2LV8A

Solution nmr structure de novo designed rossmann 2x2 fold protein, northeast structural genomics consortium (nesg) target or16
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
110
structure length
110
Chain Sequence
MLLYVLIISNDKKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRKESQNIKVLILVSNDEELDKAKELAQKMEIDVRTRKVTSPDEAKRWIKEFSEEGGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords De novo designed rossmann 2x2 fold protein
publication title Principles for designing ideal protein structures.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 41
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lv8A00
2LVBA 2N3ZA 2KPOA 2L82A 2LV8A 2LRHA 2MR6A 4J29A 5GAJA 2LR0A 2N75A 2LCIA 2L69A 2MR5A 2LTAA 2LNDA
chains in the Genus database with same CATH superfamily
1CJCA 3KD3A 3ZWWA 1RI5A 2O8VA 3QEBZ 2PMBA 3F1LA 3LGSA 2ONJA 1Y4SA 3TW6A 2X41A 1TKCA 1FU4A 2ZT5A 3DWFA 4R8VA 3LHIA 4GOLD 4AG6A 4BLOA 4RADA 2GPAA 3TB4A 4IIEA 3TIGA 1LW6E 3MINA 1JB1A 3DCIA 4NYJQ 4YNBA 1J97A 2FK8A 3HCEA 2E6KA 4IMPA 1LBTA 2GARA 2GWHA 1PWHA 3NNSA 4MQLA 3T7CA 4MCIA 4RPLA 1MC4A 3RJ9A 4TVBA 4KJZA 4KO1S 4HCJA 3VBCA 3WSVA 2E4XA 2MT9A 5FPHA 2I6UA 4FLFA 1E1QD 1TEVA 4NULA 4WE3A 3RPEA 3RT7A 1QBKC 1EQ2A 4D9BA 2W6PA 3GA7A 4MA5A 4LDRA 4LBVA 2R7KA 1ISJA 4XYBA 4KH1A 5DO9A 3T95A 3VO8A 3EMKA 2JLVA 1IM2A 4CEIA 2HBRA 4A5OA 2IWRA 1BKSB 2Y05A 3UHOA 2FRDC 1LPBB 4E6PA 3ZJTA 1ESZA 1RM0A 4LNUB 1WSBA 3DOUA 2GWRA 4RTOA 1U1FA 4QRDA 3ZWDA 3ZZUA 4YMHA 1MW9X 2P68A 1KYZA 1L6IA 1Z8FA 2FEKA 3JALA 3K72B 1IAVA 2HU2A 2AIRA 3M70A 2HKIA 3IAS6 2D5CA 2IPLA 1Y7IA 3CRMA 1HURA 5HHTA 1UBHS 1I0IA 1ZVQA 1M75A 1QLJA 3LUBA 4DMGA 1FYEA 2VRBA 2FSVA 3FCXA 2QT1A 1PFVA 5JPIA 3WIOA 1TVMA 1LBSA 1T5LA 1C3LA 1X1EA 3BB3A 3EDMA 2JFZA 1P2GA 3Q6NA 2CEKA 3L6OO 4FFPA 4KUEA 4RPHA 3WY9A 1M9NA 1WBJB 1XVTA 2BD0A 2EZUA 1YR3A 1YZQA 4G1CA 3CCCA 3NHLA 3WYFA 1II0A 1FUKA 1Z3CA 5GOTA 1YZLA 2DR3A 3CX6A 2QN9A 1CNMA 3RTDA 4D6XA 2GN9A 5LZ7A 4ZYZA 1Z6XA 5KQRA 2W0SA 2Q4TA 3JQBC 2PS9A 1HK7A 3IAUA 3LLSA 3UFXB 3VOSA 1BDJA 3MAAC 4P31A 2EP5A 1PGOA 3I83A 4ZOEA 4O4LF 5BUSA 3CONA 2H4JA 4H18A 1Z2AA 2GH1A 3FTFA 3KEGA 3LO5A 1UK6A 5GZ1A 3A31A 4AJIA 4AZVA 1T36A 1XV5A 1PD0A 4BQSA 2O3RA 2VDNB 2RK4A 3NRBA 3CEJA 2W98A 3OEHA 2J45A 5BN4B 2G70A 4O4JB 4DQ0A 3WAJA 3NHMA 1NQOA 4WZ6A 2FZ5A 3PFKA 3JSXA 1H2HA 2H57A 2IHZA 2WJJA 4LZWA 1D2GA 1UC9A 4HXFB 4MH0R 3U4IA 3BILA 4LY0A 4CMEA 4CIBA 2M6KA 1VE9A 1FZQA 2E5FA 3FMGA 4CCAA 1DBWA 2FLVA 4PONA 5F4ZA 1XL0A 4TROA 4YV1A 4JQZA 5HQ3A 3K0EA 4JUIA 1Z2CA 4KNWA 5JE8A 4MVJH 1T3GA 4FC6A 4H7JA 3LG2A 4PIPA 4KOAA 4Q7JB 5GJCA 1E1KA 5AKKA 8ADHA 5K2OA 4NOLA 2WKSA 3ADDA 3QNMA 5A5DA 3IEUA 4DC1A 3TD2A 1YS6A 1YNOA 1SA0B 3E4DA 2PHZA 2O07A 3PQ8A 3WR5A 3VHXA 3CNQS 4C3VA 4ADSG 5EI5A 3GDGA 4XQEA 1O96A 2E85A 4Q3NA 1GGFA 1RHRA 4FZVA 3W9UA 5FTLA 1TIPA 1MJNA 3DG9A 2PZFA 3LQQA 3DBRB 4PG4A 4FHZA 4LHZA 4ZVSA 3SHOA 3V1KA 2X9VA 5F1OA 4A2WA 4D8UA 2BEVB 5KX5A 3WL4A 3DD1A 4FM9A 4H6WA 3WIEA 3O2JA 5AWFC 1RVV1 3JATB 4H7PA 1E3WB 2IZ1A 1DKRA 4DPKA 3EAGA 5B30A 1M0SA 3SDSA 2ZIUB 3JQRA 4MCAA 3OFVA 3PFFA 2IEAA 1NMSA 3BSSA 2ECQA 3KK0A 4UBIA 2N1MA 4C04A 4DADA 4YT8A 2HA5A 3UICA 1GA4A 4CL8A 2WTMA 1E9DA 2JHGA 2C1XA 1S3SA 4EB3A 1I36A 1I80A 1RLIA 2F62A 3LGAA 4C0KA 4PQFA 4NF2A 3ZD9A 5K4GA 1BXRA 1E4YA 2G80A 4DV5B 4DILA 5JV5A 2WV9A 2G9ZA 1C29B 5FI0B 3TOCA 1J0EA 1A96A 3OZVA 3GPDG 4HEJA 1VXOA 1ZOOA 1RM5A 2E1PA 2XYHA 1QHHA 4IQ0A 1WW2A 4LG1A 5BQPA 4P4UA 5F78A 3V1YA 4X24A 2ZZMA 2BM8A 2WOJA 3B5JA 3JZAA 1MNAA 1EB9A 1OT5A 1FP4A 1BHO1 1FYFA 1X7DA 2JAHA 3CMMA 3HGQA 3LD9A 3NWBA 4U02A 3T7JA 3PSAA 1EFPB 3H8WA 3OIDA 2B4YA 2VT3A 5AICA 2DERA 1GZDA 1JJAA 5G4KB 2EFCB 2YYZA 4IBOA 1EFVB 3KLMX 5I7EA 4CKBB 3NFRA 4XM0A 4C2TA 3PWZA 4H0NA 3BSFA 4C88A 1D9XA 4CMBA 4IG9A 3V4SA 4OMDA 4CG0A 1N7JA 4L9AA 2X1LA 4INPA 2ACEA 4TUYA 3UUEA 1DBSA 3E22A 2B8TA 3AB8A 5HZKA 3GA0A 3RNOA 2ALJA 3VMMA 2WHQA 2I8CA 3U9LA 4U39A 3MSCA 3ZDRA 4OO3A 5JZ9A 5E7JA 4B3RB 4GC9A 5HDQA 1EZZA 1JEYB 4BUJA 1YR7A 1X8KA 3QQPA 4RKQA 1WBBA 5CCDA 5ITZB 3SEFA 2AR7A 4IGFA 4N12A 4Y2JA 4RA9B 5CW1A 3SBOA 4EHLA 2QTAA 1M1NB 1RWVA 1A71A 1RMTA 2WWTA 3AUAA 3KJHA 4NZOA 4S24A 1XD9A 1KZ9A 2B1QA 2JIRA 3O03A 3PQ3A 1OXBB 2RGEA 1B00A 4PSDA 4PZUA 2AR0A 4B3JA 2WV7A 5HJ7A 2WMYA 3QG5A 4OHOA 2HK9A 4BNUA 3TJZA 1LPNA 4LC9A 1EZ1A 1S6YA 3ZZ0A 2QTGA 3BPSA 3FGOA 2R00C 4V3CA 4CLDA 1KP3A 4YFVA 4G1MB 3MWGA 2DTXA 2GHTA 3BOSA 3ODPA 5F2EA 5JYBA 4PHCA 3PNMA 4ZP1A 1FP7A 2MDTA 2OFOA 4ZZIA 5KMGB 3DTTA 2C0PA 4OH7A 5TEVA 4MW4A 4CGZA 1ZJWA 3RVNA 3T3PB 5K8CA 2XITA 3JQBA 3KG2A 4DOMA 4CDMA 1SBIA 2HQSA 3JQ7B 4ZCPA 5J47A 1QZXA 3DMFA 3NGMA 3UMRA 5A04A 1M7HA 4I5GA 3WRXC 3SHVA 3P2MA 3RLIA 3ZHVA 2GEBA 3AK4A 2C54A 2JZCA 1XKTA 3F5QA 4P8RA 4LGYA 3B9PA 1NXSA 4JJIA 4BLPA 4FD3A 5AM3A 1E3IA 1V3TA 2H3EA 3Q8WA 4QBIA 3E2MA 4K8OA 3B2EA 5K0TA 2V7WA 2HPZA 4QXOA 4UZSA 3H5WA 2QLJA 1QOPB 2G7ZA 3TRJA 3T1HB 4WLNA 4OJQA 3ORFA 1T0PA 4O2BA 5KYUA 1LWNA 1H94A 1EG2A 2IKQA 1VB3A 3NCHA 4KQXA 2G1UA 4KRGA 1ZN8A 1JDNA 1ZMTA 2EP7A 1U8EA 1MV5A 3W05A 2P9EA 1XMIA 1HFEL 1WDKA 2XOEA 4FYKA 5DE3A 4F2WA 4KJXA 1P3DA 1QHFA 4KWEA 4AJ9A 