2LV8A

Solution nmr structure de novo designed rossmann 2x2 fold protein, northeast structural genomics consortium (nesg) target or16
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
110
structure length
110
Chain Sequence
MLLYVLIISNDKKLIEEARKMAEKANLELRTVKTEDELKKYLEEFRKESQNIKVLILVSNDEELDKAKELAQKMEIDVRTRKVTSPDEAKRWIKEFSEEGGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords De novo designed rossmann 2x2 fold protein
publication title Principles for designing ideal protein structures.
pubmed doi rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 41
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2012-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11230 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lv8A00
2KPOA 2LTAA 2LRHA 2L69A 2LVBA 4J29A 2LNDA 2LV8A 2N3ZA 5GAJA 2MR5A 2N75A 2MR6A 2L82A 2LR0A 2LCIA
chains in the Genus database with same CATH superfamily
2CBGA 5LKAA 1UJCA 2EGGA 2EL9A 3IXQA 5EC8A 1T2VA 3Q41A 4HJXA 1L4BA 1BJRE 3DV2A 1IM2A 3GLUA 4U2EA 1N3BA 1RXCA 1WUJS 2GM4A 1G18A 1H0RA 1GT6A 1YR9A 4V02A 3OBIA 1NY5A 5L4LA 4DQVA 5K0JA 2VLIA 3G0CA 4UM8B 1UZNA 3DZDA 4I2VA 4PYRA 2PGNA 1Y34E 2H1FA 4FR0A 1DQSA 1RYEA 2P90A 2NU8B 2P7HA 1RYYA 3NHPA 3AXTA 1ZBDA 3TEJA 5AK3A 5D3MA 1P8JA 2DR2A 1MOZA 5KSYA 1CY8A 1R3DA 2CNBA 2QTNA 2I9KA 3VKUA 2C77A 4RTJA 1Y9JA 5GOTA 4HDOB 1RLIA 4QVKA 4QBFA 1R66A 5EMLA 1TAUA 3IB3A 3FCCA 3MJFA 4ND2A 1B1CA 1JFFB 1QZUA 3A36A 1Z62A 4H35A 2AUNA 1CS4C 1RTKA 1AX9A 1WLYA 3BF7A 4YP5A 4CCAA 3TPCA 4E09A 2Z8YA 4TLMB 1KZHA 2FLWA 3OZSA 3PXUA 1PR4A 2R2AA 1CY6A 4P80A 3CKYA 1XMQB 2C58A 3Q5EA 3LX8A 3QA9A 1TPZA 1MPXA 4HDRB 1FU8A 2ACWA 4NYMR 4C4SA 4WBNB 1WZEA 1QDLB 4A9AA 5LPNA 1UM9B 1X1CA 1J42A 1YZLA 3TLMA 4LF4B 2V7UA 2W6OA 2ISSD 1M2NA 2VYNA 1ZH2A 1FTGA 1T3SA 1PG2A 1FBTA 