 2FSPA 3MTQA 1ZLYA 5GINE 3K9NA 3Q2KA 4NZ9A 4GNRA 5FF9A 1AK1A 5ARDA 4MO9A 1F9EA 4LISA 1PDOA 3KX2A 3BRQA 1X1QA 4B47A 4HDOB 1NOIA 2Z9BA 1K8RA 1BN6A 2FE4A 2P9FA 4M7WA 4XVCA 2NM0A 4XGKA 1QUFA 3G0BA 2QX8A 1ZJYA 3HJCA 3PE6A 2PEZA 2D06A 3DMYA 3ZE6A 2I1QA 4HX5A 1KI6B 1RWOA 1T4BA 3RC3A 5GIOE 5ANRB 1CC1S 4JAVC 2CNKA 2O3TA 3LUAA 4J6FA 4MW1A 1XF1A 2E87A 1KK3A 2WYIA 4OQLA 2OKCA 4CXMA 3PFWO 1G8YA 1GKUB 3AZQA 3DXXA 3G68A 3N8GA 1PE0A 1AIPA 4TKZA 1CB7A 2ZTMA 1CQJB 4RACA 4LDPA 4PSCA 1AUPA 4DRYA 2YOFA 5GADl 3FFBA 2WZCA 1XTUA 3IAM1 5IBPA 3V34A 4EA6A 1ZISA 3QNMA 4ZOLF 3EGXA 3GUVA 5DOZA 2ZU0C 3ET5A 2HJRA 1O95A 2OY0A 3NFRA 4QU0A 5HTOA 3HA2A 3IT2A 3LUKA 1RADA 3WHLA 3MB8A 3JXEA 2NTYC 3CFYA 2DR0A 4AWAA 3SHVA 5A3RA 2MIIA 1MRNA 3ICPA 3PHLA 4CBVA 1VLHA 5DISB 1VLVA 4NMWA 4PWYA 3ZDZB 4UHBA 1ZQ9A 3HM9A 1K8QA 2MU1A 2OAQ1 4O2AB 1QOZA 5HMMA 2EDAA 2P7HA 3SYRA 1T8UA 3FVRA 1NBEA 3V8BA 3AGQA 3DOJA 4NHOA 4Y67A 3SF8A 3NAMA 2J4CA 2Z43A 1Q16A 2HY7A 2ZAMA 3B89A 2VIIA 5JD4A 4D43A 3WSVA 4IZ6A 3AUJB 3AHJA 1ECGA 2QVXX 4YMTA 3F96A 4Y2XA 5JQGA 4B5LA 1TAUA 2ZKIA 2C8KA 4AU1A 1PS8A 3OM1A 5A9RA 2VTBA 2X0EA 1TDJA 2JD1A 2WJIA 1E2PA 3NBAA 5IN5A 2C7RA 1T35A 1WHTA 1XXHA 5DWVA 1QV9A 5IK2D 2FRXA 2VPZA 1E3JA 4JJ8A 4M1TA 4PV7A 2F3UA 4TUYB 3GP5A 1ZNZA 4K9KA 4QJ5A 3IE0A 5ERYA 1DHRA 4Y2YA 2KS6A 3PA6A 4M86A 4MRMA 4CFYA 5GTDA 4JGBA 3UMFA 3AWDA 2D3TA 1SZPA 3CCCA 3JSXA 3KHSA 3R9KA 4I4TB 3VZSA 3RR2A 4D8VA 4NCAA 3AOEA 4H2DA 1P4HA 2IW1A 3M6XA 2QL6A 3BZUA 1I4WA 1MPXA 2I3GA 4NSNA 4RHUA 1Y3HA 5B2ZA 2YDXA 3G5UA 2LXNA 3ZK9A 2FPUA 2FH5B 2JJ2D 2LD4A 3D3KA 3CNBA 5TS3A 4JUDX 4WKPA 4ZVKA 3WLLA 2CN1A 4EM6A 1X7GA 4GH5A 3TRIA 5I9LA 2GPWA 5B5SA 4GF5A 4Q3DA 4Q4HA 1ETHA 2LW7A 5DU2A 1HDZA 4JENA 3RS3A 2CK3D 2GZHA 5KNLA 1DEAA 3BC1A 4F93B 1OX5A 1IHDA 4NG4A 3SJZA 2FZCA 3K9GA 3STYA 5CFOA 4RXUA 3W6UA 2Q5HA 1UJ4A 4G6ZA 5EP2A 1FVOA 2OO5A 2VJNA 4GU5A 2CKMA 4DV3B 1CQWA 1UKEA 4BX9A 1G5IA 4IDDA 4U9HS 2C4HA 3KR2A 3O93A 2B98A 1AQLA 2VZLA 3ABQB 4LDQA 4LHEA 1E20A 2VI5A 1U2DC 2SCUA 5EJ4A 1YBMA 1CUDA 4ZXPA 4I4LA 5UKDA 2WJ4A 4H4DA 4XDHA 4ZTUB 2WU0A 2D5BA 1SXJC 2P2ZA 2QLNA 3BS4A 3H4VA 2BJHA 221PA 4FGSA 5HGXA 4DR1B 3H2BA 4YIHA 1LU9A 2XA1A 3BWMA 1JDNA 2ODWA 3HRHA 3NVAA 3OZGA 3U9TA 4NXNB 4HRAA 4GX0A 2GHQA 4XYEA 1ZNXA 1C7QA 1Z4PX 4GSYA 2XXBA 1T2FA 4JCOA 2ZRLA 4UHHA 4R2HA 3DE2X 1LPPA 1KVSA 5JI3E 4BQFA 4DQVA 3P4XA 1OAOC 3KTOA 1W88B 3HXPA 5EZQA 1L5SA 4DHWA 2EWMA 3Q0IA 3NRBA 1X1AA 4QQ8A 4CUZA 4QGAA 1PNRA 2EEPA 3JRXA 4OHXA 1P2DA 1QIDA 3MMSA 2W2KB 2E4VA 1AXEA 4NOLA 4RLFA 5FJIA 5H3LA 3HO6A 4IDPA 4RA9A 5CEJA 3ICVA 5CFQA 4Y1FA 1FFXA 3ZHSA 4DQLA 2JEZA 4FIDA 4Q9HA 1SUIA 1H6CA 3VR6A 2XMBA 1RACA 1QNLA 3GT3A 2QRKA 3SI7A 1ESDA 2C61A 1FSZA 1MX3A 1VMAA 3O0DA 1JIQA 1EFLA 4FPXA 3DO6A 1Z6TA 5AM1A 2WD7B 1GLNA 1FXWF 3HB9A 4M9SA 4ZAVA 2JIPA 3NT2A 3TW8A 4IH4A 2V6GA 3H84A 1DARA 1W85A 2E4WA 3ECCA 2AEEA 1V4NA 2BFPA 3FGPA 4Q66C 5TQJA 4CT5A 1D2MA 3DLIA 3A4TA 1JEOA 4NCNA 2PKXA 1H6BA 4G5OA 5JJIA 3PCXA 2R4QA 4KAAA 1AMNA 1ND6A 2Q9BA 1H0RA 3HVUA 4UASA 5DHFA 4ARIA 1QYVA 4XM2A 5EKXA 1PR9A 4IFTA 2JGNA 3HS3A 4ZO4A 4K03A 5EZYF 4Z4EA 2V7UA 2H7VA 3G0IA 4MINA 2ILVA 1AQNA 1O0CA 4YRIA 4FFBB 3N74A 4R9NA 2H7XA 3O7MA 1QMGA 1N5DA 3CLHA 1UKAA 1RFLA 4K9QA 1HSZA 3R0ZA 5KQMA 1T5BA 4J16C 3ZTYA 3B3FA 5K7SA 1YCGA 1BDBA 4B3GA 2OVBA 3TPFA 2VJMA 4Z9BA 1TA4A 4B5KA 3QPCA 1M3SA 1M2WA 1QHFA 2P3QA 4MI3A 2PUEA 4NCKA 2CFSA 2C57A 3S6JA 3LBIA 4QBGB 1MX9A 4WOPA 4KOEC 1E2EA 1M6WA 4KQJA 5BVGA 5DN6D 2RARA 2YKGA 4H9GA 4HN2A 4Q16A 3TQIA 4F2DA 1M0EA 1NT4A 4P58A 4QEDA 5SZIA 1AX9A 3AY3A 1RAIA 1E3IA 3ROZA 4KLNA 1F2DA 1GFWA 1WSDA 2PS3A 3NXKA 4FJ1A 3F3MA 3LUFA 5DGHA 3VPGA 1NF9A 1PV4A 1G2PA 3IL2A 2QN7A 1D2EA 1FVFA 