1DGQA 3O4VA 1LQTA 1NXWA 4XEUA 3NYWA 4WK0B 4DA6A 1LPMA 3QX3A 2HDOA 2QD2A 1HE4A 3PTAA 3QE0A 5J4KA 4QAJA 4U7FA 5C53B 3DMRA 3I9LA 5E9QA 4IEFB 1ML4A 1A8SA 1EEXB 4YV2A 2G71A 2QQ0A 3KB1A 4OQPA 4NNJA 4BFCA 2VC2B 3R8FA 1GCGA 2AJTA 2BH9A 4N65A 4P84A 4YJHB 5FNVA 2YVKA 4HYQA 2RCYA 5IN5A 3T38A 3U6KA 5IVHA 1CZLA 1QDLB 4HATA 3JVUA 4L27A 4CI9A 2PMDA 3AETB 5ANRB 4G37A 1VCNA 1L5ZA 3FTPA 2O5CA 3H1TA 4AUEA 3EISA 2R1TB 2ZR0A 1UZUA 3DZHA 3JWPA 1QX4A 4LSGA 1H93A 4J7CA 2FHSA 1C4OA 1NVUQ 2B8EA 1OV6A 2OILA 2OR3A 3DDNA 3E1SA 4K6CA 3N2YA 4UUNA 1CFJA 2QAGC 5EJ2A 4F2HA 1C3OB 3OKPA 3C5EA 4B0OA 2YC2C 3FTCA 3LUHA 4CLEA 4UCFA 1LPAB 3K96A 4IIXA 4CU5A 5LQMA 1JEQB 5L3VA 3G7SA 1DAGA 1YRBA 2QTLA 3THXB 1XQ6A 5AKHA 3CXRA 3UB4A 1LA2A 3H5VA 3B3JA 3RABA 3V8PA 4EF5A 3VH4A 1P44A 4TMFA 5CA1F 3NHWA 1Y7HA 2PH1A 3DEKA 4FUTA 4IVQA 5JJKA 1XCMA 3WQSB 1R6TA 2NT3A 3F96A 4DXHA 4QGSA 1I13A 3GLSA 4OHZA 2IPNA 4R6WA 1J21A 4OB8A 4BUZA 2AI3A 2ZB4A 3EEBA 1J8FA 5LXTB 4FOSA 4F5DA 4RJLA 5JAHA 1LLUA 2ODAA 3D7SA 4MI9A 3TLCA 2DPYA 1L7NA 2ACVA 1DWUA 2R6HA 2WB4A 2CVHA 3E15A 5DNCA 2PZKA 1B41A 3FSGD 2JASA 5IMSA 1Y1PA 3CVXA 2WD7A 1O8BA 2PLAA 2AG6A 2C2BA 3AV0B 3O4FA 4NBSA 4RJ2A 2PUJA 2A35A 3JQAD 3IQGX 2NM0A 4BFXA 1H5QA 2PAFA 2QP9X 3OQBA 1G8AA 4UCXA 3STHA 2ZDHA 4FSXA 3H1EA 5E3JA 2NNLD 3W77A 3G0BA 2QL7A 4X7RA 4INAA 1BE6A 2YWBA 4JLBA 2GXSA 4NONA 3KR0A 2V0GA 3AOEC 1CVIA 4RVFA 1LBHA 2Q5OA 2ZETA 3DYBA 4AZTA 4FB5A 3Q9LA 1GVHA 8OHMA 1E9AA 3ENWA 1XZLA 3DDZX 5JVDA 4UU0A 2J9FB 2W4MA 5IKEA 3WGGA 3IIIA 2QE7A 4DYHA 2N3ZA 3WWYA 3SYKA 1MHTA 1AHIA 3FCSB 1CEYA 2AQ8A 2A3NA 3C85A 3IOMA 3ADCA 2I7TA 2ZXUA 3QJGA 3NFYA 1K7CA 4EGQA 5DWQA 4OXYA 3A1NA 3CRVA 3NWJA 2BTQA 1SQ6A 3ZW7A 5ILGA 4Y6PA 1ZN7A 1O97C 1HLFA 1FTWA 2VP6A 3EE6A 2AOXA 2OV8A 1SXJE 2IDZA 2QYSA 3HCWA 3I3OA 4XB2A 2H6EA 3NNDA 3TLKA 2X76A 1YH3A 5C5EA 3STWA 4OHPA 4E6EA 3Q87B 2GUGA 3RS7A 3WMXA 2OMEA 4E51A 3QKWA 4FIZA 2Q5LA 4K28A 4E11A 3TO5A 3OOWA 2QJFA 1OWLA 1CUSA 1ZBQA 4PWYA 4LVUA 3NH9A 3AYXB 2QLTA 3P2KA 3O8LA 4IHAA 4RZ3A 2R00A 4P7GA 4UD2A 2FV8A 2I8AA 1U0SY 5EQFA 1H6AA 1HXHA 1U3UA 2JATA 3AKYA 2XGJA 5IC6A 1CD5A 1GG5A 1UANA 3GFTA 3N70A 4IQ8A 2UZ3A 3E0QA 5DYGA 2RE8A 4ZQCB 3GMDA 3L8ZA 2BFBB 2OHJA 2BWJA 1CR6A 5JMWA 5DYWA 1DIBA 2GOYA 2MINA 2IZ0A 1I3OA 2VQ6A 4XLTA 2ZYAA 3RQSA 3ISTA 3C0KA 3DHEA 4RLSA 1K8ZB 3WRXA 3GT3A 2MU1A 4GS5A 1E94E 1NI5A 1NATA 2X6RA 4JLUA 1V8OA 4M87A 2CHEA 1KBQA 1QCYA 4C7JA 2ASVA 3M8KA 2PGIA 3PCTA 3WMFA 1L7RA 1XHFA 2C92A 3WB9A 1IXYA 2DB3A 3PLAE 1E9SA 4FT2A 4LSZA 1W85A 4FEYA 4UM8B 2BGUA 3H8SA 3IVRA 3L1VA 1Q7BA 5CVEA 5DKFA 1FXSA 2X0JA 1AO3A 1ZNXA 3EQ2A 2W6MA 4QUJA 5AM4A 1AUXA 4JU9A 3IMCA 2RD2A 4BRZA 5JRZA 4ZO4A 4G4JA 3DO8A 2QENA 1Y81A 1JT2A 721PA 2AG1A 1T1EA 3VYUB 1W4RA 3ZCTA 4LOKA 5HOQA 2VQSA 2XSZD 4MYDA 1GKLA 4ILEA 1ZGBA 2GFHA 3UHAA 3X1YA 2OMKA 2NU8B 3IAAA 4LJ8A 2NZWA 4O3FA 4UVHA 4EG7A 4C5BA 3IE1A 3JPYA 2D1SA 2O2GA 2QIOA 1MC1A 4OMCA 4EKEA 1M76A 4U3JA 1P3JA 1ZD5A 3EDQA 3LF1A 4MV8A 2WJ3A 1SK8A 5JXWA 4GWKA 5CJPA 4DC0A 3EVBA 1D4ZA 3A11A 5L4NA 2FPGB 4ER3A 3MWFA 3I05A 1FP2A 4ICIA 4RHXA 3U81A 2Y0DA 3FHTA 2NV6A 2PO5A 2MSLA 5DLEA 4LJ9A 2JGNA 3ZLJA 5CLJA 1U3DA 1YFKA 2HA4A 2XMSA 3PRHA 1PR2A 4QAQA 3E8XA 5JH7A 2M32A 4HOYA 3FOEC 2QAGA 4DBVO 4Q1EA 1VG8A 2JL1A 3M3DA 2RIPA 3SSAA 1U04A 4FNMA 4YRMA 1IN7A 2Z3WA 2AF3C 5TQ2B 3ADPA 1NTOA 3EXIB 1Q57A 2XCQA 3VPBA 5B3AA 5REQB 3SP1A 1P7ZA 2OG2A 4UNIA 1DEHA 1W30A 2I3DA 5E1MA 2XECA 3KU4A 3GT4A 3KQSA 4RTMA 1BA3A 3WKDA 3AEKA 1PLKA 2OECA 3FYHA 3PHIA 1ZJ5A 4LHSA 3Q8KA 1D1QA 2FR8C 2F2TA 5JXHA 2BMVA 1ZEMA 4O02B 4EG5A 2QAJA 3DTNA 4ND8A 5IBQA 3BF7A 4D3SA 3C1UA 4BZQA 1Z15A 3E03A 4M7PA 4IINA 4XSHA 1UXOA 3VTFA 3EBOA 3DAFA 1QG4A 3R8XA 4UFOA 4JEUA 4N9QA 2WSMA 5ALFA 5K0BA 3WI7A 2JEOA 2PUTA 2A86A 4PWZA 1CUFA 5I47A 1X7ZA 5JFOA 4WXMA 2PE5A 1QGUB 2QVXX 4HTAA 2DH6A 4JHLA 4YAJA 3HSYA 1C9MA 4JX8A 4WESB 3MS7A 5HIJA 5AVRA 3ZN2A 3MB8A 4EB6B 3RYFA 2IQIA 3AOEA 4LJKA 4B34A 4D4LA 1Y1SA 1L3BA 1MJ5A 2OCGA 4AI6A 2G6BA 1JNXX 4P3KA 3GOHA 4UHJA 4EHIA 4Z4GA 2D0DA 3PT9A 2B8JA 3EUFA 4TLCA 1G1MA 2O1WA 4HGPA 3QITA 4C7OB 2WTXA 4B31A 1CB0A 3HVIA 3O8BA 4ZCTA 2PA0A 4N6GA 1GA1A 3SZUA 2V3CC 4HQ0A 4CV3A 4MPJA 1KOGA 1CY6A 1V8FA 2QY6A 4EGSA 3JW8A 1H4SA 2ZJ8A 4Q19A 5ALJA 3DAPA 3D6FA 2HT6A 3EVGA 3TTXA 2FPIA 2WWFA 2ZQZA 4IFEA 3ZE8A 2G88A 5AI0A 4DMFA 4DR1B 4PZZA 2J5QA 3NBAA 4JMLA 4H1VA 1V7PC 3GGOA 2QRMA 4NU6A 3U3DA 4DDUA 1HQKA 2H8KA 2JKYA 2UZIR 1COWA 4OHRA 4TQAA 4A5SA 2O6LA 4AG3A 2PTHA 3RRXA 3UMYA 3HNRA 2GPTA 3CUEF 4URFA 1YFLA 4RIHA 2AQKA 5FWYA 5EJ8A 1IM5A 1NJ1A 5LU9A 1WXQA 1OMOA 3CLTD 5DSZA 4XGRA 3VYSB 4C7XA 4LMBA 3NT5A 2CD7A 4MEAA 1NW7A 2EIHA 1VYTA 3PWTA 4DPLA 3IUNA 1BHSA 4FYPA 2QRGA 2WHPB 3RE1A 1CWUA 1KS2A 3EXHB 1WXFA 4C14A 2GR9A 2NVWA 1QS0B 4KQFA 2HMTA 3ZQJA 4DEYA 3FNHA 2J9RA 5EPEA 3WL3A 1CT9A 2IFTA 3H9BA 4A8PA 4F4HA 3O5AA 4KZPA 1UBTS 4ZQHA 4GI2A 4D9KA 1WUYA 1ECCA 4MRNA 4ARSA 2VNAA 4LZAA 1SXQA 4TL8A 1IFXA 1F9AA 5FBZA 4HQNA 1MX1A 5EGNA 3LM8A 3LQ1A 1E2GA 4LHVA 2F1OA 3JV7A 3M1LA 2PKYX 4A9AA 5KOHB 3MWYW 3WQHA 4R98A 1F6WA 1EA5A 3UYKA 3PICA 1RTTA 4LJ5A 1O6FA 5BYAA 1SBYA 3OIWA 3DE7X 3DKKA 2GA8A 5K45A 