3G1TA 4L57A 1IHOA 1VB5A 2ECPA 4U2KA 2CKMA 3EIHA 3Q6IA 2UUBB 1NR1A 1J8VA 2OCBA 3LOQA 2H65A 4Y9TA 1ESDA 1UEJA 4YJHB 3VR0A 3HY4A 2F48A 1A5TA 2E3JA 3VZSA 2ZI5A 1ENYA 4YHHB 1YS2X 1F6DA 1NG1A 1O96B 1FFHA 4ZOLF 1GD1O 1B8UA 4QU5A 4QNMA 4WOJA 3RC3A 4E2YA 2DH5A 4FYJA 4ASUA 1U8UA 8ABPA 3RK4A 1PT5A 4RSRA 1SQGA 3L8MA 1RC1A 4JI5B 3JQAA 1PT6A 3MQ2A 3PI6A 4RD1A 1YR1A 3RTCA 1MP0A 3VR5H 4ZVKA 2GBPA 2X3FA 4FYVA 1NVVQ 5ALXA 3X2SA 2XT0A 4CEJB 1SWVA 1KDPA 2VHYA 2OZKA 3AETB 1LV8A 3ILYA 3OFSA 3PT9A 4NARA 4J3FA 3TD9A 3ZNQA 4D9NA 1GG5A 3A6KA 3W04A 2AMVA 4DIOA 4DUGA 2QV7A 1LPSA 3AP2A 3DT6A 1O6BA 1YZQA 1Y1TA 5FTJA 5T41A 3MAGA 4ENPA 3W77A 2XUPA 1S2IA 4FXPA 5EUBA 4WXPA 1GTZA 3KXPA 4XDZA 1LDNA 1ORDA 3DQZA 2HWWA 2ZWAA 4R71A 4IRMA 1ZR4A 3RREA 3MGBA 5IJ0B 2P4HX 2WLSA 5MN6A 1KMNA 1PE0A 1KSJA 4P0PB 3ZHUA 4MX8A 3WNZA 3LC1O 5CA1A 2XOKA 3VNRA 3DEHA 3M4XA 4XWAA 1PQUA 4QDZA 3YASA 3BD7A 2VSNA 1Q1EA 1N2CA 2RGCA 3N1UA 1RYFA 3NCTA 3SFZA 4EHLA 3L3BA 3SQOA 5ILOA 1YRHA 2OWDA 1GYRA 2OGWA 4J94A 5A7HA 4EY6A 2O2ZA 3TW6A 4B87A 4EHJA 3W5JA 2P9EA 5HRAA 3CF4A 4JOQA 1Y8ZA 1NNEA 2FMUA 2I4LA 3R77A 4M8SA 4NENA 3VRHA 1I0ZA 4RKQA 1VZ2A 1YZKA 1EFTA 2QJOA 5COBA 3RB8A 2P2ZA 4F4UA 2OHJA 1EXDA 2HK6A 2O8FB 3AGPA 2AXNA 4URFA 2CE7A 2KW5A 3OICA 3KEQA 4AY5A 3P2MA 6GPBA 2VP6A 5JAQA 4EHAA 2Z58A 4AZVA 1H0SA 5CLJA 1EVYA 3NKFA 1HH4A 3HP4A 3ITNA 2Q8NA 1UXKA 2I1QA 3DGEC 4O5AA 1H3NA 4RV5A 3V1MA 3PEYA 4ZYUA 1SHZA 3BE6A 2JC3A 4JBHA 4AF7A 1IL0A 2HU8A 3L7BA 1N1MA 4TS1A 3WWEA 3WGZA 1EX9A 2IL1A 3Q9LA 1KZ9A 5T57A 1GV1A 3EIXA 4TTVA 1JMKC 2WTAA 4WVLA 4E12A 3SC3A 3EPLA 4CL2A 1HL3A 3O3MB 5A02A 1Q83A 4HAIA 2ZIFA 1V8DA 4QUIA 4ZOCA 3RHFA 1LCIA 5KQGA 2P65A 3FSJX 4UBNA 4DKJA 4E6EA 1Z4IA 2QTVA 4TXHA 4YJ2B 4ZRMA 4E15A 2G1UA 2E5FA 1BXRB 2JIZA 3L4EA 3OQNA 3IQXA 1ZNYA 1QVZA 1D7OA 3WXMA 4CFZA 3TAUA 