2NXNA 1HDEA 3ED1A 1GRQA 1EUDA 4GVPA 2WPDA 1G64A 2IHBA 4A7PA 4QBKA 1R0RE 1Q7BA 3MMNA 3BYZA 1KNQA 4PBTA 4XZ3A 2VSOA 2D1TA 3E0QA 4LDAA 5FUYA 2PGIA 2JARA 4XYBA 3TTTA 5EJEA 1JTFA 1TU4A 4O4HF 2CVHA 3HCOA 1Z28A 3NX4A 2WYOA 3OAAA 2CBGA 5HCNA 4LMAA 3WL6A 5J2UF 3KUUA 1EX1A 1UZAA 2FFQA 4F4CA 1B1AA 2OK7A 2R8EA 4R9SA 4K2HA 3TZ6A 3O3NB 3SZLA 3LLSA 4DMHA 1VJ0A 2YN4A 1E5LA 3BSSA 1AD2A 3SOPA 3WRXC 5KVSA 2J3IA 4KGVA 3WXMA 2W6IA 1NXWA 1VI6A 3E05A 1D1PA 2GVDC 4QTTB 1GVHA 3FKJA 2OXTA 3UAWA 4D5EA 5CVJA 5LMNB 4KACA 4RGQA 4FDUA 2ZSFA 4L5AA 5FA5A 3TAXA 3G59A 1H5UA 2Q5OA 5EP1A 5JXGA 1U3DA 2EW8A 3KP1A 2CFCA 1XLUA 3IEKA 3KR9A 2LR0A 5HM6A 3DE5X 4B7CA 1T2DA 4L73A 4N7BA 3ZU2A 3EXFB 3NKFA 4JZKA 1G55A 2GARA 3QEKA 4JFAA 4QA9A 4TLBA 1VJGA 1S0UA 1U0NA 3ZZTA 2IHTA 4V0KA 4UPEA 4ZCIA 4HO1X 1E9AA 3PT5A 4EFDA 5EJ5A 2C2MA 3HBLA 3ODGA 4GMFA 4CIVA 4Z1MD 1H9BA 1JHQA 1WTAA 1XL0A 2OCAA 1ISIA 2QLFA 3HYCA 4LKOA 3EN0A 3K05A 2OO7A 3GRYA 1UKVY 1WUKS 2O8EB 4LY9A 5F5LA 3E0XA 1T9AA 3ZBUA 5JS8A 3P1JA 1V1RB 4QWMA 1ZDMA 4J16A 4QTXA 2B35A 4RIIA 1Y4UA 3PSHA 4AUNA 3H42B 1SCQA 3C8UA 3CIFA 5TVGA 5FUBA 2J30A 4JQYA 5HSGA 4FCVA 1O96B 3SJCA 4JN6B 4JJ7A 4K0RA 4BBZA 3KDPA 2CVPA 3KTFA 3S2FA 1NLUA 5CG2A 1X9GA 1EUQA 1QHYA 1DJQA 1RXUA 3MWEA 3ZHVA 3ASUA 3HXKA 4MYRA 3WHKA 4OK3A 2IU3A 4AJNA 8OHMA 2HKIA 3D3EA 4Y6LA 2I2XB 5IJ9B 5NULA 1SWVA 1TIKA 1VLMA 3FSRA 1PG2A 4QECA 4YLEA 3F8WA 3H11A 1R3DA 3SBDA 2BUAA 3M1YA 3UB4A 3WKCA 4RZ2A 4V0ME 3RVPA 1E3QA 4D3DA 4MPDA 4QTZA 4DDTA 1CS0B 3TQFA 3BJIC 5KOJB 3E9ZA 4C06A 2ZT5A 3GD5A 3D5EA 1RBQA 3OEHA 2QR2A 3ZIDA 3KM0A 1AGXA 2O4UX 3HHEA 2X9QA 3T0IA 1LY1A 1SZDA 1I1QB 1NFRA 1HH4A 1DTWB 4M60A 2IE0A 3NWBA 2ZYVX 2ATXA 1ENZA 1L5FA 1QGZA 4HFMA 3B9PA 4CGYA 3QVMA 1PKEA 1Y3AA 2C9MA 3MC1A 4G4SO 1L8QA 1T4MA 2RIPA 1IBMB 2QSJA 4KDEA 1KRWA 3O4HA 3TUIC 3T3NA 2IY7A 1NQTA 2HQSA 2J9GA 3OKPA 1FBNA 1UKBA 5AI4A 1Z2CA 3RNOA 3WFIA 4A8TA 4AF8A 3VNSA 4KPEC 4QYXA 3OQOA 1YQEA 3G7NA 2GBPA 3GEIA 4WI1A 4JYPA 2P91A 4CI9A 4UTZA 1Y33E 2V55B 3M4XA 1RPZA 1UBNA 4BZWA 2P2LA 2B92A 4O02B 2VUTA 1DSSG 1VPLA 1JIJA 3L84A 1EK2A 4HAWA 4GPAA 2IELA 5AM5A 1GL6A 3EBOA 4FNOA 2NXWA 3B1VA 4P08A 1CY6A 2BF4A 3EC1A 3VR4A 2V6MA 3QTBA 3G5AA 4DZTA 3M8KA 4I55B 2NVOA 1Q21A 3AVUA 2ECPA 3I52A 1U6IA 2X0DA 2XXJA 3HDTA 3SZOA 4EYEA 1JQDA 4R41A 3ZVLA 4X24A 3E2IA 1D5CA 1KETA 2WJZB 4DUPA 2DWOA 3GRVA 3U80A 1AH2A 4XVHA 4MWSA 4RKRA 4UQPA 3V9AA 4AJ2A 4XI9A 5EE1A 4WBNB 1HY3A 4PICA 3X1MA 4B83A 3VXKA 2XA2A 3GEHA 3OCWA 1OXVA 3PXCX 3SWWA 5B3JA 4E4YA 4ONEA 3UAYA 2VXYA 2EHDA 1PHPA 4YJHB 1GDHA 1AGPA 3CG4A 4WUVA 1B6TA 2ETXA 5LBUA 3GFFA 1H3FA 4MSUA 4JLDA 4LJAA 2BGWA 1SU6A 2JKVA 2LTAA 1KI7A 1A3CA 3RFCA 3L6UA 2XMSA 4ZD6A 3ZNNA 4NONA 1GKKA 2DHEA 1M0SA 1IY8A 1EQ2A 1HQYE 1SUEA 4NBNA 2AQ8A 4WK2B 4E1VA 5GV7A 1O9HA 5BQPA 3IDQA 3NKVA 4DS3A 3U13A 2FVXA 4UM9B 5KVVA 3RKRA 2GSDA 1NF3A 1NHWA 1ZK3A 2HFJA 5B53A 4DPLA 2A35A 4PQRA 2PRJA 4EYSA 1E98A 4EG7A 2MR5A 3RYFB 5H7XA 4EG8A 3DBLA 4UOZA 3L7IA 4NTZA 1JAZA 3C8HA 1V6SA 1ZXLA 2ZJFA 3ZV6A 4YR9A 5HX7A 3ESAA 2FZ4A 3LSYA 4JLMA 3UTCA 5JH7A 3HA3A 2GO7A 4R8RA 4V0RA 2EQBA 4UTNA 4DC9A 1P72A 2ZRPA 4FGLA 1ONBA 2X5NA 3HCEA 4EF6A 4OBXA 2OBLA 1L7NA 2JBHA 2MYPA 2C3UA 4RCYA 1V6CA 2J32A 2GHIA 4IINA 1EEHA 1KYQA 3ILHA 3ORHA 3C5VA 4MVJP 2JLVA 2QX6A 1ZCJA 1FDWA 3MTGA 3UG6A 4CIBA 1E2HA 5A2GA 4TWIA 3SR4A 2UZ0A 3L8DA 3A31A 2I71A 2GAJA 1O9GA 1GARA 5CNJA 5D8DA 4MKXA 3GRKA 4G0VA 4KPYA 3ZCRA 1PTKA 4W1SA 2E3JA 3AETA 1MIHA 4HFNA 1ATZA 1CUUA 2HTEA 5F35A 3UK2A 2I67A 4L0DA 4DRZA 5KMGB 2O57A 4N0PA 5JSFA 3H2IA 1KYIA 4I50A 1PO7A 4IGFA 4KO4S 2XJ4A 1A69A 4ZAWA 1L5NA 3OWOA 2QTBA 2D0PB 5K3SA 4AFNA 2XMZA 3KKKA 2GEDA 4YXFA 2OFXA 1Y5IA 4NJEA 3V1UA 2REQA 