1JAIA 4AZSA 3HV2A 2R66A 2WW8A 3T6KA 3M6WA 5C80A 5SYAA 4AXBA 3HA2A 2CHVA 1XTPA 2FW8A 1A9PA 2CZGA 1L4MA 3EG9A 3F7MA 2JI8A 3L6CA 3ORHA 1Q1NA 4XD7D 2WKPA 3D7KA 3RS2A 3MUFA 4Z49A 4PQRA 3PC6A 3VR4D 1DLIA 3RVOA 1DFIA 4URXR 5HS4A 5TIIA 1B8UA 2XTAA 5HF9A 1U1EA 2QM3A 3WWPA 4DWWA 3U7GA 2YXLA 1L7MA 2D62A 1I7SB 2X0IA 2JFGA 5GGXA 1BS2A 2Q3FA 3MRXA 5JY1A 1XDUA 4LV8B 4GPIB 4BO9A 1XZBA 2PG3A 3EF3A 5E6UB 1ZNQO 5EGSA 5KO2A 1E2JA 1RWMA 1ZVMA 1MB3A 1MO6A 1YFZA 2WD8A 3A6LA 2JHCA 3EZ2A 1C9NA 5G0UA 2PEYA 5EZQA 3O8RA 1W4LA 1YC2A 2QUZA 2ZWIA 3NXKA 3BFJA 3OMWA 1XG5A 4LF5B 1F2TB 1RAHA 9ATCA 2ZJ4A 4I50B 5AHOA 1DT5A 1S3FA 2J87A 4UD6A 5HTOA 1T1GA 2DPXA 3IAEA 4HZUA 4KO3S 1I2CA 3O8QB 5LA6B 3QVGA 4IHJF 3H11A 4L08A 5M34A 3QEKA 3TI7A 3DQPA 1YJCA 1ZLXA 3CWQA 4FYIA 4D0GA 2VBCA 3HP4A 5BMVA 5HQJA 3PKZA 3W9SA 2LDBA 1QQ5A 5EIBD 2AMFA 2HO4A 3KQVA 3E35A 1XU4A 3UK6A 4E21A 4F9GA 2ENUA 3PHBE 1QKJA 3V4VB 1O54A 1FRZA 5KX5F 1SKBA 1D5CA 3TUZC 3K9FC 5B58T 2H65A 3PJEA 1JW9B 1PTJA 3WZMA 3ZDAA 3ZJYA 1ZI8A 2FR8A 3QBVA 2BFDB 4Y2GA 1A9ZA 2HEIA 2O2DA 1US8A 4KQWA 2IZ6A 5AK5A 1LRJA 3RO7A 3C3AA 1N2BA 1HEUA 3GPCA 1Y7PA 3T06B 3ZDFA 4ZJUA 1AHPA 5JYEA 2XZTA 5DX1A 2J0EA 2GF2A 1L5OA 1IJEA 3ZJVA 1PV1A 2VPIA 3Q9NA 3RGGA 4OQEA 3AJ8A 2GCIA 2PKQP 3OI7A 5EJFA 2QN1A 1JEJA 1ZK3A 2XMRA 3LC0A 4E13A 1RYEA 5C4GB 2ZRHA 1H65A 3ONNA 4QUGA 4NBTA 1P6XA 1X8XA 1X7YA 1CV2A 2VATA 5FOVA 4RPCA 1TEXA 3Q4GA 5JNUA 2PSJA 2CNDA 1RABA 1X8LA 1H1DA 3HGTA 4INZA 3ZHQA 3FHOA 1DFHA 5M04A 1SD5A 3ADOA 3OQMA 3BN3A 4BB5A 3AF3A 1YO6A 3GEPA 1EMDA 3QH4A 4F3RA 1J8MF 5HIMA 3HCBA 3GN1A 3X1DA 2I55A 1WB4A 2C2ZA 1XNGA 1NJ2A 3VH2A 4CMAA 3ONEA 3S2EA 4UNQA 3HK2A 2BHNA 2XTJA 2IYLD 1GSOA 1DC4A 3E61A 1GZHB 3MTBA 2OV2A 3PEFA 4LCJA 3VR6D 4DTIA 3H97A 2E1RA 2YIDA 2J5RA 2LNDA 4G0YA 1FNSA 2AS0A 2YY5A 3OHPA 4PSAA 3D0RA 4CHGA 2UVQA 2P9GA 2OG1A 5DI3A 2PT7A 5ELMA 4EGJA 1J33A 1EINA 4D46A 4EVSA 3WQQA 3RHFA 1GN9A 5B7PA 3RWMB 2A4KA 1CS0A 1WQ1R 1R5BA 2D4AA 2L69A 3PGLA 4OATA 1MJGM 2YH2A 1GRRA 1M1XB 1YQDA 1UH5A 4PQEA 1B0ZA 1XK6A 2G63A 2ZJ3A 3R40A 4KREA 1YRLA 4BFWA 4GX5A 2NPFA 3A6KA 1T8SA 1EG7A 3AFNA 1VA5A 4FEGA 4YI5A 3RADC 4I14A 1FXUA 4KIFA 3VV2A 1R0RE 1ZUNA 4WNCA 1WXXA 2AOUA 4DLRA 1NVBA 2BEWB 2FSFA 5HNKA 1P75A 3H2HA 4HDOB 1YXMA 4ETWA 1PR1A 4YAOA 3R3HA 4KNVA 4BNVA 2TECE 1YDFA 1BKYA 3TQHA 4BKRA 4DV2B 2YJ6A 2Z4RA 5KU7A 1D3AA 1V2HE 4E3ZA 1CLEA 2Z1DA 1SVSA 5HPYB 1RKBA 2HSJA 1Q0TA 4KXVA 3RSQA 3LUCA 5E2BA 2DULA 3CR8A 2G9NA 3C6KA 4FLEA 1IL0A 3JX9A 4X6YA 4KFSA 4L9RA 4XCVA 5KTKA 2BP7B 2UZ1A 2EL7A 3G17A 3JYHA 4HK4A 2ENWA 4EFNA 5B55A 3LI2A 2W00A 4FFBB 1UFQA 1RE1A 3I9NA 5FPSA 4ASUD 3A6PC 4GM4A 5ALXA 3WE7A 1M2FA 3G1WA 4Y9UA 5DBGA 3SM9A 3NR2A 5IUNC 1NWHA 1A7UA 3QSYA 1N7IA 5EJGA 4ATNA 5C4IA 3I2IA 2BMFA 3OBIA 2R4TA 4BU1A 4EG4A 2JBWA 3JQ9A 5AYVA 4AY4A 1J8YF 2JLCA 1PX0A 3K30A 4UTZA 5A6SB 3QM1A 1FSFA 1XK7A 1JV2B 2E4AA 2ZBEA 4RK4A 1O4VA 2VCYA 4H1HA 2YHSA 3QNWA 1QLWA 2AN4A 2OCLA 4G81A 3ZW8A 2QRKA 4GXTA 4MOWA 1QH1A 1ONNA 1W9MA 3DL2A 1XL1A 4IRXA 1S9DA 1ZR4A 1Z33A 1UDXA 1RHJA 2R751 3RTBA 2VJDA 5AR1A 5L3SA 4Z5XA 1Z4LA 3P5BA 1KMMA 1C7QA 1AIPA 2E7ZA 4LZPA 5ADVA 2R7LA 1VPEA 5I9SA 1J09A 5EWLA 4M1ZA 4HRAA 1H5NA 1GPAA 2PQMA 2VKQA 3QP9A 1NJFA 2FPLA 5JC8A 4KXMA 3G8BA 1DFGA 1OXXK 3GVPA 4NG5A 3BH0A 4Q3CA 3ONVA 3WLQA 2YIVX 2VEOA 1MO4A 1TTTA 1FYXA 1N5RA 2M1XA 4BVHA 2PX3A 4D0SA 4F11A 4ISBA 2QRHA 1G98A 1ZU4A 3ICVA 4PC3A 3C16C 4TTTS 1K3TA 1T5BA 3L77A 4IS3A 3K6JA 2FPKA 1EP9A 4E32A 3HKDB 4B6RA 5C7LO 3I8OA 4ZCQA 2W4IA 3BMOB 4M9XA 2DFDA 2O0LA 3JWEA 3F90A 4L5YA 3UPDA 5IM4A 3CISA 2X1VA 1IN8A 1WE2A 3EH2A 4RW0A 1GQRA 3FB1A 2FETA 2QKYA 3B3QA 5ALKA 1T5OA 2B2XA 2O2JA 2V6FA 3DBOB 4I8DA 4D9IA 5BWBA 1Y89A 1JDPA 2FE1A 2GNPA 1QFJA 2AI1A 2HA0A 3LKDA 3LUPA 4F7WA 4JV5B 5DGDA 3TXYA 2YN4A 1C1XB 2F4VB 1DWQA 2IV7A 4ZZ2A 1N34B 4IDQA 1QGZA 1Q77A 1XO1A 2P9HA 2GZRA 3B13B 1R15A 2CF6A 3MRTA 3JVDA 3QYAA 4G4IA 3M5CA 4DUGA 1CNEA 1K7EB 1LC3A 1O0CA 1K6JA 4BNDB 1AH2A 1M34E 3B6ZA 4EFKA 3QYJA 2WF9A 4X97A 1SAYA 3LLMA 1DNPA 3ACBA 5DHUA 5IHPA 2C3MA 5DJ5A 3HB7A 3QNUA 4PCLA 4MP6A 5KYYA 4TTQA 3KZMA 2B1JA 5K20A 1JTFA 4N8SA 5DX0A 1RWPA 3P9KA 2B1IA 4UXIA 4KB5A 4WZAA 4PX3A 4XR9A 2ACKA 2CMKA 2RHCA 2RSLA 3LK6A 2EL9A 3ZWBA 3UT0A 4ZK6A 3B12A 3BK7A 2CEAA 4MPRA 2IS4A 2VTBA 5ECGC 1OOEA 1ENYA 1QB7A 1M5RA 2B69A 4OI1A 1R4MA 1HDYA 1PS9A 2FG7C 3C1OA 3BD6A 3LUGA 3PHHA 3GGPA 3WYCA 2OZKA 1F48A 6REQB 1RSZA 1YVPA 1J7JA 1DOHA 1PNVA 1UBEA 2AUMA 4FGZA 4LHYA 1EM8A 2GDZA 4WPGA 2XZLA 2F64A 2BFFA 3GHYA 1AV6A 4WNAA 2XB2A 4L8VA 2DFLA 1F5SA 4UVIA 2G83A 3VU9A 1GZSA 4YACA 5I7FA 4L16A 4WX2B 4BVJA 2XUPA 3BTUA 3AY6A 1VCIA 2P9QA 3KEQA 1GILA 1U1GA 3A1FA 3M6UA 3MS4A 4MQ5A 4ZTUB 1XXHB 1PFGA 3NAQA 4I5FA 3ZZMA 1PL7A 2D74A 4IX1A 1SBHA 4JENA 3MCUA 4UASA 4X8LA 4Z4QA 3LY8A 3HFRA 3H2JA 4IIUA 5NULA 4RVSA 3BRSA 3STTA 4RXTA 5HE8A 5BW5A 3GZ4A 4TZ6A 2JGEA 3H5AA 1LBQA 5DLQC 1G8YA 5FL7A 5L45A 2OFPA 1BE1A 1JFVA 5C32A 1GGVA 5C8YF 3ENQA 5DASA 2Y0BA 1ZINA 2JH8A 3HCPA 4RE5A 4ZHQA 4AN4A 2C7RA 3ZLBA 5JDIC 4HDSB 2PZMA 5GTDA 3OTGA 5I7AA 3R5HA 1F9EA 2QJOA 3HV0A 1D6MA 4INOA 2GJ8A 3KM0A 2EKDA 4YAUA 3UTCA 2ZJ6A 5FLXA 5HKOA 4KEAA 