5ALUA 1SUAA 5FBVB 2JFOA 1TAHA 2I76A 3LYAA 3U6KA 4PRYA 1QHXA 2O2CA 2A59A 2BEVB 2PT5A 1P1FA 4I6GA 3EVDA 2GBGA 2AI2A 1AG9A 1XEXB 5BUCA 5JD6A 3TQRA 3ONEA 2CJWB 1M6VB 3JAWB 4RETA 4RPKA 4P5EA 3AEZA 4OQZA 1BKSB 1NW8A 2ZSFA 1EM8A 2GD2A 2QJFA 2RHRA 3DJYA 3MWYW 4RIGA 5TB5A 4GYKA 4DMLA 2ONCA 5EJ6A 3U7GA 3QWIA 1TEXA 2W6NA 5A4KA 1ZL2A 3INGA 3CCFA 5A9TA 4CMCA 4OK3A 4ADSG 3EXFB 4LX8A 1PGNA 2J3KA 2M6SA 4V38A 1MORA 2QD2A 5LWQA 3A4LA 3KAJA 4PAQA 3LLCA 3RBAA 3RVQA 4CETA 4X90A 4LRYA 3U9LA 4DWJA 1L5KA 1Z3CA 2W2LA 4JHXA 1LQUA 2XHEA 3I4FA 3P9XA 4LVOA 2ET6A 3QVXA 2BLLA 1ZIYA 3WKBA 5GINE 2C96A 2E4ZA 5E2BA 3IPXA 2JGLA 2WTNA 4P93A 3EE6A 2MR6A 4TLDA 5FNVB 4BVHA 1NP3A 1QCZA 5FUXA 1HDYA 4MWSA 4C7MA 1GAWA 2G5TA 1D8TA 4C88A 2YMLA 1N1GA 1DOHA 2VNJA 2RK4A 4HWPA 2RHGB 3H8WA 3KP1A 4YJ3B 3UOWA 1LU9A 4XA8A 3MHPA 2EEPA 1YVUA 3BPSA 3CUVA 3P94A 1SPBS 5MHTA 4MO2A 1WNTA 2HO4A 3I8SA 3NORA 1LDEA 2QI9C 1M10A 3V8NA 4BVEA 4TQ9A 5JZSA 2O59A 1Y98A 5I51A 5TPWB 1E0SA 3ZTWA 4N0PA 2Y0BA 1KNXA 1W59A 1QWSA 1AKQA 5JDIC 2QP9X 3SYKA 1PZFA 1N6OA 3K5HA 3AFIA 5AM1A 2DU8A 3GLFE 1CQJA 4TUYA 3ZLBA 1AE1A 2GILA 3PPXA 1L5WA 2X0DA 4JB3A 2C9YA 2FVXA 3LS2A 4A2QA 1FY2A 4E08A 1MXHA 5BN4B 1ZP6A 3I6YA 1FFWA 3S44A 5BN3B 3AKZA 1XRPA 4NR0A 5CBPA 4G26A 1C0PA 4WY8A 5TGZA 3CH4B 1K2VN 3IFSA 3PXCX 2Q3BA 4CV2A 3RW9A 3MFYA 3V1UA 1J5PA 1X8LA 3PLAE 1UT5A 3FNHA 4WTOA 1VB3A 5AKZA 4YRCA 2R6CA 1GPBA 3PGMA 3IBSA 1VBKA 1K89A 1E5DA 1T1SA 1T8TA 3HZRA 3TAXA 1Y1LA 2EJWA 1AK9A 2OCAA 1CRLA 2IEZA 3H0KA 2A14A 1COWD 4ILKA 2BD0A 3FMPB 4J1QA 3PQ8A 3RANA 3SIRA 4YMGA 4OLFA 1Z0SA 5A2QA 1MV5A 2FOXA 4NJEB 1ATZA 3ECCA 3H7IA 4RAOA 4OHBA 3EEIA 3GFBA 1Z4PX 5E7MA 4WN3A 2GEDA 4G5QA 4B6RA 1N7HA 3CVJA 1G5HA 2YVAA 2EX1A 1YB1A 4MIEA 1FRZA 1YJXA 2VPPA 3AEXA 5DN6D 2QN1A 3V8BA 2V74B 4JBGA 4DIBA 3ZWCA 1PFUA 2ONKA 