3GUHA 2OHGA 4LAFA 4ZAXA 1N57A 3ZXXA 5LJIA 1FU7A 1RYBA 4J91A 1KQGA 3HB4X 4C6SA 2BC9A 2OMEA 1W96A 2BR4A 1X7YB 2EFDB 4BX8A 4TVKA 3D1JA 1UMCB 4XWGA 4DTIA 2PA0A 1Z26A 3BMCB 2I87A 1F2TB 3LPAA 2LBPA 2I3DA 5I4BA 5HS6A 2VK8A 1N0IA 1Z4JA 4HJRA 5J2TF 3R7WB 4BV8A 1JHPA 5HW0A 4HP8A 1OWMA 2E89A 4IUCS 1DAHA 1W4BA 1TI7A 1FFDA 1ZS9A 4MITA 1GITA 4MS3B 3EG9A 4CQMD 8AT1A 3HVRA 1GGMA 2R2GA 3D0QA 2PD3A 1P29A 2B6HA 2RBKA 3LUBA 4ZVLA 5FYDA 4TS1A 4HV4A 4YWJA 1YZQA 4PLPA 2FPSA 2ISCA 1NQUA 4RV9A 1NJ5A 1UODA 5BR1A 2QPOA 4LX0A 1WVMA 3L92A 4J3JA 2BCGY 4LWQA 1CP3A 2QM7A 3TH5A 3PDIA 3GBSA 2I66A 3H1TA 4BNFA 1GPUA 2C7GA 1YR1A 1RXWA 1NUTA 3N7UA 1SGWA 2H2FA 2JFGA 4TLEA 3QPVA 4RELA 4BLQA 4X9XA 1ZFNA 1EZZA 1S8FA 1ONPA 1Z5PA 2W83A 1V4BA 1KOLA 3OHMA 2FPWA 1NZJA 1T2NA 1XAGA 3KTDA 4BNNA 1RKQA 4CL8A 2BFMA 4TWRA 3OKFA 1PYDA 2C9DA 3MQ4A 1ZESA 8ATCA 3RS2A 1O57A 1RWXA 2APJA 4L22A 4RHXA 1DXQA 2Y1GA 4YHHB 4CEJA 3TGPA 4ARUA 4GBED 2J3DA 1QP0A 1J2RA 1VZ3A 3ND6A 5LQRA 2DTDA 3NRCA 1EG2A 1IN5A 1N5JA 2BGMA 5CX4A 3UF0A 1ULHA 4R40A 5A03A 4AZ3A 3RM3A 1XQXA 3WYAA 2HJSA 1II8A 4JLKA 4B44A 1QU3A 1LI7A 2GERA 2JAWA 4O6VA 4ZEOA 1I2AA 1SCKA 3WS7A 2IXEA 2G06A 1GT91 5H82A 4DSZA 3EE6A 3HEMA 3HNPA 2XQFA 5E2IA 1PLLA 4CVNA 3A06A 5HRAA 4FSDA 1V35A 4IFEA 4XPIB 3U2QA 4OHMA 2C98A 2F7SA 4H18A 1V48A 6AT1A 1A1VA 2VRBA 1RP1A 4B40A 5CH5A 3TECE 1WQ1R 2VDKB 1N1DA 1PL8A 1UQTA 4KCGA 4NH4A 3ZI0A 4BZXA 3JAKB 5CCDA 2JLZA 1Z35A 3KKEA 3P9CA 3CKKA 1IBKB 3DBRB 3Q3HA 3DXFA 3IB3A 2H57A 4RTSA 4C43A 4OJMX 1JHDA 4JVLA 5D84A 3ZJTA 3GEPA 5HIIA 3C6KA 3HWSA 1YU9A 3PC2A 3ROPA 4NU5A 2VEOA 3VH2A 1X8XA 1NLYA 4LFBB 1Y81A 1U94A 4JBIA 4NK5A 4R2LA 1Z6YA 4YONB 1NLMA 1J2UA 1XXHE 1XZLA 4LBYA 1HXHA 2X8JB 1Y63A 3ELBA 2NAFA 3DPSA 1EDOA 4PHGA 5B58T 4QLOA 2R6CA 4Y9RA 2PGJA 1DBQA 4GKBA 4JOSA 1FVXA 1IHPA 1U9CA 1YKGA 2AN9A 2I55A 4JDPA 3PGXA 2BE9A 5FWYB 1NVTA 5TNXA 1YS6A 2Y77A 2QZSA 2VF5X 3K4QA 5HKBA 1P0FA 2QTVB 1DFHA 1HG0A 2NYRA 5TMBA 2HJ9A 3QE4A 1C7EA 3QF4A 3U4MA 3WK7A 4MXDA 2JIOA 3A11A 4E4TA 1UC5B 2P8SA 4TRMA 2Z8YM 4P83A 1I80A 1YULA 1JVSA 1Y3BE 2ZUEA 4L6AA 1CJVC 2GM3A 4ZAGA 3ZV7A 4EUKA 5JZBA 2CLKB 1PLKA 3SMVA 2AVNA 4RIFA 3TOCA 2PWPA 3HBMA 1KXZA 4DY4A 3R5SA 3CISA 1RJFA 4ANFA 1PNVA 3EPRA 3WY9A 1XD2A 1KO7A 3VR3A 2BEVB 1GCIA 2HMVA 3AQIA 1YB4A 5ALRA 1ZH4A 4C6TB 4ZYUA 2J0UB 4L51A 2VUSA 1WXEA 4KFSA 4EGQA 3EPJA 1OLUA 4PIMA 3OJFA 1J00A 2WMYA 4FHDA 3AOGA 4YAFA 3GUZA 3RAJA 4AJJA 2KB0A 2JIZD 4FYYA 2F3PA 1A27A 1QHIA 2A78A 5G4LA 3HZOA 5D5QA 5C8DA 1EX6A 1AS2A 1PBTA 2XEXA 4W8HA 4Y9TA 3RARA 5JPCA 3C1AA 1G0OA 2FN9A 3ZCVA 1HURA 1INLA 1NIPA 3ZV4A 2PXXA 4MYUA 5DWDA 4JL8A 1E7QA 2QX9A 2WVAA 4Y0NA 4ZT3A 4CIWA 3EIEA 1VRWA 3VJKA 1ZOPA 3BEDA 1E3TA 3MW8A 5CX1A 4OGGA 4RULA 2AZTA 1NAIA 3COSA 3F4BA 1DKQA 3TEJA 2VJOA 5IMSA 4MQEA 2FA9A 5KTPA 4MUJA 4CKYA 3W5CA 3IVGA 4I8DA 2VAMA 4M6WA 3WNVA 7REQB 2F4VB 1RXVA 5I9BA 3PE4A 4Q4JB 5JZMA 5AQEA 4GGMX 4KMMA 4R3NA 4M76B 4V0SA 4CG0A 1KZ9A 1Q19A 2BH2A 4P32A 2VYNA 1GTMA 3GHYA 4S1NA 5ALZA 5ENZA 5AVKA 1KBOA 1MZVA 2GZSA 3G13A 4EY3A 2HRDA 2O3RA 5LNK1 2LE0A 2UVDA 2NU8A 3SXUB 4Q82A 1UC9A 4DLYA 1EFRD 1EKXA 1YNSA 2X0RA 2CNNA 1UK9A 3IX7A 5THQA 3WBJA 3ZW8A 4C1NA 1A7JA 4PPNA 2PQ6A 2CHEA 4N5LA 2N9UA 4RJKA 1P9WA 2FG5A 2XBMA 1P5HA 2IC5A 4Q7JB 1ZW6A 1PK8A 3OZFA 4JX9A 3RABA 4ZJZA 5AJHA 4HLCA 4XVRA 1IHOA 1VLLA 4LDNA 1D7OA 1UM9B 2JIQA 3GD7A 3MZ0A 4C5AA 1RSZA 3O74A 4GI1A 1WB9A 3LKZA 5EHGA 2X9LA 1T9ZA 2XCUA 1H65A 3B6KA 3PYLA 3SQOA 4HNGA 3STWA 3TSAA 4F5YA 1ZSVA 3DNPA 3KZKA 1V6AA 3AP2A 1Z6GA 3NU1A 1RCUA 1T5DX 1ZP6A 2XYRA 3H3FA 1YASA 3HGMA 3NHYA 1HYGA 5BN5B 4F3YA 4ZJUA 2PJZA 3ITEA 3GLFA 3PVZA 2GZRA 2WIAA 4I8IA 4LSMA 3RANA 1OLSB 4A8HA 1KEWA 2QT1A 3HY6A 2H92A 