4JEIA 2PZAA 2NMVA 5GJBA 4UE2A 1PGJA 1T2DA 1YJAA 3LO8A 4WCDA 3QIAA 4CM4A 2ICAA 3NKLA 5A7GA 3LU1A 5HGXA 5H0IA 1JR4A 3A9UA 3ZHYA 2BSAA 1C3JA 1BD3A 3DL7A 1QQTA 5E4YA 4QDXA 4TQGA 4LI0A 5L7TA 1MRSA 5BR1A 2C4TA 3JQQA 1MH9A 4GT1A 5CA0A 2GLTA 1VBFA 2AH5A 4LVOA 3REQB 2EQAA 2Y67A 4YT4A 3EG5A 4P7FA 4YCJA 3ZOKA 1ZKMA 4AMYA 4KLRA 4L0QA 1E1RA 1Y1TA 2J3QA 3UTDA 3I42A 2HHHB 5E38A 4MB0A 2G72A 1NIJA 4KO8A 1IXKA 3MJ4A 4BOYA 5TT0A 5JCOC 2XMQA 2I67A 1CPYA 2ZYWX 4OXQA 4OSPA 4I5EA 1AVTA 1YB7A 2NXCA 3VDXA 4UAGA 2BCGY 2H7YA 3AC0A 4KU4A 2IYUA 3R0ZA 4M49A 1BDMA 1MMFB 2WZBA 4QG3A 2AKYA 1QDUA 2GF9A 1V4NA 2WT9A 2XE8A 4PAMA 5NLLA 1TEHA 1Z4JA 4B3BA 1KFKB 3CBGA 3SC3A 3ASUA 2XDQA 3W2IA 1Y3HA 3QX9A 4PLGA 4WOPA 4BO5A 1R88A 4W5RA 1CUGA 1I6KA 1PLJA 1XDDA 2UVDA 2ZSKA 3OKAA 2I7CA 4HTFB 1IOZA 3WQBA 2ATCA 2H1WA 3Q7QA 3VDNB 2W70A 3OF2A 2BISA 3NU1A 5TEWA 3SJ7A 1NRWA 1TKAA 3QX8A 4JS0A 4D9MA 3FNEA 2B4KA 1T1IA 1MAUA 1IUOA 2R62A 2FN8A 4P1ZA 3GLQA 1LS6A 3LPCA 4QJ4A 3FMIA 2G5TA 1NMXA 1NTRA 2VWQA 4Q93A 3DEZA 2G1PA 3AUXA 4HPXB 4YXWD 1KP9A 3H0EA 3DEJA 3H4VA 1JBQA 1SCIA 3ICCA 3PDIB 4QGAA 4XTCS 1ZDMA 3CWZA 1H85A 3AM4A 4BQNA 3TBFA 1EWQA 4BMOB 1GADO 4EPVA 1EA7A 1NVVQ 2Z56A 2JD2A 1TF5A 4XD2A 4FQ8A 3TSOA 3HUUA 2J8ZA 3WGIA 3SS8A 3W7AA 2JZOA 2Q8NA 1I1HA 1E8DA 3LL7A 3OPQA 2MWMA 1AF7A 1PJ4A 4L5IA 1BXGB 5AW8A 1UK8A 5KSPA 2YASA 5I9BA 1UPFA 2PCJA 3WL6A 3VI3B 4AYWA 2IHBA 2X3YA 2O2EA 1ZAKA 1IEWA 4PAWA 3ZWPA 5HCNA 4DV6B 1NF9A 3KL2A 4H4CA 4U2FA 5F1YA 1ECJA 4FD2A 2HNKA 3IBSA 2OCYC 5EYPB 2C4NA 2PCLA 5J5AA 4HV4A 2GASA 1MCZA 1N77A 1TM5E 4B84A 2PWAA 2YV4A 1N8KA 3MQFA 3K92A 1M33A 1U8AA 1ZUHA 4QYXA 1X7WA 1P1JA 3FJ1A 2A0WA 4L15A 2O54A 4DRXB 5EVJA 4PN3A 1JG7A 1PUIA 3DQQA 1OAAA 2GUWA 3JASB 3D6VA 4EL0A 1J6UA 1F8YA 4J29A 3AR3A 1NYRA 2PXCA 2VYND 3KQTA 1QVRA 4M6WB 2BR3A 2UVPB 4IFTA 1QFXA 4HDMA 4URUR 5EOVA 4TRRA 2XNKA 3ANNA 2BGMA 4UBNA 4F38A 4ENTA 4MWCA 4ZRMA 1V43A 2FZEA 2QVLA 4G1UC 1TUEA 3R5FA 3MWJA 3S8MA 3AVVA 3IUQA 4O5AA 1NX6A 1Q2XA 1NOIA 4NMWA 4HS4A 4YUWA 5INTA 1TJ3A 1KJWA 4U9UA 2GD0A 3I2HA 4GM1A 3PPWA 3CF4G 5C8ZA 1ORHA 2FNAA 3KYJB 3RHZA 5FBQB 4YONB 5KYNA 3SQWA 2RHMA 2CL0X 1C8VB 2PSHA 3H5LA 1TK3A 3AI3A 2FPOA 3CR7A 3CUWA 3OIYA 4HZIA 1CR0A 2V7GA 4RL4A 5D3MB 5FNZA 3G5LA 1LPOA 1NFRA 3MPOA 4LWZA 4TXJA 5F23A 2XWJI 3LNCA 3OU2A 2FGKA 3FFTA 3UMMA 4A6PA 3L4EA 2EBWA 3MJRA 2X14A 3RRZA 1AKQA 5BQ3A 3LYUA 4K0RA 4OOFA 1E1YA 3UAGA 4F96A 2CD9A 2P90A 2ZW9A 2MIIA 3ETGA 4YMLA 4F3TA 2H4WA 5DOVA 3X1KA 4N76A 4H7IA 3NJRA 3A28A 2NP6A 4EUSA 5KAMA 5FTJA 3GVXA 1DT3A 4ITUA 4CQMB 3GVIA 4OIFA 4WERA 1NVEA 4BN0A 5IUJC 3CH7A 4XWKA 3COZA 5TPWB 4YRKA 3K70C 4R9RA 1NJ6A 3BK1A 1WXWA 2ON6A 4I5DA 5BN3A 1KI7A 5TLSA 1KERA 3PNPA 5JDIA 4C6SA 2YWRA 4MWTA 3AB3A 2W2OA 3RAGA 4ABYA 5FBVB 2FZWA 5CAEB 4ALMA 1QOQB 5KYWB 3VOBA 1PQ4A 4B3TB 2JFFA 3KKLA 2ZS8A 2OSVA 1RE0A 3VAYA 4EW6A 1T4BA 3BJZA 1UODA 3UM9A 1UT8A 2HLDD 4IQGA 2FYTA 2PRYA 5H16A 3C8HA 1GZUA 5U4XA 1WNTA 1S5PA 4FMDF 2PANA 1AKMA 1WO8A 1G8FA 2OFWA 4WL0A 1PV4A 5HW0A 1BVHA 2KQUA 4MA0A 1TIKA 1AUQA 1O4WA 3FGZA 5SZHB 3VJLA 3KZNA 1WCWA 2VHWA 1VOTA 3V8MA 5HKAA 4PG7A 3UJ7A 4UFPA 1XMPA 4YEDA 4RULA 2C07A 3GGJA 3AR4A 3OZAA 4GR9A 3C3XA 2H1FA 4MHSA 5EJ9A 3X1WA 1R9JA 2BKUA 1T15A 2VHXA 2VZEA 3MLEA 1FRQA 1E5XA 3GAZA 1V6AA 4BMYA 1BVUA 3G9XA 2H4FA 2QX7A 2DKOA 2R6AA 3ZCQA 1SXJB 2QVCA 3DGFC 3LFHA 3LY7A 3N05A 4W9RA 3DBHB 5H5JA 2NNWB 1BW9B 1NHGA 5JCOA 4DJ5X 1YR2A 1VTKA 3LC7O 1N2CA 1SCAA 5BWOA 2NU6A 4JJAA 3DF7A 2CNBA 1VHWA 2NO7A 2QGNA 1IUKA 1JLLB 3IB6A 4QT0A 4W5OA 4G8CA 4L78A 3LVBA 4BLWA 4OU5A 1KGDA 3KVOA 5EL0A 4N5IX 1KOLA 4UARA 1T26A 1K6XA 2Y68A 1DG1G 2PFSA 3K0CC 1FRNA 2CWWA 4N82A 3D0QA 4PYOA 1V1RB 4R7GA 8GPBA 3DE1X 2C97A 2B6NA 1HRKA 3LJKA 4TOIA 4YO8A 2HJSA 2V3WA 1NNI1 1HI9A 5AKEA 3JCZA 3S2FA 1U8FO 2WF7A 1HQYE 3ZZNA 5JXJA 1RQ7A 2XJ4A 1RHKA 1B8PA 1ST2A 3YASA 5LNK6 3HJRA 5LZ2A 1EFCA 1OCEA 1QCZA 2JIPA 4C43A 3I04A 2HCRA 1CIVA 5E6SB 1U0EA 2QLNA 1IUNA 3HHEA 4KC0A 1QC5B 3GH3A 4EUHA 2FLKA 2R96A 3S5UA 4F72A 1VPLA 4IOKA 3TDNA 4R7ZA 4AMGA 3ZE6A 3I0MA 4QL3A 5EINA 1R8YA 1IQPA 3A1DA 2GD6A 1PUXA 1V5IA 4TT3D 3L02A 4X3CA 5HK9A 1YBAA 5AI6A 3PNYA 3R5KA 2IA5A 2EW8A 1KO5A 3IQHX 1Y6RA 4WZBA 2B37A 1K7SN 1USWA 2Q3JA 3FE2A 2Z98A 2OD7A 4M1YA 1F3LA 1XZ8A 1V96A 4H7DA 2WZQA 3OPYA 3SC2B 1K08A 2F7SA 1JPUA 1L4KA 1Y34E 2R1VA 1WZUA 3R3ZA 4NBLA 1R37A 1RHUA 2REQA 4WY2A 2PBZA 4DJAA 4V1CB 1CQPA 1X94A 3JQ8B 3L92A 3L7DA 4XKJA 2V54A 3F97A 4MUHA 2JJ1A 4WV3A 1WCIB 2AN9A 4V0RA 2FFHA 2P9FA 3HGMA 2YJGA 2DTDA 2IH5A 2ZBGA 2XHZA 4J4TA 1YQEA 3SEQA 1RDFA 1L5SA 2OLKA 3BWMA 3UV7A 4E1BA 1RLOA 2A0XA 2WT8A 5FUXA 4I1YA 4ZDWA 5JS7A 1QRUA 4MUMA 1CDEA 5DK4A 3ZI0A 1XA0A 1ZZEA 2GN2A 1QORA 1COZA 4X20A 4BFLA 1D6SA 4MIOA 2IK8A 5AJTA 3OJWA 2AFHA 3NHYA 4Q3DA 2YZNA 3AHDA 1UOEA 2WG2A 4MLDA 3FHCB 8ATCA 3TIXB 1QU2A 3W7VA 4J1NA 4K88A 4TV9F 2WQZA 5BT8A 1EVEA 6PFKA 3QPWA 1NVDA 3MT0A 1PT6A 2C59A 1IUPA 5CLLA 3KFLA 1UMCA 2Y1WA 1VB5A 1N75A 4TXMA 2OD2A 3BHIA 2JDIA 1CXZA 4UBOA 1PJBA 1PHPA 5BN1A 5B4TA 2X4DA 3GP3A 4MR7A 5JNVA 2ZM5A 1ZUD1 4HLQB 2A7XA 4KQKA 1MC5A 2CK3D 4MWBA 3IKLA 4P93A 2ZI9A 4RDHA 1J70A 1ID1A 2W48A 4IKOA 2H59A 