3ESBA 2V6BA 3VR1A 4XCXA 2YOHA 4BX9A 2R62A 3HEAA 3KQPA 4E03A 4OQNA 4U6SA 4A26A 4CIAA 2IP1A 4GDFA 2VNAA 2P9CA 3HMQA 2B8NA 2VYQA 3MWGA 4BV3A 1YZGA 6YASA 3Q0IA 1GDTA 3CEHA 2ZRIA 2B7BA 2PTGA 3EODA 1MD9A 3I3OA 2DPGA 4CHGA 4CQLB 4NPHA 2PH7A 2ZB4A 4NMMA 2IYEA 4BDTA 4BPRA 5JQGA 2JAUA 4MNTA 1HFJA 3OWXA 4JUBA 2QPOA 4XUGB 4I9FA 5KMGA 4IIJB 1JR3D 3H99A 5BUZA 4RW0A 2A1UB 3EIWA 5DW3A 2R4TA 5JFTA 1UIMA 2O0KA 1XA4A 4WEOA 2GA8A 2Y1DA 1RWXA 4HNTA 2YOGA 4Q7QA 1Z38A 3UJ3X 2QX6A 5HWSA 1RJGA 1NIPA 3DDHA 3FCUB 3AFGA 1BE6A 4N01A 5TGDA 3KJFA 4YVFA 3W6UA 4RORA 1J1ZA 3HUFA 1TC2A 1ODLA 2GLUA 3F8WA 3GCDA 1ATIA 3ODPA 1AD2A 1PL8A 5H68A 3HJTA 4L9WA 2G72A 5LC1A 1SWWA 4EGQA 3H9UA 4ZJYA 5B3JC 1G5PA 2RHHA 3ZHYA 3PWZA 1VJ5A 2DULA 4I4LA 3ZWPA 3ZZTA 2IYWA 1REQB 1X7XA 4PO3X 4PN3A 5F1YA 5G1PA 2P6OA 4KYVA 4I5GA 5KQMA 3NH6A 2HL6A 2XB6A 4HQNA 3R5XA 1SKBA 4HKTA 4EA9A 3AUTA 3OLZA 5SZHB 1IHUA 2WLTA 1Y7IA 5AVXA 4BB0A 4M55A 1YU6A 2YWEA 2IPNA 4EMBA 4KI7A 5HTKA 2X6RA 4PPFA 2EHJA 4DAOA 1DWQA 2C57A 2R6AA 2H4XA 3K5IA 4LDPA 6ADHA 4CMKA 4MEJA 4QYMA 3I2JA 4M9SA 3UB2A 4DV1B 2IU6A 4JI4B 3I32A 4B3GA 4XM0A 5IJ9A 3L9XA 2GEJA 5KNCH 2QRKA 3VNUA 1J23A 2BZSA 2QR2A 4U5QA 3RSLA 3TUJC 2G6BA 1YA8A 4Q93A 4RHCA 3NHJA 3RS3A 3AUAA 3IUNA 1RYBA 3GNTA 5EHNA 4TMXA 1N2ZA 1U2GA 4EG4A 1U0BB 4KGXA 1P2TA 4EPYA 5DIZA 3UGTA 3W8RA 1E3MA 4KWEA 3HJGA 3HB1A 3EHDA 4D99A 4Q1DA 2HEIA 3ORHA 2EJTA 1B8NA 3GCXA 1ZI6A 4JCOA 3UFXA 4QTYA 5D01A 2C3OA 4L4UA 5FT9A 4XVCA 3PJRA 5A9SA 4OHYA 3AY0A 3NDRA 4PRZA 5TMDA 4R7ZA 2C4UA 5FLEX 4OKIA 3ZNNA 5ICEA 3CU5A 2IPOA 3O8OB 2PRSA 3ZHBA 1QXSA 2QYTA 3T1OA 5AXCA 4GWLA 1JHYA 2WWVD 1N6LA 3HZOA 3F7OA 2HQ1A 3QPCA 4M99A 5JSFA 3EA0A 4HWKA 3DVAB 3SQDA 4DABA 2B0CA 2FLKA 1H4VB 1XK7A 1QB8A 5K0EA 1MJGM 2B20A 1UC9A 5THQA 3AG6A 4KUGA 3ANLA 3VVMA 9LDTA 1XKXA 1G9SA 4QT0A 1KFKB 