4C7BA 1NXOA 1QIIA 4NE2A 3W77A 4ZQFA 3H18A 1ZN9A 4PX3A 4PN7A 4Y6OA 1GZSA 3ST7A 3NLLA 4F6LA 3F97A 3SZRA 4MULA 5CT6A 1BIFA 4CL3A 3OCXA 3QVLA 5DNUA 3FSJX 4IDAA 2PUAA 3K6SB 1W34A 2JHGA 3AXSA 2FTKE 2O52A 5JS2A 2QSZA 3B3AA 4TQ9A 1Z36A 3B48A 3NHUA 3R5JA 2I8AA 3EXG2 4CLEA 3TNYA 1A8HA 1R0XA 4WKOA 1Y8ZA 4JUFA 2CL0X 4RK0A 3UMBA 2D7CA 4TWBA 2M6RA 1QCZA 4O08A 5AVXA 2BZ0A 4PYOA 2XZLA 3FXAA 4UFNA 3L1KA 3BGOS 1M6HA 3DZHA 4G5YA 5HGJA 4MROA 2NV6A 4EG3A 2CVOA 2Q28A 3G8DA 1T9GR 3EQ2A 5L4SA 1PZNA 3HCBA 1QZTA 3OLCX 2UVQA 4WPGA 1J8QA 4XYGA 3WWZA 4BBPA 1OYWA 1TT7A 2PMBA 2BFFA 3IUBA 3ZCTA 4OUDB 2OCYC 2PNFA 4KXXA 4R1OA 1IWPB 1O6GA 4EY8A 2BSXA 2P69A 3QUBA 4I9HA 1SA0A 5EAIA 3GV0A 1J22A 1NQ5A 5GGXA 4B84A 4DV2B 1DUSA 3MJSA 3QELB 5HQ3B 5LUBA 4JI4B 2F43B 3FCSB 1N6RA 3WHIA 2DR2A 1TGVA 1XZDA 1U80A 5BMVF 1R9NA 2G9VA 1RTKA 2V58A 1ANKA 1OCEA 3N2ZB 3QOYA 3U19A 1NG9A 1KZ7B 2QTTA 4Q6BA 3LBFA 4AMGA 3OF2A 1EPUA 4AN0A 3G9ZA 4YMVA 5JXHA 5AK3A 1VCHA 5F52A 2GHRA 4CMKA 1ZMTA 5FL3A 4C0WA 1VPEA 1E9EA 1QO9A 2AC2A 4X64B 3TJZA 1K2VN 3ZDDA 1JQJC 3DL0A 4FC6A 2O20A 1G21B 1C4XA 1XL1A 2UZAA 5ABPA 2W58A 5AOBA 3RSGA 4Z2AA 2O23A 3MAJA 2II6A 3N0TA 2NG1A 2PRKA 3PFKA 4P93A 5E6SB 5JLAA 1SEVA 2NUPA 5CB4B 5F23A 1V8DA 3ISVA 1TO2E 3V00A 1K98A 1E9RA 4RH3A 4N3BA 4DMMA 3NAQA 1DO2A 1Q92A 1R66A 3ZQ4A 4B87A 2VHWA 3MHPA 2G5PA 4MUKA 1L7QA 4ZXFA 3RRBA 3K2EA 1II9A 3HGTA 3I58A 3VX3A 4AS3A 4EVRA 5BRAA 3LPMA 4PXAA 1QRRA 3DKPA 3RG8A 3LECA 2R65A 5ED4A 2QQ0A 4DKXA 2OD9A 3GLSA 5JJ5A 1SUSA 1WHSA 3MGBA 3W9YA 4LBVA 3VU3A 4KR2A 2E48A 3K8QA 3MWFA 3CURA 4S35A 3JRNA 1XEFA 3UFXA 4YCLA 1JA9A 4P7GA 1JHXA 1VE5A 1TJPB 3C39A 3LKVA 2TMDA 4I14A 2HV8A 2HPZA 3EBPA 3ZH2A 3W6OA 3Q7SA 1YWGO 1KI4A 1YZVA 4E33A 3ILYA 1DRVA 3K8OE 2AXQA 1P2BA 3Q5EA 1LFAA 3RYCB 1E77A 2B7BA 3GAAA 2V0GA 5AJUA 2NO1A 3DOUA 4GD3Q 1KI2A 3PKIA 3CZRA 4CR7A 4RZ3A 4BNYA 2KSQA 3KWJA 4XTRA 3AFNA 2HEIA 1YZGA 5J9FA 5KREA 1JXOA 3FTCA 3RTDA 2A0WA 4ND5A 3VUEA 2B1GA 4I1OA 4RF4A 4HSGA 4TROA 4LV8B 4MW6A 1CR0A 1R0KA 1G3MA 1KVUA 4LRWA 2WIDA 3JATB 4ZQEA 1QCYA 2F1JA 2JJ1A 3F6EX 3O4VA 4KFUA 3F5QA 4PGFA 5CRIA 5BUCA 1L7RA 5A5GA 1NOKA 3KVVA 3MERA 1XN1A 3KKMA 4PU0A 5A0TA 3BGVA 4QUBA 1IOVA 5AVSA 3MCWA 1H2EA 4IYJA 4JYBA 3ETLA 4HH1A 4EPWA 4HBGA 4ER6A 4S05A 5EIWA 3WIOA 1SOVA 5JZSA 3OQHA 3QNWA 3KJFA 2SKEA 1QF9A 3STHA 3DV0A 4DMRA 2XUZA 4OYLA 3ZD9A 4PHFA 4B35A 4C0HA 4ZOAA 2WV9A 4YEDA 4K8RB 5L7TA 4WK4B 5DGDA 2ZXUA 3O91A 3CUEF 2J3KA 1NNLA 4ND1A 2CDNA 1GD1O 2CNWD 3LY9A 2VDMB 2UZ3A 1PS0A 3P9IA 4QG7A 1CUSA 4OIFA 3V46A 3GA0A 5LOVA 2YN0A 1RFGE 2QWXA 4ENWA 2IYAA 2QVGA 1PR5A 2V7EA 1RQ2A 2XCIA 3BIXA 3DWFA 2PL1A 3PHCA 2VNIA 4KLAA 3AVYA 3PIDA 2JHPA 1HOXA 3KXPA 4Z1MA 2QD2A 2PKQO 4I4NA 1KARA 4D8YA 4O2BA 4RM3A 1S3SA 1VBFA 2JRCA 2QZ4A 2XVAA 3SIWA 3C85A 1S8AA 3G2NA 3MTEA 2PLAA 5JD3A 1ZOOA 4R1SA 2AN3A 2V9PA 1M34B 3BMOA 3M49A 4EA7A 2O8FB 4LKRA 3UPUA 2DH5A 5KJEA 4CNBA 1WU8A 3VTZA 1YJAA 4DA4A 5AM0A 2KPOA 4IG9A 5DTJA 2ADOA 4C9BA 4EI9A 2I6UA 3VVBA 3JTEA 4OJKA 3K0AA 4NBVA 5EC8A 5JPIA 1OD6A 2M6KA 1P0CA 1G4HA 3D4LA 4KZPA 2JLSA 5LSAA 4TWZA 3WE7A 4JC4A 1H5QA 5AYVA 1RHJA 4UTRA 3AVWA 1Z3IX 4IDQA 5EKSA 3OZCA 2OZLB 3TYXA 1TZBA 5DPMA 3KSDO 2ZUDA 5KYWA 4J2HA 1C81A 4YAIA 2PT7A 3OWHA 2WTMA 3RJ9A 5C8ZA 4M0MA 3CNHA 1NE2A 1QGAA 5AW1A 4YT2A 4TS3A 1CE8A 1SHZA 4JIGA 4UKDA 1MFPA 2YRWA 5JR3A 4D9IA 3A4MA 4CKCA 4XVQA 3WZLA 3H19A 5IKOA 2JCBA 1ZD1A 3IDFA 3LQRA 3TSWA 2A9OA 2PUBA 3TXXA 5E1MA 2OR3A 3IMGA 1W5TA 1CUEA 1HF3A 3L77A 3QEMB 5CFLA 4U6NA 1RKVA 4DA0A 1OPRA 4AZWA 3D4NA 4M1SA 2J1LA 3X1YA 4YUAA 5FBVB 1X80B 2HHHB 2ZBVA 5LQUA 2XNDA 4G0MA 4HDRA 4YV7A 2WSIA 1YS7A 1CV2A 4EHDA 3WHPA 4ALLA 4K9SA 4HNQA 5TQVA 4LMPA 3HXOA 2RHOA 3OPMA 4QM6A 