4RORA 4I9FA 5T6MA 3S29A 5CCXA 3RAFC 5JD4A 4BECA 3D6UA 3LQ2A 5BVGA 1ILWA 2WWXA 2XNCA 4JELA 3OT1A 1E58A 3TZ6A 4DIFA 1M54A 4BTVA 1TMOA 3RK1A 4RK7A 3NUZA 1V3VA 2W6JA 2OD9A 4GYKA 3OY2A 2B5WA 3LXUX 2J3DA 4YCMA 4WXRA 4G2TA 3QA3E 3H86A 2YV1A 3BTOA 2DWPA 2JGDB 4CEJA 2XYRA 3PZRA 1M5UA 1NAHA 2H16A 1QK5A 2AKAB 2Q2NA 1FXWA 2QB5A 4KIGA 5GONA 4DCSA 4OP2A 4P83A 5FI3A 3RYIB 1ZXLA 2CC2A 2W8BB 4BV3A 1UJ6A 4DV0B 1XEXB 3OE7D 1T9HA 3EYAA 4Z0TA 4FGUA 3GLGE 3U3OA 3TCNA 1GITA 1VDMA 2YV5A 4X45A 3K32A 1XLVA 4YO7A 5G0WA 2HJRA 4G0PA 3NYRA 1WTAA 3V42A 1PVDA 2XE4A 1TAQA 1ESEA 4DV7B 2YDXA 2WABA 5AKLA 3V8BA 4ARAA 4LVNA 1HO3A 2ZUSA 4O25A 1O5OA 2AFIA 3KXPA 4X85A 2ZTLA 4HUTA 5CVVA 1EVKA 2PFGA 1OZGA 3BMCA 4P82A 4ZHSA 2PQ0A 5HSGA 3OEYA 2C2MA 4WLOA 2CY0A 4B6PA 3ZXSA 3AVQA 4LQCA 4IDFA 2D7CA 1D0SA 1JS1X 3IV7A 4DMKA 2OWDA 2CV1A 3BFXA 2IEGA 3C8UA 4ZD6A 2ZBVA 3W9YA 2PTGA 2NUAB 4FHFA 1NT4A 1ZEJA 3DBIA 5TT1A 1ODTC 4JLWA 4XB6B 3TQIA 4CLOB 1BJKA 1RPNA 2VYVD 4IZIA 3N0RA 3VSAA 1WUJS 4PNHA 3WGQA 1Y33E 2JFNA 4RIIA 3Q3IA 3DXXA 3F4BA 2AYYA 3DMHA 1V5EA 3A4LA 1U98A 4YJGA 1XF9A 4HNAA 1JB9A 4EATA 4G56A 4YQYA 1QIMA 1SWWA 1GPDG 3WMWA 3K0CA 3EK2A 2IYTA 1TYAE 1NVMB 3OO1A 2YJ3A 2GYYA 3WHLA 2X15A 3K20A 4RBNA 1BAPA 1RKVA 3WGVA 2L82A 4U7TB 3WV5A 1L1RA 4CR7A 4DC9A 2PWBA 1GWNA 3F7NA 3ROPA 2IY9A 2B36A 1T0JB 2BFPA 4BV9A 3I6IA 4AWXA 1WVMA 1EUDB 3PHLA 2J4CA 2NADA 3EC7A 1RAFA 2P5SA 4GPTA 5H02A 2FUCA 1QQBA 2F1RA 1Z0DA 1W0KD 3F9RA 3TPZA 2BFOA 4R84A 4BO4A 3OPNA 1SVIA 3TEMA 4C3ZA 2QRUA 2FP4A 4KI0A 4DTCA 2C7GA 4HVAA 3ADKA 1JFLA 3KPYA 4M1TA 2A5GA 2HU5A 3C6YA 3MG9A 3S7ZA 3CSUA 4NTZA 4Q82A 1EDBA 3QPDA 1OFIA 1PGNA 1LSSA 3E9EA 5I4BA 1BVYF 1IBRA 2RH4A 2BEUB 1SCUB 1V95A 1WY5A 3GV0A 3I3SR 3M1IA 1JHPA 3N28A 4B83A 3QF7A 1UOOA 1CZKA 5JADA 4EPTA 2C8KA 3U17A 5M29A 4BNLA 1KYIA 3UWKA 1FDVA 4RTSA 3ONWA 4KMSA 4TS4A 4UTOA 2JANA 2ZJ7A 1LZKA 3MHTA 3HXKA 2AW5A 1R6XA 2GK4A 2WD9A 3ILYA 4ZT6A 5BN5B 2OBYA 3LKZA 1UWCA 3K5HA 1AHHA 3WGMA 3LWNA 1A2OA 1W0JD 1J00A 3IR6A 1HKHA 1A2KC 4MS3B 5CXXA 2CJFA 1WETA 4AD8A 1SEPA 4TMKA 3BEDA 4KLNA 4GGOA 3ROXA 2WPDD 5FB3A 2XUKA 3KNZA 5JANA 2Q1TA 3N1UA 3W5HA 4YMVA 2HHJA 1K6IA 3UJ6A 3TEFA 3VZRA 5FPKA 2TMDA 4ALIA 4IO1A 4PLHA 3BHNA 4YECA 3QK7A 3GC6A 2H51A 2OLEA 1W36D 2O3QA 4IRMA 3DL4A 4D5GA 2ZT8A 2HMWA 3EWAA 3CVWA 1W36B 3TQQA 5A3VA 4YR9A 1QF6A 1GNSA 3MT7A 1YDMA 1DAEA 1QIDA 2WIFA 3E2PA 1NHWA 2OV1A 4JL6A 5AVVA 3GZTB 2I2XB 5FTMA 4ZJZA 1G5IA 2WWHA 3ESDA 5BW4A 4PLTA 2FUKA 4AZ3B 4M1KA 1G8GA 1JNYA 3TM4A 4H17A 5F3RA 1Q0RA 1CB7A 1YUBA 3IAHA 3RU9A 1U11A 2GCNA 2XH8A 4UNRA 3R0QA 4TYQA 5BSVA 1HG0A 4YFYA 2ZS9A 4UDNA 3DC2A 2DUNA 3RSFA 3T7RA 4J1QA 2QOEA 3AM5A 4R5HA 4TV8A 5DP1A 4C1NA 4I55B 3AINA 1FFXA 3LWBA 4B2LA 5KCZA 2XD9A 3RYCA 2CFSA 2X2FA 2NAFA 4V0MA 3COVA 4CTMA 4UNPA 5BN3B 1EP2B 4JKIA 4KIJA 2QL5A 3GQBB 3B6EA 1G20A 2HA3A 2J7KA 1Z34A 5HRCA 4X6XA 3LYAA 3AJ9A 4RHCA 2Z2ZA 2RJNA 2ADMA 1XCJA 4AG5A 2A94A 3GUUA 3O3MB 5DTRA 1YB1A 2B82A 4KBGA 4EL5A 1VYVA 5C18A 4XPIB 1O0SA 1U0NA 4ND4A 1BA2A 4UQOA 4EA9A 2HHCA 3AHIA 3VPCA 2WP8J 2PKRA 3P45A 3USES 2NVBA 3OM9A 2CFCA 2QGFA 1KYYA 1Q1AA 1ABFA 1ICEA 1YIAA 2BFWA 4FEEA 4WT7A 5JAQA 3N39C 5JC1A 5CYOA 2QLMA 1CUEA 5CM2Z 1CQJB 2ZUUA 3TBKA 2W2KA 2SKCA 3WGJA 2RK3A 2YS7A 1SPXA 3EDRA 4G3XA 4NENB 4JI3B 1IWPB 3EUAA 3FTNA 3TD6A 4DRZA 3D6NB 3KXKA 1M1ZA 1KAQA 5HCIA 3X1MA 1M0WA 1JDZA 2M2IA 5EQTA 5ILQA 3U2QA 3UHPA 3CNOA 3CKLA 4Z9AA 5T5QA 3EUWA 3ZGVA 5KS2A 1O95A 5B1SA 3NDJA 2H9IA 2RKOA 1Q22A 5DCUA 2DQKA 5BO5A 3RRNA 3PEYA 4TYYA 2CZQA 3LT0A 3BTSA 4KAFA 1YR8A 1P0CA 4PSKA 4YAEA 5A7HA 3WBFA 4D9EA 5G40A 3OFSA 2E2WA 2GZAA 5AI9A 3QEMA 3TECE 4L3WA 4Q3KA 3HYSA 3WK7A 4CKCB 2ZBFA 1EK0A 2H4YA 5AESA 3UBTA 5HMMA 5D3QA 2Q29A 3B82A 2R8ZA 3BJIC 1KI2A 1EK5A 1NQAO 1S2IA 2AG5A 2G40A 2H18A 3G5MA 3O8NA 5D86A 1SVNA 1SHKA 1UZLA 4DXDA 1YCGA 2IYQA 3MRVA 2CFRA 4TL7A 2NUTA 3A3KA 5DNDA 3WJAA 5BRAA 4CMHA 4YUZA 4U5XA 5JSUA 4F97A 1T1RA 4MK4A 3GLTA 1I51A 3AEUB 4LDQA 4FXOA 4HUJA 2C8VA 2CNWA 2TRSB 4TZTA 5IWCA 3AF2A 4LJAA 1NE2A 1P73A 4N5HX 3ANXA 4Q9KA 2QRPA 3VVCA 3ZCRA 3A9WA 4F4FA 3ZD7A 1D2MA 4RCYA 1EGQA 1LJ8A 2XCOA 1QYRA 1USGA 2LV8A 1BEUB 4RTPA 1U2RA 2EAUA 3P0HA 2QDXA 3EIQA 1PZNA 1W19A 1NV8A 3EF0A 4LV6A 3RIEA 3SSOA 4TKMA 1GAQA 4DCNA 2MSNA 3PJRA 4LY3A 1WDWB 1E2DA 1EGAA 1A5BB 2Q6OA 1C30A 1FPQA 2WAXA 3HSSA 2K2WA 3OZGA 4JGIA 2B99A 3QKTA 4QU9A 5B7QA 2H3HA 3AIKA 1L7XA 1KK3A 1YASA 2NACA 3G7UA 2XI4A 1MQ8B 1X0XA 2AYXA 2C99A 2V9CA 2V96A 3Q8XB 5CBPA 2HYDA 5ICFA 4S1VA 2BF7A 1XAIA 1EWTA 2ZZKA 5A7FA 1J9GA 3PIDA 4G0OA 2E82A 4XDYA 3VU3A 3AR8A 4OUDB 3I9V6 4QEZA 3B7WA 1T6YA 3BXOA 4GOXA 4UPDA 3SZMA 5TVKA 3OKCA 2ZBUA 5H3HA 1ULHA 2OORC 3BMQA 3JQ6A 1W94A 1I4TD 2LE0A 4N9WA 4UCWA 3ILHA 5CHYA 5HQTA 1R8SA 2BBWA 2YQ4A 2QLBA 1QZZA 3DSRA 1H2BA 2IKSA 2LKCA 3D1JA 2QP3A 4Y0AA 3HXQA 1EWVA 3RSOA 2SKDA 3G2QA 1IN1A 3INNA 2DWOA 3A2NA 3AR6A 2FEMA 4R2KA 1K89A 3UUGA 1TYEB 1XD2A 2BMJA 3TLMA 4BP1A 3WLIA 4MQFA 3ANLA 1UADA 2P77A 2W4QA 3GRYA 4F6LA 3N6VA 1FX0A 2FPXA 4IY1A 1L4HA 2GZ3A 5BV0A 3LRTA 1ENOA 2WUDA 3LC2O 1YZGA 3D5TA 4GSLA 2DFTA 3LHSA 4O4LB 4B33A 4D9CA 1QFZA 3C87A 3PENA 5JPCA 3KQKA 5CJJA 1RPAA 