2HMYB 3TB4A 1V6SA 2CLDX 4Y3UA 3WYEA 2PKQP 5C8YA 3STWA 2R7AA 3GA7A 2YMQA 3H8JA 3QFSA 4MRAA 4X84A 4U39A 4FNMA 1U8EA 3U31A 4XRGA 5K4GA 3QUQA 2V9ZA 4L3WA 4ME6A 1IN6A 4FLEA 3N0RA 4NJOA 4X92A 4N5LA 3GXBA 4YP1A 3UXHA 3REQB 4HBGA 2BH2A 1QGUA 1XRSB 2GM9A 1II8B 1DTEA 2ZT5A 3PC4A 1J9GA 1GNPA 1GL7A 1ODCA 3G5AA 4YTEA 3QY0A 4A8PA 1RBMA 4RWZA 2BONA 4DCTA 1R0CA 1TW3A 4DYHA 4BJ5A 1V8PA 2IPXA 4BQOA 1E2FA 2I2CA 1VJGA 1S2NA 2H08A 2M6RA 3OOWA 2J3EA 3LCMA 2GETA 5FI1B 2PXAA 3RAPR 2ATVA 3CH7A 4V3CA 1Z56C 1WXIA 4N47A 1C7EA 4QTZA 1PJ2A 3JQ6A 5EHIA 4NEHB 3ZVMA 2W5UA 1YS7A 2ZWVA 3KX2A 4UCFA 2M1XA 1R6DA 4YWJA 1E20A 3DBLA 3UA3A 1WCYA 4POOA 5JS1A 2WZBA 1AKNA 2CHFA 1VBNA 3G5TA 2AI3A 1DMRA 2QTGA 2ZSAA 4LGCA 4GRIA 4YASA 1D2EA 4MGKR 4BLPA 2AR0A 3WL8A 4D4GA 4E5VA 4PLGA 2YKGA 3EAQA 2AV6A 1ML3A 1EE1A 2GRAA 4QYSA 5TQ2B 3PNOA 4M9XA 5KSZA 5EQFA 4AP9A 3WK4A 1B7GO 1OR8A 4Z99A 1AGRA 3LK6A 4FGWA 2ZKIA 1MVNA 2JVJA 4YRFA 2BMAA 2XMZA 3FUCA 2XYQA 1U3CA 4FGLA 2CD7A 3IHKA 5CLQA 1GAJA 4EG8A 5JDIA 4G1UC 1WQ3A 3HNPA 4KLRA 4NBSA 3K72B 2GCIA 1T0BA 4BNJA 4ZT2A 1SCJA 1W4ZA 2C8KA 2PVCA 3MOSA 2ASVA 2C3MA 3CLKA 3H9QA 3HEMA 4GKBA 3HKCB 4FC7A 4GM4A 4QULA 5IG2A 1PV4A 1X8KA 4JR2A 1TK2A 2I3GA 1GAEO 1TVKA 3G1UA 4GXNA 3SYNA 2GGSA 3QUSA 5DWVA 3H2IA 3ZI0A 4CODB 1GAQA 3R3ZA 4DHWA 5C7LO 5CGQB 4RKEA 2X6QA 1PJQA 2PM8A 2R2GA 4LYGA 1OAKA 1SR8A 2UUOA 2PLNA 4YAWA 1YBMA 2WJ6A 1SD2A 1D0IA 3KXKA 1Z7BA 4HH4A 4BLRA 4F96A 5AVYA 4OVKA 2GB4A 1PR3A 1UUFA 5K8CA 1J7KA 3ELBA 4G9EA 4JEIA 1Z0UA 1ZK1A 4MA5A 5IT9A 2QTCA 2GJSA 4GG1A 3E03A 1O4WA 2K4MA 4UFPA 5D2CA 1DXYA 1O9GA 5JV5A 1Y81A 1H0KA 4AURA 1D1SA 4QX6A 2P67A 2W8ZA 4MYRA 3I30X 4HEHA 2D5IA 4L7QA 2OHOA 1AS2A 2D2IA 3JATA 1J56A 2N47A 4DREA 1JFSA 2IP4A 1VYTA 1J97A 4MZDA 4B3CA 5DH9A 3LUFA 3TQIA 3R0XA 1C7JA 4PV7A 4TV9A 3I2HA 5F4BA 1ADBA 4TWJA 