1PEDA 3FKSD 5K3AA 1F06A 4M8SA 3BFXA 4ZI3A 3DMTC 2IODA 3OD1A 1GJRA 4WN3A 2ZRJA 4ZO9A 1IWBB 4D02A 1HNWB 4GP7A 4F5DA 2QPAA 2OBNA 3EH2A 1UM8A 2Z5FA 4WJZA 3E61A 4H7FA 3INRA 3PUHA 4JA2A 1L3BA 1LJLA 1FTNA 4CFSA 3K35A 3ZNQA 1GG9A 1WKVA 1GRCA 2BKXA 3DWEX 3FW1A 1Y8QA 3T52A 1UK6A 2Q6KA 2QZJA 2X41A 1ZVJA 3H13A 4QBTA 3TLXA 1SUCA 1B0AA 3PFHA 3QKIA 4RHTA 3F8TA 4WY2A 1RRVA 1QNFA 5E7QA 3OSUA 3EW9A 1MH9A 1T5LA 4LBWA 1NI4B 4TV8F 1K5DA 5LUAA 2DMRA 1NSFA 1B43A 3K73O 3KQTA 3H2ZA 3DUFA 3WJAA 5I45A 1QDLB 4JJEA 1KH1A 1CIPA 1N2XA 3RVRA 1RKBA 3HVHA 1ISRA 1E2FA 1U7WA 5I5EA 1QB7A 1V1MA 2IKQA 1JN0A 2GZ2A 1YVEI 2ZTVA 2AFIE 5JNWA 4MP3A 5DEOA 2YVLA 4C21A 2VH1A 4JQZA 1GNPA 4IICA 4FB5A 3R3VA 5KDOA 4B79A 3G0OA 5B2EA 3EQ9A 5BUSA 4TV9B 3TUJC 2DG2A 1X1BA 3H9CA 1XLVA 2XTMA 4BN4A 3BD7A 3A6DA 1CLUA 4LYJA 5E0KB 2PU5A 3T1NA 4PLWA 4OQXA 4RPCA 5K6AA 3BORA 4N39A 1GEGA 1WUJS 3UW3A 5DSTA 4A23A 2FOLA 2IZOA 3D8RA 4Q6WA 1EEXB 4FQ7A 1SC3A 3DHWC 3MJFA 4KUGA 5BSRA 3UUWA 2E1RA 1FNCA 4L5IA 5MHTA 2N47A 3HH8A 1NRXA 1ZUIA 4ARSA 2A57A 1JHVA 2YVKA 3P2JA 3QXSA 2I8CA 4MRSA 1ZJJA 5IP5A 3L04A 3K0BA 4YP6A 3RSZA 4X93A 1E64A 1JZTA 1UZMA 2EJTA 2G72A 2VJQA 4UNNA 4DIMA 5EHZA 3HKBB 4HMQA 1R8XA 4FX2A 3A1SA 4NYJQ 1C8LA 3USCS 1MP0A 3F6PA 3R8FA 1YO6A 1GA4A 3QE9Y 1ILEA 3E8SA 2W71A 4BEVA 3ITDA 1C2YA 3IP8A 4PEVA 3PA8A 1JKFA 5EWMA 3O47A 1X9IA 2ENUA 3CJQA 3RAGA 4EH1A 1E3MA 1BVYF 1EX7A 5IT9A 1JQLB 1K8XB 1JPNA 1EP1B 1AT1A 2XODA 3CNEA 2Q4DA 4HDSB 2J5QA 3I8XA 3KVRA 3L8HA 1F0NA 3JU3A 1PR1A 3IUNA 4O2RA 3RIMA 1H2HA 2X1LA 3WO0A 4F1KA 1BC5A 1D9XA 1PI3A 4GVXA 4MPTA 1FC0A 2C2WA 2WE8A 3JQQA 5K99A 4WGGA 3WWDA 4XA8A 3WYEA 2D59A 1NW7A 1Z82A 3R9XA 1ISHA 1T1EA 3O2NA 1JXAA 2AWOA 2HAEA 2W43A 4MGKR 1T5OA 2C4NA 2H3EA 3OKCA 4MVJE 3WIUA 4X41A 4ZGBA 5BSVA 5KTTA 1TRHA 3I2YX 4I08A 4DHEA 1BQ4A 5CDUA 1F7VA 2J9FB 2W37A 4GC5A 3C8ZA 1OIVA 3DYVA 3DOFA 1KAQA 4FDTA 4RCVA 2VLBA 1U9YA 1F6BA 2QUAA 3N7TA 3K1YA 4H1UA 3GXOA 3QVWA 3VR5A 3VTAA 3CNNA 2R86A 2VNAA 4TM7A 3WL4A 4LE0A 3HWWA 2D1QA 1SIUA 3GFRA 5ERGB 2Y0DA 1GY8A 3DYBA 3MGAA 3PVSA 4LJ4A 3AIIA 4MRNA 4UOEA 4MUHA 4BJ6A 5JD5A 5BY2A 3GJ5A 1W5BA 5EG5A 2QTWB 3CPHA 4KWCA 1KEVA 3EVGA 4Q3EA 1DCKA 4RK6A 1GAQA 1DJOA 3PWSA 3I2IA 4FDVA 3UCXA 2OCIA 2FMFA 3FZYA 3KU1A 3E3OA 4QOHA 3LVFO 4IVRA 5AKEA 5ADWA 1JDVA 3D2LA 3SP1A 4DM3A 1E3WA 3NASA 1Y80A 3JZFA 5I7RA 4OHPA 2W6PA 3WXBA 5HM8A 2XB2A 3WLJA 1PBNA 2COEA 1LB1B 1FDOA 5GOTA 3I9NA 3W2IA 3VR4H 2BEUB 1CG6A 2H5IA 2ZUTA 5HK9A 4B73A 2R2AA 2ZB8A 3K5PA 3DFZA 3U40A 1QH8A 1VGVA 1KEZA 1OJLA 1U1IA 4W63A 3FVTA 5CM9C 4MUIA 4JLAA 1YIOA 3AR2A 3TOXA 4Z99A 1GXSB 2BD0A 1WF6A 1I7PA 2P9QA 3I0NA 4RF3A 1DCTA 1FYVA 3BFPA 1KMIY 3OY2A 4M1YA 4RABA 3ZWCA 2GK4A 4LHXA 3DT8A 3FNGA 4ARAA 4MB6A 4HLQB 5AKHA 5G3ZA 4XRGA 3CLTC 1HE1C 3EW7A 3F6YA 4TS4A 3OM0A 4BGVA 3E58A 5GMOA 2QENA 4DUGD 3GO4A 3WTBA 3PP8A 2CF5A 3S2YA 4R71A 3AR3A 4OMFG 4RK4A 1ZK4A 1J97A 2CKDA 1CX9B 4FCTA 4BKQA 5EYPA 2WFAA 3BHNA 2IOFA 3PDJA 3N6VA 4C87A 1MDBA 1VKNA 2F59A 3IHTA 3A8TA 4G2NA 4U1RA 3NC4A 5T4FA 4RTMA 3SS9X 4HPJB 4RX1A 1V95A 5DXFA 1SBTA 1M2OA 1SUPA 1CUHA 2VYFA 1VKRA 2X7JA 4QGGA 3VR1A 4JBLA 2Y05A 2YRFA 2FN3A 1JEAA 1V1RA 1DRKA 3EUWA 3GK3A 3KB8A 2QA5A 3L7AA 4NFSA 3RHTA 4WWHA 1M1ZA 4HGRA 1JR3A 2NUAA 3I6MA 2LP4Y 4KXMA 4NKRA 4Q93A 1ZR4A 5F1YA 3FOFC 2UXCB 3QI2A 4I1IA 1YQTA 2C03A 3FDXA 2V6JA 3UVEA 3WFJA 3MB5A 1U7DA 2VDLB 4MGHA 1KMHA 3DXZA 4PZZA 3WLNA 3WLQA 4RJTA 1BCSA 1W4ZA 4Q7QA 5AQ1A 3IPCA 4AY2A 2IYNA 3UUGA 5BW8A 2ERXA 1USWA 2WU4A 4HXYA 4L9AA 3BB3A 1G6Q1 2V0NA 4CETA 4IFIA 1L5HA 1R5OA 3DZGA 1W2HA 3ESRA 3E15A 1EJBA 1G8SA 5A71A 3ZU3A 4A0GA 5A4FS 1SOUA 8GPBA 3C43A 2ZZKA 1CS0A 2EFGA 5GJWC 5KOJA 1KK0A 2A9VA 4F97A 1EFAA 4B7XA 4Z3OA 