1MW8X 1ABEA 1PD1A 2D06A 3JZDA 1L8QA 2GVDC 5JWOA 2D8AA 4AJHA 3KUKA 2I4OA 3OM0A 1RXWA 3PXGA 3HCFA 2ZWAA 3AB7A 4R8RA 4YROA 4E14A 1FEZA 3IA2A 1PZXA 1HFKA 1QMGA 1CJVC 1PFQA 2GTIA 2P79A 3DAOA 2J46A 5IVKA 5DLPA 2CDCA 1NLUA 1GHTA 2VDVE 4M22A 1YUNA 3EPRA 3B2NA 2GTHA 1Y7LA 4QDKA 1Z6AA 3TR5A 1RP1A 1A69A 3E8MA 5E95A 2PX2A 3JQPA 2ZKLA 2NN3C 2IU3A 4RMIA 2VJBA 4UHCA 2RAFA 4GP9A 4PLPA 3HCOA 3TOSA 5IBCA 4YRPA 4BMPB 1KE1A 1QRTA 2XMCA 1CRZA 4PLWA 1KKMA 4LXTA 2NSJA 1UJBA 2NXWA 1TJNA 5LUAA 3BT7A 2P91A 1C4XA 4PX9A 1D7AA 4BLTA 1JIVA 2FJPA 1OWOA 3QSGA 4GF5A 5DV9A 3RAJA 2PQ6A 1XYGA 4B71A 3JYNA 5AKYA 1A7JA 1ZD3A 2J5KA 5F1PA 4IJUA 5AJYA 3SEAA 4DV4B 1H8EA 3RVQA 2XQFA 4IMIB 1MDFA 1MPTA 4KODA 5D7NA 2C83A 5IXJA 5JZOA 1DUIA 4CIDA 4F6RB 4QFMA 4BBZA 1ZQ1A 3QVSA 3KOMA 3KXDA 1A0OA 4JJGA 2IEIA 1Z8NA 4MXDA 1PG5A 5JHGB 5CB0A 3DOFA 1BEEA 5F7OA 4LZZA 1QV6A 4FSHA 3MCVA 1G6KA 4XIGS 5ECWA 3RFUA 3HB4X 1M67A 4K26A 2EJCA 1H1LB 3I2GA 4OG2A 4RY0A 3QBEA 2XIQA 3QJ5A 3V2IA 5KNDA 4TL9A 3V7YA 3GJZA 1PR6A 4ZEWA 4E88A 1N2IA 1SC9A 2PGOA 3O8CA 9MHTA 3WTBA 1M7BA 1L5LA 2VHJA 4M9RA 5T7BA 1GG9A 2GQ0A 3PUKA 4BB6A 3HJFA 4F4DA 3KVNA 1VI2A 2O5VA 4PYLA 3WB2A 1ZN9A 3NIBA 1EFRD 4LJ4A 5GY7A 3RJ5A 1OU0A 2Q4OA 2HH9A 3GGSA 3KTAA 1QR2A 4PO3X 3UWDA 4C4PA 3ECAA 4YJ3F 3BXGA 4HAVA 3RFVA 4MJLA 3L7YA 4R8SA 4B3DA 1YOVB 2RHBA 4RS4A 1ECFA 4MZXA 1AGXA 1JVNA 1MQ9A 1DWOA 2YN0A 4KQCA 2JIOA 4UNSA 1ZW6A 2NSLA 4ZCRA 3AF5A 4M9CA 4CM5A 5J4LA 3K8QA 4KQ6A 3Q40A 4NS1A 5K0LA 1OILA 2AEFA 4DRYA 2CCGA 3ZHZA 4LMPA 4IHQA 1PJRA 1T5TA 1MT0A 1RI3A 2O0JA 2W90A 3M2PA 3NPMA 2OA0A 3CZPA 3CUTA 1Z0KA 4E22A 1DX4A 5H3LA 2AL7A 2JCBA 1JJVA 2OC9A 4QJ5A 1E5LA 4C4AA 1KO7A 4F5EA 3NDPA 1Y6ZA 3DH0A 1ZM4A 3K0BA 3MPUA 4OJKA 3S68A 3HCDA 1XZCA 2CJWA 4C2AA 2ZR9A 2XZPA 1Q0LA 1U2GC 3GJ6A 4LTMA 4K05A 4YB8A 3ZJ4A 4DYDA 5B64A 2FX3A 3HCRA 3EW9A 2RMKA 2WA1A 1MENA 4CG3A 4DIEA 1VPVA 2XNJA 4V2IA 2WA2A 3GRCA 1B76A 1IMOA 2F59A 1R9MA 3KDSE 3L46A 3WFJA 1KTVA 2EW2A 1AV7A 5JU6A 1M2EA 2WYHA 3BSYA 1R0CA 3D81A 3SXUB 4R2HA 4R1NA 4RYLA 1ZBDA 5D6NA 3ORQA 3W2FA 2VH5R 3DOHA 3V8RA 4L6AA 5HIAA 5KWIA 4YDHB 1TGVA 3KTDA 3T9CA 2IXAA 2VDWB 2VS1A 4JLSA 5AI4A 3RKRA 2K7FA 3QEAZ 3IBYA 3WL7A 4KE6A 1PG2A 1GKKA 2IXDA 2WBLC 3V1TC 3RC2A 1CJUC 1Y4AE 3QELA 2J3MA 3G85A 4MUEA 3O38A 4RD3A 1YJBA 2OORA 3HYRA 1CUUA 1E1LA 4QU5A 2R8RA 2WG0A 3AH8A 4R1OA 5AK3A 3PX2A 2JKVA 5FKJA 2X42A 3WDSA 3QBDA 1F14A 1LK7A 1N4DA 4H3SA 2OZPA 5CXUA 3UWMA 4MAMA 2CLHB 4MB2A 1C7RA 2RGNC 3DE2X 3KRTA 4F6CA 4BMSA 1EM6A 1RYMA 3D7NA 2W43A 5GGYA 5FA8A 2C77A 3BRWD 3KB6A 4RWZA 2XV1A 3SQLA 1PT9A 4GSKA 4X7PA 1BXZA 1GPNA 5K3DA 4C5CA 3TAUA 4ZICA 1U63A 1AGYA 1YS9A 3BIWA 3F98A 3A8TA 1DZ3A 4RPGA 4FR0A 1I7QB 3N2EA 1TU3A 3PDJA 2FG6C 1EGVB 5ABPA 3AONB 1P7YA 1WHTB 3FSRA 2IL1A 4JBXA 5BQFA 1DRWA 2GLXA 5KSWB 3DVRX 1GTVA 3P0RA 4KE8A 4NPCA 3MTEA 2VJOA 3EIFA 4YGXB 4A6XA 1XZNA 3VUEA 4KLZA 3C7CB 4UUAA 5AKIA 4BPRA 4WLUA 2PVSA 3IHTA 4WXHA 4FMCF 3NZEA 2R5NA 4D25A 1IPFA 2OAEA 5HWSA 4F71A 1XQYA 3NC1C 3TMKA 4PAOA 8AT1A 1V5FA 1H2YA 1FLAA 1IC6A 1KZYC 4HBGA 1Q1QA 2WVGA 5JROA 5KB3A 1M6VB 2GBPA 1DIHA 4J0FA 1CR1A 4C6TA 2P3OA 4DIMA 3ZDYB 1Z13A 4FOTA 4WA8A 3Q5GA 4XI9A 3IMGA 1NXPA 1XQ9A 4L28A 2X13A 2DHQA 1ZOPA 1PX2A 1DBQA 1L4GA 1J20A 3QE3A 4MUFA 4QFCA 2VDOB 3KYIB 1WB9A 2ZITA 3OE5A 1G16A 1GKUB 1X9HA 3C6XA 1Y1QA 1H9AA 3RB8A 4Q3OA 2FVXA 1ZL0A 1T13A 1DAMA 1Y9EA 2C0CA 3FZGA 3GIDA 5COAA 2C82A 2X4IA 2AB0A 3EZXA 3BXEA 5H80A 1RXCA 4FOLA 1PFKA 2PL9A 5GONF 1B3RA 4MCJA 2FGJA 2HIAA 3D4NA 4OV6B 4U2EA 1Y8QA 1A95A 3RS3A 4DCUA 2P5TB 1E5TA 2XUIA 3K4HA 1DTWB 1QG6A 2PJRA 4QSHA 1L9KA 1RZRD 2M98A 3AY7A 5JW6A 3VC2A 3ITDA 1TRHA 3UUWA 2BYTA 1AJEA 1JXQA 3GR6A 1EESA 3V3KA 2GVZC 4H6PA 4KXUA 3T3DA 5JWRA 1N0UA 2A9RA 1CJBA 3VZPA 1KIMA 5LQCA 1Y37A 3H13A 1NI4B 2A5FA 3SJBA 5K0SA 3OHMA 4N03A 2H63A 3EFOA 4YV0A 3RUEA 3FHLA 4DDTA 1JDBC 4QQFA 3WG9A 3IRUA 5CA1B 2GBCA 4HWTA 3F3KA 3CR3C 2QTVB 1SOVA 4F4UA 4MPTA 3PF9A 4AY6A 4JDUA 3CKYA 3AP1A 3GI1A 3LY9A 5EJ6A 4U6NA 1C9EA 4CPDA 2ETVA 1VSUA 1I1QB 3GZJA 4MVWA 1K9VF 5CDTA 2R6CA 5G2OA 2BHRA 3LUKA 1KQOA 4LF9B 4AN1A 1K0FA 1NUSA 1O6BA 3ROTA 4QBHA 1JR6A 1KY5A 2C9MA 4QFBA 4TKVA 1CUBA 3EGOA 4PZLA 2EJTA 2GTPA 3JD3A 2GM3A 1N33B 3ZLVA 1DBIA 3TTSA 1Z7GA 3RS4A 1KJNA 3KAQA 4M4SA 2ATEA 3FPFA 3PEEA 2I4NA 3NX4A 4PTLA 3UJCA 1LB1B 2FH5B 1EIWA 3FLEA 2YV2A 1P0QA 5FJJA 4AVYA 1JHDA 1YU9A 1KI6B 3TFOA 4RFSB 5I8PA 2LVBA 2VSFA 1ZA2A 2YFQA 5G1OA 3HYTA 4MKXA 5B1IA 4NYJR 5H9VA 5U9CA 3UXHA 3K0AA 3PJDA 1JG6A 1VSBA 5TMDA 1NN5A 2XY4A 1C0LA 1WOMA 4UMDA 4Q9IA 3ND8A 3PFGA 1NWCA 2MSKA 1KPHA 2VJPA 3EIEA 3LSTA 3VSDA 5B3JA 2J41A 2ZJBA 3EZ9A 3PUZA 2B35A 1U2GA 5TGTA 3PQ7A 3KYBA 4FONA 4B9AA 4BY9E 3DAHA 3HWRA 3OTIA 1H1TA 1QCCA 4P81A 3OCUA 5FBWB 3VSBA 1KVUA 2FQQA 5IABA 3AV3A 1E7WA 2JGJA 1OWNA 4D79A 4WN3A 1QX3A 2Q5EA 1VIDA 3WOHA 2F9FA 4DIOA 3KQUA 1I4DD 4I3FA 2PUVA 3BJRA 1U8UA 3DDWA 5IDXA 4DGSA 3LRPA 1PZGA 1NSFA 4YWHA 4GL2A 1AQLA 5TF4A 3BMNB 4G8JA 3B8HA 2P6MA 4YRIA 1GG2A 1ZRSA 4OM7A 4ZT5A 4ZOLF 4EJFA 5IYZA 5K3FA 5I9NA 1QRDA 1FVOA 4R0MA 2GKGA 1J1IA 3BMXA 2HM7A 4MMYB 1X92A 2FZ4A 3FOAA 5AHWA 5AVZA 4YAKA 3KQHA 3Q2IA 4NFYA 1PYGA 