1JHZA 3H4TA 1Q1EA 1IZ7A 1DIOB 1R4NA 2Y4NA 4EJ6A 3HVIA 1U0SY 1DC6A 1BA2A 1JV2B 1R9JA 2RHJA 4DMLA 1VRCA 1CUBA 2BBSA 2JCVA 3FVWA 1BGXT 3DZ8A 3M2TA 3U3JA 1O97D 1WNFA 4HEHA 1FJ2A 2AN1A 3OKAA 4Q7MB 3GCXA 5AKIA 3RT1A 3UM9A 5I9NA 3PXXA 2JDID 4EYGA 3AP1A 1LBEA 2DHCA 4M8IA 4JOBA 4U2KA 4FJ2A 5EP4A 7YASA 2WHEA 1C0PA 4QYIA 1K92A 5BSTA 4YCJA 1SOMA 1A9YA 4AJKA 2QZZA 2CLDX 1QQ7A 2Z4TA 3N07A 3RIEA 2GAOA 1IY9A 4RCZA 2EJVA 4ZI5A 5BSFA 3L6RA 2FZWA 2R8PA 1QQ5A 5AKGA 1DKOA 2QTLA 4FWIB 3T5MA 3IIMA 3G0GA 3AKZA 2HXSA 4US1R 3ZBTA 4D3YA 1OXUA 1U7XA 3AWIA 1CVIA 3K9LA 4JLBA 5L3RA 4FNGA 1A7KA 1OQAA 3HSYA 2YICA 4C04A 5AVZA 1YHYA 1IH8A 1EG7A 2Q9AA 4H15A 4NOJA 3VNVA 4JR0A 1YB5A 2Q3DA 2WIFA 3D02A 1XPUA 1M73E 3AQ4A 3NETA 2VP9A 3OZBA 4EF5A 2C5LA 1BHJA 1HYHA 1VL2A 4IRUB 1QRSA 4N76A 4CG1A 1L5YA 2PZEA 4G5FA 4L2IB 2X77A 4YCBA 1I3KA 4HB3A 5HIAA 3KSBC 2E4XA 3RTCA 2OPHA 3S1SA 1T9KA 3I01A 4F5ZA 4BFUA 3SHWA 5FUQA 5IC6A 6ADHA 1D3AA 1RJWA 1LLDA 5J5AA 1VKOA 2I2DA 3QU5A 4EKGA 4BVEA 4MAFA 2GN4A 3Q7TA 2FPPB 3H97A 1P1HA 3PHGA 3VI3B 2WFMA 3ZDXB 5HYVA 1S2MA 3WSWA 4LVOA 4JV5B 4G1FA 3GDOA 4QQFA 4CMCA 3TFQA 4BKUA 1O5IA 4PBRA 2G4VA 1Q2UA 1KC3A 3MBKA 3NDIA 4MW9A 4IIGA 4KFRA 3UHAA 2ZVPX 4M0EA 1HNZB 3RSSA 1MKYA 2GD6A 2ODNA 2QIPA 2VDVE 1X42A 3H6HA 4TSFD 2VG8A 3IHWA 2JHFA 1Z63A 3L1VA 4EUHA 4LGVA 2IFTA 3DVQX 3QLTA 3L82B 1R50A 3OI7A 3A58B 4EJ2A 1P81A 4PRZA 5CA0F 3U44A 3OT1B 3PE3A 3VR2D 2GXAA 4AMVA 4GZ3A 1OAAA 1GQFA 1UDBA 1BKDR 1K8ZB 3KB1A 4PX5A 3KB2A 3RRNA 3TI7A 1DBVO 2C5HA 4B3DA 2HYIC 1F0PA 1DJMA 3E5HA 5TPWB 3GOQA 2RK3A 5HF8A 4BYGA 1T1RA 2PGAA 1P19A 2HDHA 2GYYA 4QHSA 2EW2A 5CBPA 1KTVA 4EUFA 1U1EA 2XOKA 3SYLA 1PSDA 4ARBA 2IPLA 2R79A 2IHVA 2DCUA 4IVNA 4P53A 2JHCA 3P7MA 4UDOA 4DNQA 5KKAA 2W2VA 5HIMA 2HNBA 2CE7A 3EEIA 3HSSA 2X4DA 4LECA 5J2UA 4IDBA 1KYXA 3PYMA 4WECA 5T4BA 4YJGA 3FNEA 2I3BA 1IBLB 2PAAA 1TAHA 4PR3A 4QX6A 4NMLA 3SPXA 4ZARA 4EUSA 3L8EA 4QUEA 5K3OA 1DBRA 3THRA 4FKMA 2JLXA 1F14A 2BHRA 3AEXA 4B71A 1ZI6A 3OURA 2B61A 2BRUC 4MQ6A 1QH1A 2EJCA 2EL7A 3GAZA 3NB0A 3GLQA 3LP5A 1N32B 3EWIA 4M0UA 1M54A 1KAGA 5H1YA 3SJAA 5TGDA 3GJ8A 3IV9A 3QFFA 4BRWA 3C5CA 5IKEA 1PW5A 2DY1A 4KL8S 2WW8A 1C8BA 4GBGA 4JYZA 4PLZA 4V38A 2ID9A 3MAAC 5FEMA 3ECAA 4UM7A 1G5RA 5FWDA 2X8AA 2O8CA 5I4KA 1C1HA 1TYEB 1Z47A 4WZZA 2NTEA 6NULA 1Z8DA 4ZVTA 1DXHA 1QLJA 3KYCA 4JKOA 2OECA 4LY6A 1F2TA 5E7JA 1DT5A 5DNYB 2VP3A 4PTZA 4GRIA 1NJ1A 1VPDA 3OOSA 1HEUA 3K0KA 1N3IA 1F4VA 4OHKA 2Q0QA 1TQHA 1AZLA 3PITA 3T7TA 4WLVA 1XDGA 3VSDA 4PSUA 2Y1CA 1IJKA 2FQXA 2C5SA 4ED9A 3QWFA 1Q91A 2AW5A 5G40A 5C46F 4A6DA 2EBFX 1CRPA 2I4NA 3GPLA 1ZJZA 4LJ8A 4QFCA 3VR2A 4N5NA 5JYBA 2PIDA 1W5SA 1Z15A 2B4YA 1V0JA 2OCGA 2GD0A 3GFPA 2Z30A 2ZBRA 3DV9A 4JU9A 4NJOA 4XYMA 4RM2A 5IUNC 2VSXA 1MOQA 4MKIA 3GRPA 3SIXA 5AVQA 1YI8A 3P9YA 4Y3UA 5BSKA 3PV0A 4CCYB 1QCCA 3QVUA 2F90A 2AUNA 3O8QA 1OFHA 1CZKA 1VP9A 1J23A 2WICA 1Z0FA 2X0IA 4P31A 1VTKA 3EIUA 3OLWA 1BSVA 4AX4A 4AC9A 4KIJA 4DY6A 3SDZA 2BGLA 4C01A 5AJWA 2C83A 3D1VA 3NHWA 4D4JA 3ZBQA 2JIMA 1XELA 2PLFA 3HU5A 3ZWVA 5C18A 3QKRA 3FCUB 2B3TA 2EZ4A 2XUPA 2ACKA 3STTA 2GCPA 4B32A 1DUVG 2RDMA 4CM4B 3DH0A 4PRLA 4XIFA 1G1AA 4J7UA 4PYLA 3GGPA 3RVLA 3D5QA 1PFGA 5A04A 5BUZA 3CE9A 2E1PA 2OAGA 5BNFA 3T9EA 4IJ6A 3OSZA 1MNAA 5DVZA 3ZYZA 1QFMA 2WAYA 3O38A 3DQZA 4GLFA 4N9QA 1IBSA 5P8WA 4LF7B 2ZI6A 1IDN1 3FF4A 1H0KA 4IDFA 4M98A 1D2NA 4PRKA 4W5JA 1LKZA 3U3OA 2DRIA 5IZCC 2WTAA 2HJVA 2K6GA 2PMCA 5IXYA 5IM5A 1XQVA 2C99A 3DEKA 3B7GA 3H1PA 3ZLTA 2MINB 4WVFA 4ZIRA 2XSZD 3A26A 1P73A 3ENNA 4R9RA 1PCXA 4REQB 4ZV4A 1QIFA 1ZCAA 4WHMA 3H8SA 3EGOA 1U7OA 3O4IA 4NU0A 1W4AA 4D0GA 3ICEA 1FLAA 1XVLA 3ULKA 1U9JA 3G85A 3GARA 4IGAA 4R6WA 1IVNA 4YJ2A 