2YMLA 2JAXA 3V97A 3GLKA 1PKEA 4UW9A 1JLRA 3A4YA 4CMCA 4MVJG 4EIWA 1X3SA 1NSTA 1PZMA 4UVEA 4J6EA 1NVXQ 2ZRDA 3ZHCA 2Q7XA 4BWYA 1LDGA 2UYCA 5A9SB 4JBNA 3W8NA 1GDHA 5IASA 1ADGA 5PGMA 2RGNA 1MEOA 2IPAB 1NOKA 3L7OA 1YZ3A 5FOSA 3T5BA 2ZJYA 5HF5A 5JQGF 3C45A 1EVLA 4ZARA 1YS7A 4BRSA 3IVAA 3F7TA 2RHGB 3SQMA 4BATA 4MWDA 1J25A 1SC6A 1EK1A 2JBAB 3OPXA 3R6TA 4FR2A 5TR9A 4GI1A 5KNBA 2GCGA 3RI3A 4RTLA 2Q3EA 1NP6A 1YACA 1L8AA 1PG0A 4HB3A 1WZCA 3AVOA 4FWBA 4CNBA 3A2KA 5JJCA 3DCYA 4Q0MA 4Q7KA 4DR4B 2WI8A 1WP9A 1KKUA 3ECSA 3PNBA 4GOKA 2P0YA 3Q9SA 1NW4A 3PX3A 5TMBA 1KMNA 1U94A 3F8TA 5DU2A 5BRJA 3KJFA 2JK1A 5KOJB 5JSYA 3D54D 1IEVA 1ZC3A 1Z4MA 4B82A 3FH0A 1PI3A 1XX6A 1S3GA 3FFAA 5H4HA 4FDUA 4GPAA 3UT5A 4F86A 1CY7A 2RIRA 1REQA 3OJCA 2FWAA 3IBFA 4HUQA 2XXAB 4G8DA 3RFTA 4ARVA 1AX9A 4GC5A 2G8NA 2DQYA 4TTVA 4PS0A 3DLPX 1KAHA 2AVDA 3HKEA 3CH6A 3LFUA 4KAJA 4MJ7A 1WB5A 2D2XA 2R8EA 2HSGA 3QTTA 4PVCA 5A2QA 3LTNC 2AOVA 2C61A 2QW0X 2ZWVA 4IWNA 3ML1A 4G4SO 2HDWA 2Y0EA 3PZBA 3U13A 2HW8A 4BWVA 1NW6A 4JEMA 3T5PA 1MVLA 1K1EA 2YWJA 4YMGA 2CVPA 1I3KA 3O7WA 2XNHA 4MUNA 3SGLA 4I99A 5IVPA 3U16A 4B6GA 2DSNA 1WCV1 4XOIA 2FZKA 4DMLA 3OLYA 3TTVA 3W34A 3N3AC 5TQJA 3A70A 3H5OA 2O59A 5J4YA 3DJYA 1ZJYA 3K2IA 1H5UA 1JEAA 3DMDA 4KVGA 3NM6B 3M6FA 1Z5PA 4LRTB 2C0QA 4ES6A 4CKWA 4EYEA 1S96A 2CN1A 4MRPA 3TL2A 3ELWA 4OHFA 4WOJA 2OVFA 4BMDA 5IJWA 4ZIRA 1V1MA 2JCGA 2OXRA 1T91A 5ALGA 2XQVA 3O3CA 1DXOA 1TIBA 3D3NA 3WZLA 1A9QA 1BEZA 3CB4A 1YI1A 2Q5HA 5DGHA 5L7WA 1CJTC 2FE4A 3VVBA 4MRVA 1M0EA 2VPZA 1GGMA 4TSRA 4CZ2A 5KPDA 1PYOA 3ZNPA 3HKBB 3IIJA 4Y30A 5KDLA 2UZ0A 4L7VA 5LUBA 4D8YA 5KTSA 5CVUA 1MR3F 1ZH8A 2NVUB 3PITA 4FYYA 4FI3C 1JFFA 1K8XB 1R6VA 3WWEA 3E1GA 4BCCA 4XWOA 2NU9A 3A3YA 1HQDA 3HWX1 1R0ZA 3EW7A 3VJMA 4QQNA 4RU1A 2XDYA 4R9VA 4E94A 4ZCSA 3B1JA 4WKBA 5AT1A 2ONYA 2EATA 4RAQA 1JDJA 4RZSA 4WN9A 5DW3A 3U4HA 2HA7A 3ZIAD 1TQ4A 2PUCA 3PHGA 3AESB 3V00A 3N6RA 2WDZA 4BO7A 4CGYA 3CW8X 2IS2A 2ECKA 2O05A 4UJ5A 1ID8A 2KW5A 2RAUA 4L72A 3KUDA 1FB5A 5HGJA 4BNNA 3RSCA 4GOMD 1C2TA 2HQRA 2QG4A 1XF1A 3U60B 1KJJA 1SFRA 3GLGB 1PTKA 1K98A 1ZO8A 3T52A 1YK0A 3TN7A 1UQRA 1C9KA 4J43A 1O5TA 3QF4B 3DZCA 3BULA 2CJPA 2IT1A 1MV8A 2W6IA 2XLCA 3I04M 3QW4B 5CU7A 5JCPA 5F3WB 3HY3A 4X44A 1VLJA 3L01A 3CSSA 4L8FA 4LBWA 4NC9A 1JQEA 3G8DA 1BHQ1 3P9SA 5J5VA 4ZDKA 1VIMA 3OWXA 4K6KA 5HKKD 1T6BY 2ETXA 4EO7A 1CYEA 2II6A 2J7PA 2WAAA 5AUQA 1RLMA 1DEXA 1GPYA 1Q3TA 2PBFA 2OQ2A 3OT5A 4FGKA 1OLOA 4PE5B 4Q1BA 4UATA 3WHKA 3DO5A 2CMHA 2BHLA 5SZJA 3GVHA 1YJ5A 1HZZC 2I6QA 4L4RA 1EB8A 4WBXC 2ZYGA 3OICA 1Z62A 1MABA 1NY5A 5HEKA 4LSMA 1P91A 1FUIA 2C78A 1CJKC 3AHJA 1CQZA 3C3YA 3D3KA 4FDAA 4UXHA 1C4WA 5DEOA 5IX8A 2FN9A 4AN0A 1L1QA 1QNFA 1WLSA 4XUCA 5LP6C 4JEHA 4BGVA 2R79A 2X19A 1F06A 3MMZA 2IYPA 2WJPA 3S6JA 1XVVA 4WCFA 4JWKA 1PFWA 1TQHA 4RZQA 1RPJA 1JYFA 1VZ3A 2GJ4A 1DEKA 3K0KA 2KI5A 7REQA 4GUAA 3TXAA 4GYWA 4I66A 3ND9A 4JVOA 5DEIA 1EQUA 2HMSA 1G42A 4HWPA 2Z95A 4OJTA 4JSTA 3L6DA 4Q1FA 5JTUA 1NIPA 2F00A 4J2HA 1RP7A 3BE6A 3ULKA 4FB4A 1GFZA 3OLCX 4GMDA 4BNIA 3EN0A 4C0XA 1YAHA 4AMZA 4PVDA 2P3QA 1NNLA 2D8MA 4Q4JB 5EKSA 5LD2B 4K9SA 4O4HA 4B73A 4FOPA 5F9MA 1UBMS 1F8UA 2HREA 2Y92A 4K1XA 4N5MA 4C76A 2ZVQX 2CDNA 2ERXA 5AKXA 2GPBA 2FDXA 4TMYA 1IG0A 3CUVA 1FL9A 3GDHA 3FCAA 3K9CA 1N3LA 1GL3A 1EX6A 1PJZA 2AR9A 4GZ3A 5ADUS 5A3RA 2M6LA 3IPYA 3INGA 1LZLA 2GAJA 1D2HA 2CHUA 3LHKA 3BREA 3IO3A 2V7VA 1F17A 3AUJB 3HMQA 1TQ2A 4R3WA 3OEHD 1JH9A 1IY0A 4IGIA 2EARA 3KX2A 1MLDA 1BH2A 1KDRA 1Y5RA 1R5NA 2V4ZA 1GGJA 4M89A 4QNMA 1M66A 4BP8A 2UXDB 5IVDA 2HMVA 3N87A 1OT3A 4BEWA 5LL6P 1UBSB 2JLAA 3M9XA 3BGOS 2YJ5A 5ECYA 5FBRB 1HFWA 4EG6A 2IYNA 1T9ZA 3K5PA 2B4TO 1D03A 1ISRA 1ZCAA 2HWXA 3LHDA 3L8HA 1KI9A 1CUCA 5LMNB 4EAAA 1VGQA 3K8YA 3HBAA 4F04A 5JI2E 4ZMBA 3W3AH 3OC6A 2HUNA 5CEFA 1L9XA 5FLYA 4X8OA 3FCUB 3QWAA 2ZXEA 2VPTA 5JCXA 4TN1A 4A91A 4I1IA 3RLFA 3R1IA 3KVVA 5MDHA 4A1OA 1HNNA 3BSWA 1SR8A 4IHJB 3WB0A 1XZHA 3VI4B 1UJNA 4EKDA 3F9IA 4KK3A 1T8UA 1BQ3A 2ODQA 3AR7A 1MIOA 2VI5A 3S44A 421PA 1KY4A 5GM1A 1IHXA 1MEJA 3OJXA 2DPMA 3I9OA 2WSBA 5C3MA 5F7XA 2JLYA 3C48A 1E0DA 2XUHA 5JT1A 4MICA 5KJ6A 1MVNA 5CPBA 4BJHB 3LK7A 3LDAA 1E62A 1X80A 2DF8A 4YYZA 1VA4A 2LW7A 1E18A 2QMQA 1PK9A 2Y9MB 5KX5B 4S04A 1FBNA 3GDOA 4DR5B 2UV8A 4C2BA 2I76A 1L8LA 2E5LB 4WFKA 4FILA 1F0YA 3QXJA 4NYMQ 5T64A 3TX6A 1DSSG 2V4UA 4N8EA 4ZYUA 3JWIA 2BGIA 1JKIA 5D3KA 3MILA 2BM1A 1NOJA 4BVEA 4NEQA 2HF7A 2X7JA 3CZ9A 4FIDA 3SR3A 1FQWA 1NFQA 3BWEA 4CUZA 4DQUA 2UZ4A 2DH5A 1AM4D 1SUFA 4KPUB 1PN3A 4Z4HA 3I39X 3LYHA 2O7RA 2O7QA 3D2AA 1PLLA 1T0IA 5A4FS 4EF6A 1BXRB 1G2QA 2Q4BA 2KSQA 3A9SA 3DFMA 5BQ5A 3ZI4A 3N2KB 1WY7A 1PV2A 1G64A 3HR4A 1N6HA 1M7GA 2P9JA 3RC1A 3SHQA 3TLJA 3MT8A 4D4GA 5ENZA 3T3GA 1XMXA 1DQPA 4Q18A 2VXBA 1K3UB 3CF2A 2HK8A 3FR8A 2QTRA 4P3PA 4CTNA 1C9YA 4E5KA 3LP6A 2W93A 2ZI5A 4XGQA 3LKVA 2SKEA 3TZKA 5C5IA 1ZGGA 1TNDA 4AL4A 2F8MA 5BRNA 1HYEA 3WYDA 3QBTA 3ZXIA 4G0VA 5LQSA 2BLLA 1Z35A 3CG4A 5B2FA 3U37A 1TU4A 4RLHA 1EU1A 1XTTA 4JD5A 2K7ZA 1NAIA 3OZTA 4AKEA 3LQYA 1KEKA 4YCDA 3AERA 1ISFA 5D51S 5GJWC 3U4QA 1HZZA 3THWB 3PQCA 4DR6B 1TW2A 4OHCA 3H04A 2VNSA 