1KWGA 1WDMA 3WYBA 2DR3A 4JR1A 4CR8A 1XEXB 2Z6UA 2RMKA 5EMJA 1VJCA 1X7WB 3QJYA 1JU4A 5D5PA 3NBMA 1YZHA 3JYHA 4L0CA 2QYTA 3HFGA 4O4IA 1QGDA 1P45A 2RHBA 4NCJA 5ECDA 2HWYA 1IZ8A 1U2GA 2XMRA 3DWIA 3CPEA 3NAZA 3QBTA 4RKQA 4M88A 1DS6A 1EFKA 1OREA 5CT8A 2H16A 4X0EA 1PP4A 3V4RA 2G07A 3EVTA 5J59A 4LQLA 4R16A 1S4MA 1GRNA 1EHIA 1QE5A 5KZMB 3UY4A 3BD6A 2CJWA 4MUMA 3K16A 3EGCA 4X95A 1E6EA 2YXEA 3GLHE 4P9NA 2W6ID 3GAFA 1D0IA 4CTOA 1YR6A 4GR4A 2QE7D 2WOJA 3JZMA 4WESA 1RQPA 2QQEA 4Y9DA 2YQZA 5EIBD 3ADDA 4PGAA 3NHFA 3ZLBA 2DEUA 2AJBA 5CDFE 3FZNA 4NFHA 4IUYA 3PT9A 1U8XX 4L6CA 4QSMA 4EHBA 2AKAB 1N2HA 2K5UA 2QRHA 3KOXA 3J7AC 1UJ6A 3RREA 3MCAA 2ZE8A 4KK4A 3ZWKA 4Z3KA 4KNVA 1G7RA 1GLVA 3TFOA 4HDKB 1NX9A 3HYNA 3IQXA 5EIFA 2P9TA 4O5AA 2GRAA 4LYEA 3UPTA 4GKKB 3EA5A 1A4IA 1I8TA 2XE4A 3P0EA 1ZW1A 3GFVA 4PLVA 1YA6A 1BWRA 2FETA 2VRCD 4H0CA 2DOKA 1UP7A 3NCHA 1UPBA 4UUPA 2BDEA 5C2JB 2M9MA 1N2ZA 5ALUA 3KETA 1Z7BA 1XVIA 2VSFA 3COVA 4J0KA 4XUGB 1ZAYA 4LHVA 1V47A 1FQWA 2VAWA 3CB4A 2JLBA 3UT5B 2WDPA 1SQFA 2IPAB 2JGAA 3RGWS 3SE7A 4AG6A 3IHKA 4UEWA 1N0VC 1ZBDA 2B2NA 3CVJA 1N6PA 2QX4A 5IMBA 5BYAA 3CRNA 3SR3A 3FNHA 3OF3A 4S0XA 4G5SA 3UICA 2VSNA 2XWSA 3U60B 4LQCA 5DN9A 3QVGB 4I5GA 1KSGA 5B57C 2DFVA 2ZI4A 1DQSA 1M83A 1DDGA 1ZGBA 5JWHA 1UT5A 2OYRA 1ARZA 2J3JA 2YJ3A 4D44A 3E9MA 5BNTA 3G17A 4HAOA 3PRHA 4XM0A 3SQWA 1I36A 1BS2A 3H5VA 5F78A 3E9RA 4H7KA 4M9XA 4MTCA 4YRPA 3V8EA 1TTQB 5IULC 3ABSB 2CVFA 1CQZA 1JA0A 1TKCA 4GZLA 4K1LA 4D41A 3WJ1A 3VVCA 2YY5A 4MRMB 4R2KA 4K0KB 4ROTA 3OQMA 3OTIA 2K7ZA 3IOCA 4QXMA 4EK9A 5ICCA 2ZTUA 3ERCA 4RF5A 1OI3A 3WLFA 4ESEA 3U48A 4YRZA 3ZU5A 3K7EA 4WMLA 2YS7A 4KHZA 2BKAA 3DVAA 5EL0A 1PT5A 1SXGA 1WMFA 4U6QA 4DSUA 4F0JA 5KX5B 2IUFA 1NBOA 5KNCH 1NY6A 1HDGO 2Q2OA 1B14A 3OC0A 4A2CA 2DTXA 1WXDA 3DC2A 5EWJA 5I7VA 4IVQA 1Z56C 4ARCA 1VIAA 4FMDB 2WBLC 2A3RA 2JGJA 1O97C 2SKCA 3GF4A 1L4LA 3PQ2A 4WBSA 1UM9A 1PD0A 2ODQA 2QSYA 3EQ8A 1S9HA 1YR3A 4Z4FA 1RJDA 4E2XA 4GI3A 1R7RA 3ZHQA 4UREA 1O6BA 4W8OA 4C0BA 4DYDA 1N34B 2IOQA 1AV6A 5FBLB 3H5WA 1SVNA 4FKZA 2OOSA 3FNIA 4RBNA 1N77A 2DWUA 3KEFA 2DAPA 1WCXA 3GG2A 2ZS9A 1N3BA 4HJXA 1TC1A 4JLWA 2Y1XA 5BN5A 5B7NA 5ICFA 6LDHA 3HFSA 3ANTA 2O8BA 1F2UB 1Z29A 3CWQA 4V1CB 2R60A 1OSNA 1STOA 4PHCA 4RIHA 3IP7A 1JKJA 1Y34E 1Q74A 3TLEA 1MOZA 5DJ5A 3ZDYB 3ZOKA 1K66A 2DLNA 3ZJ4A 4TMVA 3THWA 1UF9A 3RTGA 4JR2A 3WLKX 2ZTLA 2BYTA 2R87A 1T3ZA 4OU5A 5CFMA 1TJ4A 4BMNA 5DGXA 2JATA 3AHDA 1ZD9A 4RGVA 3VZQA 3RS0A 3SS8A 1M33A 5CT4A 2PUFA 4HK4A 4JEMA 5A9TA 4B3MB 3O75A 4MR7B 4CKWB 1DQNA 5TMEA 2P0YA 3PK0A 3THWB 5FORA 2GAIA 5C31A 3UB2A 4BEJA 1SVKA 2P41A 1M67A 1M2HA 2BFBB 3AW9A 1W6RA 2Q0SA 2QY9A 4LXYA 5EZYB 5A5VA 2Y66A 3L49A 4GS5A 2XW6A 4DNPA 2J41A 1G0NA 3M4NA 2FWJA 4FFSA 4YIKA 1XCPA 3N6RA 1MJGM 2JGDA 5JSKA 3SD7A 3HDYA 3RF7A 2HV9A 2I2AA 3IHLA 4C0XA 1IIBA 3E5RA 4DMUB 3H9BA 4PX2A 2NVUB 5IBCA 1KKUA 4UE2A 4ZDWA 1Q7EA 3BHIA 1N2BA 2FKAA 2Z2IA 4IL5A 2HF8A 1G5HA 4II3A 1ZKMA 1UWCA 1M1YA 3EOAI 1B16A 1IPEA 1QH9A 2NPIA 1GQQA 3BCUA 2QB5A 1JXMA 3GCGA 4J0IA 4MKRA 5EP3A 5IUKC 2A4MA 2QD3A 5TSDA 3TIGA 4BKMA 5CYGA 1IN4A 2F3QA 6CHYA 5JXJA 3KUDA 1RYZA 2PD6A 1SC6A 4M8LA 3HVJA 2F2TA 3TE7A 2ABWA 1L4MA 3P8ZA 4NCXA 5IAOA 1S5PA 3T15A 3RBXA 1JW9B 4KI7A 1G21A 2CV1A 3SM9A 4IQ8A 4N8SA 3HB1A 4DN6A 3F0TA 3OCCA 5DYWA 4ZRMA 2Z8XA 1ACJA 1T0PA 3VKUA 4JP3A 3MJDA 3FRJA 4L76A 4AK9A 5BWOA 5LLSA 4HQ6A 4CMGA 4P82A 3NFYA 5IYZB 1E3LA 4X66B 5CB0A 4RZUA 5IZ4A 1S7GA 2DQKA 1IN1A 3MBIA 2CXRA 3L6OO 2JAPA 2OG2A 1B15A 3KJHA 2BMVA 4L4XA 4QUIA 3L7YA 3W3ZB 4NARA 1OVMA 1P17A 3QYFA 1C29B 3NHMA 3PXUA 2P2CA 3NHRA 1Q3TA 5KHAA 4LFCB 4BAGA 1H2YA 2G1KA 3HY3A 1OYVA 5B64A 5H68A 4D0RA 4DANA 3OOWA 4G09A 4C6HA 4UQLA 2ZSBA 4ZMBA 6REQA 1V7CA 3COPA 3ZPXA 4YYEA 3I9KA 4ZU1X 2G6TA 3FUVA 4K6FA 3AF4A 1QRTA 5H3CA 1O1YA 3OY7A 1LPNA 4UXJA 5I7WA 5IAAA 1X7DA 3PC8A 3W2EA 1ZWKA 4XEUA 4J1SA 5EUQB 5G0WA 3TRFA 2PRSA 3K30A 1DQPA 4JWKA 4YTEA 1LDEA 2OBMA 4NG5A 3BIWA 1NN0A 1FMLA 4O4IF 1TEVA 1G21E 3JYQA 1UFKA 3PFFA 4TTSA 3C3MA 4YT5A 2G9ZA 3DBHA 1G5TA 5DLDA 3LRTA 3BAFA 1GCGA 2D2FA 2GHTA 2XRZA 5IT5A 1Y4SA 3DP7A 5LYJB 3UAXA 4ZGWA 4B3TB 3TBHA 2CV2A 1APBA 5IT4A 6Q21A 3C24A 3BE6A 3RVNA 1KNXA 4ZI7A 1W6UA 3FI9A 2G5GX 4FT4A 4D96A 3SC2B 2N1MA 3LT2A 2AH5A 2OESA 4JIMA 1NUHA 1XWIA 3BH0A 5DT2A 3U3ZA 2JLUA 3L6CA 2GEKA 2ZJYA 4F04A 3UPDA 5IAJA 5TEVA 4IIYA 3X44A 3OEEA 5IPFA 5CNIA 5AM2A 1HE3A 1T15A 3MWDA 2P68A 1PQ4A 2CLFB 1I1NA 4KR0A 4TL6A 4BVHA 1YC5A 2DLDA 2WG2A 4GOLD 1CJKC 2CCKA 1TCVA 3ER6A 3IIJA 4H4EA 5CW1A 2E37A 2P7IA 4WK0B 4GC9A 3FR7A 5ECYA 3UT0A 3ZE1B 2EYUA 2G0NA 4L72A 5CVTA 2AUMA 2J0VA 3I34X 5E0OA 3UHFA 3EGVA 5KIAA 3FLMA 4JJIA 5KO2A 1Z6QA 4WKCA 4TSKA 3DA8A 3E3NA 4HGQA 3VAAA 2EQ5A 3R8XA 3TQTA 2ZBUA 4RTKA 2IEGA 3AGPA 4Y2JA 1K4KA 1E6CA 1KC1A 1ZGJA 3I5YA 3F78A 1KL7A 5SY4A 2QMOA 3GY0A 4RVDA 4PAWA 1O95C 3G8BA 5KNBH 4U7JA 4Q03A 3P9ZA 3V4PB 3TWOA 4M9QA 4OOFA 2V7GA 3DMNA 3HJGA 5CMLA 3C3CA 4UUOA 2OL4A 3HHPA 3PUIA 2XYGA 2Q4EA 4H16A 4OB6A 3R76A 1DC7A 3IEPA 1E9DA 1TQ4A 3F2VA 4IV8A 5ILGA 1WWKA 4CMEA 3L0YA 5JO9A 2E82A 1DEKA 2V3VA 1BRMA 3NQ41 2HRQA 4OXIA 4R2XA 1YHNA 3WAGA 2MDTA 2JFBA 3WWYA 1EE9A 2P9HA 1XZCA 3R3WA 1HDOA 1Y1KE 3GDHA 1K6XA 4P80A 1AZTA 4BLOA 2JF0A 4WACA 2ODTX 5BVHB 2VTVA 2W2LA 3EIQA 4FZJA 5DX8A 1WZ2A 1NP3A 3OQBA 1TA0A 2CJYA 4REOA 4OHVA 3LWNA 1QTQA 2FXVA 5AR1A 1SBZA 1WLSA 2VQDA 4PZLA 2CLIB 1CZRA 5FB3A 3MFYA 2VT6A 2ZQYA 3R23A 4RSGA 4US2R 3AM1A 1UDAA 3RIYA 1JP7A 2VWHA 2Z1DA 3TKAA 5CK4A 4CL0A 1OVGA 4I9NA 4WN9B 5CD1A 1E9SA 2DQYA 3KQSA 3PNQA 4UNIA 5M34A 4JI6B 3W5AA 4A0SA 3IEVA 2YWHA 3U7HB 2C2ZA 5I8PA 3FDZA 2XNDD 4FC7A 4OXKA 4FHEA 4XUDA 3R7NA 1PSZA 5DW3A 3TLZA 2JLYA 2FW6A 3C6YA 1UCFA 3BK1A 4DOMA 5ESXA 2G4LA 1L5VA 3RBZA 4JVOA 2VHQA 5FL7D 2YR0A 4LE1A 5HQJA 4BWFB 2WF6A 1F17A 2HM7A 1RZVA 5L6MB 1FX0A 3GEEA 4IWYA 1YVPA 4LI3X 1E0JA 1NU6A 1U9IC 1IOLA 1EWQA 4TKLA 2J0SA 5CLGA 5EE3A 1L6IA 2JIRA 3FOCA 4N12A 3T54A 2RG7A 2FPGA 3L7JA 1IVSA 4Y9SA 2H1FA 1J9GA 3DOHA 3VYRB 2VHJA 4HQNA 1NFFA 2DC1A 3AKDA 4M8KA 2J0QA 2XCRB 4IMJB 4M87A 1EWRA 2IBSA 2J45A 4OJTA 1EP2B 4CF7A 5HEKA 2OZKA 1FOEB 3AKCA 1XE3A 1TM7E 4QRIA 2BR5A 1DAIA 4NPHA 5ADHA 3AFGA 3K9FC 3AVXA 4P4LA 1OX4A 5K8TA 1I51A 1D09A 2DY0A 3GEMA 4L74A 3D6MA 3HEAA 4N41A 4AF7A 1EZ4A 2RGXA 4BMOB 4BO9A 4ARZA 1WZUA 2PHZA 4NICA 3PDCA 2ACEA 5FBZA 3R7FA 5AK6A 1KMCA 3BF7A 3EGWA 2YNMD 3QKSA 1OB2A 2EVWX 2QY6A 3S28A 1E2JA 3P19A 4C78A 4EWLA 4QYWA 2VP0A 3PQEA 4PZYA 1TM4E 4BLUA 2Y9MB 4EVSA 5KYXB 1DXOA 2PX3A 4YLYA 3MCZA 4KDCA 2BF7A 1KZYC 3A6JA 3Q10A 3OVMA 4FXPA 2A1TR 3RIXA 1YB7A 4BVFA 5JASA 5DHTA 2AR7A 1LZKA 1JFLA 3PRYA 2WSSA 3LTEA 1VCNA 3DE4X 2CCJA 2CXSA 3SLGA 4ETIA 4JXKA 4IKPA 2VLIA 3FAZA 3M0EA 5DMHA 1ADGA 3AM5A 3GLHA 1FLDA 3NTUA 4TQAA 1JSZA 1NYLA 3T9FA 2QRQA 2FSHA 1N9GA 2BUBA 3ZHYA 1TT5B 4AXXA 4QOGA 4Q9IA 3I30X 5YASA 3S68A 1SN7A 5ICEA 1KY2A 4IOMA 3KZVA 3ANSA 2IE8A 2X4GA 4BUJA 5AO9A 2NQ8A 4BFZA 2I76A 3ZGXA 2CMHA 4QD3A 2ZUBA 4E31A 4GM4A 1FUYB 4RDIA 5GONA 4RETA 4IP0A 4JITA 1Z2PX 5DLQC 3WK6A 2Z1MA 3A0RB 2ZUSA 5A3SA 5IASA 2HX1A 1CW2B 4K87A 4UBNA 3VBCA 3ZWOA 4HPWA 5FD8A 3HYTA 1G2IA 3IQHX 4RMNA 5FT9A 3R6TA 1DVRA 7ADHA 5KVAA 5JDCC 2F67A 4TLMB 3VKGA 1GFSA 2HCJB 5A62A 2DHQA 4N6OA 1EVJA 4ABYA 2EP8A 4KSBA 2HRRA 3FPLA 3ZEAA 1FDIA 2XXAB 3GUCA 3GZTB 5BOSA 1OU4A 4X90A 1ZOLA 2Y3IA 4RSRA 4B34A 4C7XA 2LV8A 1UXOA 1Z2OX 3RUEA 3SX0A 4EKNB 4BQSA 2PUJA 5ESWA 1ZYUA 4G5RA 4MUNA 3IDZA 4CDRA<