1ZH6A 5KOIA 3UVEA 2G06A 3H3XA 2HWUA 4X0EA 1Y6JA 3SHWA 4ZQIA 3IJ5A 3TUIC 3WHIA 1YB4A 4EMTA 4XFDA 4X1IA 2P2DA 2R87A 3AUTA 3D3WA 4B3IA 3HEBA 4X92A 3ROGA 1CDOA 4MGZR 2E4UA 4M54A 4BE4A 3D6AA 1NG9A 3RU3A 3EMBA 4XGNA 3EEIA 1K75A 2FG5A 1GU1A 2NLOA 4KKVA 3MERA 4B4DA 5LLSA 2O19A 4MDHA 3OUTA 4XYLA 1E4EA 4N7JA 1MX5A 5FOUA 3E8SA 1JPVA 1D0IA 5I7OA 1UKBA 4BN4A 1Z83A 3P4UA 3ZIUA 5ADWA 5ESDA 1H22A 3VOTA 2Q21A 4XPZA 1N32B 3FLAA 2AQIA 4NJEB 4HNTA 2CLEB 5DWVA 2BMAA 2ODBA 3R75A 5I5GA 3UXYA 1WXDA 2B0CA 3AT1A 1Z18A 2WEKA 3BVPA 4LKOA 2ZWPA 4MWEA 3WMGA 1QE3A 3GLIA 2VF2A 1M1YA 4XVCA 3M3HA 2AKEA 5KI6A 1VJ1A 5CLGA 1KBZA 1B2RA 1TQ6A 1Z3IX 2ZYTX 3O91A 4UM5A 3X2SA 2ONCA 3X2FA 3KYDB 4BKPA 4RDXA 4M1MA 1GTJ1 4LV5B 4WKPA 5J40A 3N6XA 1VG9B 4EGCB 3G9UA 4CIAA 1GUAA 1Z16A 4UOEA 4Q5IA 4WK2B 4NV0A 1HRDA 5EKDA 3DE0X 3LA6A 3LCJA 3DLBA 1XI2A 4QD3A 2QV7A 3NXSA 4QOGA 4EKIA 2RONA 1GCUA 1PR0A 3ILSA 2OZLB 3F5FA 2ZAMA 3DZ8A 2QM7A 2JI9A 3KOZA 4DR7B 4CMGA 3LF2A 1OW3B 2V55B 4OLAA 3VPFA 5IVIA 1FOEB 4PHGA 4R3NA 2LGJA 1BWSA 2BKLA 2IGBA 3RBZA 3S55A 3LUFA 4DQVA 5T4HA 2E4VA 4IHKA 2VUUA 4AUMA 4IILA 1E2LA 5DYIA 2BL4A 3TVYA 4N0DA 3KZVA 2VWGA 4OMUA 5DM0A 5IJ0A 4POOA 4DA4A 3GUVA 3I01A 5K7SA 3IUBA 4HNQA 1WJGA 1EX1A 4MP3A 4KWTA 1II8A 4B3XA 4AB1A 3E9DA 2EWWA 3QKSA 3GNQA 3CLUC 1GYPA 1UM9B 3L7KA 4OQLA 2QX9A 1Y8AA 1XTVA 4ZYLA 4BP9A 4GW3A 3LIIA 1VLMA 2HWKA 1UJMA 3F6EX 4XQCA 2J0QA 3FPGA 3WO0A 4ZI7A 4GMXA 4CEHB 1KRWA 1LNQA 2L18A 2P6OA 4ZAWA 3U0BA 3KCQA 4FK8A 4D8XA 4A0SA 2X0RA 1L5HA 4F4JA 1P33A 4M7OA 3E5MA 1M83A 1LSOA 3OLZA 1JJBA 5CB4A 1FLVA 2OCKA 1QANA 2PLFA 4WBNA 2FDCA 2QP4A 2AJLI 4RKWA 4MRMA 4B2PA 1H2ZA 3UOGA 3U7RA 1VP9A 1D6JA 3U26A 4B35A 3GGCA 3OTWA 1OB5A 4MDEA 1JWAB 4EJ6A 1ZUIA 1GZ5A 3PPXA 3FUVA 4QXMA 1MTZA 1L5KA 4Z4IA 1F8FA 1BCSA 1HT2E 2VNKA 2XUOA 1VHQA 1SBNE 3LX5A 1WP4A 1DC8A 1C50A 1KZ7B 3PXBA 1TECE 4FSDA 1W5EA 3TM5A 5L40A 2J9GA 1HR0B 3T1OA 1ZM2A 2OAGA 2QD3A 2OLJA 1OI7A 4XA8A 1UKEA 4D3ZA 3OQIB 1RYYA 4Q66C 3A05A 1UJ4A 4A8JC 2OCPA 4DBLC 1AN0A 1CTQA 1JUDA 2CL7X 2HUPA 2ZIAA 3HNOA 1JAYA 3FVRA 4L2IA 4AWBA 5JI3E 1CEEA 1VJ0A 5ERGB 1IVSA 1UJCA 5BP7A 2Z83A 1M8GA 1Z5VA 4DFDA 2CJYA 2DBZA 3M4JA 4XB1A 1N1DA 2LXNA 5FHRA 1V35A 3BA1A 2BN4A 1XMSA 2QXTA 5BR4A 5JR3A 4DGQA 5I6DA 1KOFA 2B2NA 3DWGA 3I37X 2WFLA 2WD7B 1CQIB 1PO7A 1Q84A 3BKWA 5HUHA 1APBA 1DS6A 1QZTA 5G41A 4NAUA 2OHHA 3WO1A 2XE6A 3QFTA 3E5NA 4M37A 5AIAA 2H85A 4XSVA 2OYSA 3NJ4A 3VOAA 1VPWA 4QXQA 1I9CA 3B1YA 3GWGA 4N54A 4AJ1A 3FI0A 3R7WB 3IAXA 1YJ8A 1A98A 4EEXA 1U7UA 3D0OA 5EZYF 3ROQA 1QRSA 4O5OA 4KSCA 1GLNA 3HPRA 5BSFA 2HY7A 2PZEA 1B6GA 2QE7D 1Z06A 4HYEA 3NHFA 4XWYA 5EWMB 5KHLB 4EH1A 1W47A 2GEFA 3I6MA 1QRAA 3F9CA 1FA9A 3JAKB 1QPBA 1SOUA 3NVMB 3PQ2A 5ADHA 3P32A 4OGLA 1UWLA 3EZFA 3HDYA 2R6ZA 1G5TA 3R6WA 1BOFA 4ACAA 3U4CA 4O29A 1NBIA 3H0CA 4QKQA 4N39A 5ES3A 2AMJA 4AY5A 1TCAA 4LDNA 3ZDEA 3ZDBA 1SBCA 5BOSA 2CXOA 2M1ZA 1N1GA 2IP2A 5D8DA 5KYVA 3AKCA 1C1DB 4NMMA 4D92A 5AW0A 4DG9A 1A9RA 4URZR 5HZMA 1Y4DE 4DMCA 4WAUA 3LMKA 5BURA 3OZBA 3RVDA 4ERNA 1LDMA 3DDOA 1ZQ9A 4ZZ1A 5C8YB 3HFGA 2V7PA 4TWRA 3H4TA 1MUUA 3RM3A 4RF3A 3GNSA 1WUHS 4KYVA 2E55A 1GAWA 7GPBA 2C04A 1C2YA 2HD4A 1RBYA 1PRYA 1V3QE 3I6YA 3TX2A 1Y5MA 2A9QA 4DA7A 5CT4A 4XFKA 1LVUA 4UU1A 1LQ2A 4M8IA 4N6NA 2IPMA 4E2YA 5CX1B 2QN8A 3U39A 3ZY4A 1U2SA 2QZ4A 2BKXA 3ORYA 1CLUA 4IJKA 3U9SA 1AKNA 3DMGA 3JQGA 4RF2A 4LJRA 3C4QA 1BWRA 4Q6WA 5LU8A 3S1SA 2J5BA 5M5BA 1P5HA 3GIWA 4MVJP 1M6EX 2R6GA 5AUNB 5AVJA 4GKBA 2JEYA 3ST7A 1U6JA 1W85B 5TF0A 2WWRA 4F3YA 3AFOA 1UEXC 3PFWO 3AGPA 2HPHA 4L4UA 4LYAA 3RVRA 3V4OA 1DCFA 1GPWB 1LBIA 4GAEA 1V4BA 4BX3A 4H0CA 4WZBE 1CEQA 2RBKA 2DQZA 1GG8A 2I71A 3VNSA 3UO8B 5DHSA 2VZ9A 2ET6A 4R2XA 1L5VA 2FA9A 3H18A 4M0CA 3ZCSA 4BIIA 3P2EA 1O87A 5JECA 1ULTA 4JKOA 2BAGA 3BXXA 4G1VA 4DLYA 3VPXA 5KC9A 1SG6A 1I4EB 1YI0A 3RS0A 4R8KA 4RQAA 1OLXB 1XRRA 1P9OA 3VGJA 3RUDA 121PA 1KH3A 1D04A 1I94B 3DUFA 4PO8A 4FFVA 2J4FA 2JC3A 4NHOA 3VZCA 1Q95A 3D31A 1T2UA 3V4ZA 3KUCA 1WXIA 3UNXA 4C7MA 4V03A 1P29A 4X1KA 3F6PA 4BNHA 2ODWA 3T5GA 4R2JA 2CYAA 1G0NA 1N0HA 1TM7E 4D7AA 2GETA 2HT1A 4J1SA 4PINA 2AFHE 3VNQA 3BXPA 1JZQA 1YZHA 3GCGA 4CN8A 2Z5FA 5CFNA 4GOJA 4TTIA 3R9WA 1JWBB 3A27A 5K0NA 3IB3A 2V6GA 2CLFB 3DXFA 2YDYA 3SC4A 1T1JA 3E9CA 3UAZA 4BS9A 1XU7A 5FAKA 1I3LA 1H2XA 2XCIA 3HU3A 1V6CA 3FPCA 4KDEA 1VIVA 2HCFA 1CIPA 1OASA 1SOAA 3RVKA 1GLGA 1XNJA 4KW7A 1W48A 4EZIA 3AWDA 1R4ZA 4D44A 4BKUA 2RGGA 3EXG2 2C96A 4PV7A 4RVDA 1W6RA 3WIUA 2WUFA 4ARIA 4XUDA 2W22A 4ZALA 1A1SA 4OFZA 4B3GA 4IJ6A 1PEYA 1W5TA 1XTQA 2IF0A 3EPJA 3WWOA 3A1CA 3B38A 3R76A 2XF2A 3S40A 3C6BA 4ND8B 5AKZA 1KSFX 4F06A 3W2EA 4DUYB 4MO9A 3NHBA 3QLTA 4RSGA 2JGMA 4B85A 1CRLA 1TB4A 2H2GA 3K5WA 4OX9Y 1MOZA 5CGZA 4MUGA 2DETA 1XZJA 2WMDA 4F21A 1OZHA 3CCFA 2ZUCA 2RGUA 4JSYA 4PYIA 1DUSA 3Q7SA 5IN4A 4MEJA 4YAIA 2A30A 3TIIA 5EJ4A 5EZSA 4CQNA 3PUIA 1VSQA 4Z99A 5C35A 5M3BA 4JC4A 3SSNA 1P7VA 5BVHB 5HR5A 2JD0A 4IIYA 4XIYA 5EVCA 5JUWA 5MN5A 2I22A 4ARUA 2ID4A 3HZRA 1BWQA 3I8XA 2H2HA 1A9XB 5PNTA 2Y71A 3K6KA 4GX1A 3VQTA 4HFRA 5CVDA 3FPEA 2GM4A 1GIAA 5DXFA 4DLWA 1AKVA 5ESRA 1MO5A 1Q83A 1E77A 2AFIE 2ANCA 3B36A