3VAZA 4UDNA 4EZIA 3W5BA 1OXXK 4NOMA 3ZN2A 3BK7A 3BS4A 3DC7A 1Z9BA 4BMOB 4DMCA 5KC8A 1HL7A 4WK2B 1P5HA 4PYKA 1Z0KA 2W2OA 3DAYA 4J6FA 4HG2A 4MJXA 4QUGA 3BX1A 3BDAA 3IH5A 1XOIA 2X2FA 3UNXA 4UTZA 1G8KA 1RJWA 1OC2A 5HBRA 3IDSA 3N53A 4Z2YA 2P11A 2A9OA 1K1EA 3LV8A 2W6QA 2XGOA 3R0ZA 4L9SA 1YE5A 4X6LA 3TW4A 1P1RA 3AEQB 5BSVA 5FA8A 2XVAA 1G8MA 4M37A 3ZX4A 1OIVA 3AKCA 4BNUA 3ZWYA 1R0WA 2G71A 4JEHA 1XFDA 1YCGA 1W30A 4OIFA 1A7AA 5FX2A 3O3OB 5LXTF 1ZHHA 1E2PA 4FCCA 1WLSA 1ZLYA 3WSVA 1Z83A 2R1TB 3EZNA 1ECPA 5HMLA 1P4SA 2WWWA 3VDXA 4LMAA 3PQ4A 4R0NA 1N8TA 1VG0B 4KH0A 2ZYAA 4R8SA 4ALIA 4BUJA 4IICA 4OI0A 1ISRA 2HIAA 3UJPA 4N5NA 1BGXT 4C0XA 2QM7A 3P0JA 3MGKA 5GJWC 4CM1A 4EWLA 1ORVA 1R4MB 1ST2A 2J33A 3RS8A 1APBA 1IBLB 3GQVA 1MDBA 5B2EA 2YC2C 4I4CA 1NFFA 4INPA 4R7TA 2D13A 2FUG6 2EAUA 3LT2A 3CWQA 3QZUA 2WU3A 1PNQA 1Z88A 2YJNA 4ZT7A 5KHAA 3BICA 3K32A 4CDMA 1X15A 2Q29A 5FP0A 4DNOA 3ENNA 4HWRA 4LHZA 4FYHA 3PHLA 4I1UA 3BIXA 3BTUA 1TVMA 3BD8A 1WTAA 2CC2A 2ZUTA 4IO0A 5ALNA 2ZPTX 3IMFA 3A4TA 3QOYA 1GGVA 4IIBA 3OWHA 2ANCA 4B8ZA 4EMUA 3F4BA 2RGRA 1ZOLA 1BRTA 3PNVA 2FKNA 1MH1A 1GEEA 2J67A 4DM4A 4AMBA 5KAMA 5JCOA 3KLMX 3S7TA 1I1NA 1QGYA 1EJ0A 2R1ZA 1ZFNA 3E05A 4HEJA 4JH0A 1ULUA 3WGQA 4WZAA 3FOWA 5K3SA 1ZPDA 3B1JA 4JEMA 1OKKD 4AF8A 2GPNA 1I7SB 3V1YA 4WGFA 2RAFA 1TZ2A 1YA4A 5AKJA 1NVKA 3GVCA 4FMCB 4LZLA 1OXBB 2TECE 1QB7A 1ZJJA 2Z08A 3L8CA 3AONB 2GUWA 2KYRA 2CJPA 3FDZA 3RSFA 3S1LA 4Q34A 3TK1A 3X1XA 1ISPA 4BATA 1NLMA 2N3ZA 4DMHA 3BAFA 5CJJA 4K6KA 1H69A 3GYBA 1V16A 5KVVA 3GPDG 4I5IA 5FD8A 2YIVX 1MC5A 2AQIA 1G8GA 1NKTA 3K9NA 4W5WA 4G5YA 4C2UA 3B1WA 4RK1A 4J4TA 4TZ6A 1W5TA 4J07A 5HEKA 1TQ6A 3N76A 4BN5A 1TJ5A 2I99A 4RXMA 1Q20A 2AXEA 4Z1OA 1T0HB 2MSKA 1DAFA 2F8SA 4JIGA 1E59A 4XGQA 3MTGA 1RI4A 3SS7X 1FQOA 3OQIA 1XO1A 1E79A 2Y2UA 3WGYA 2BWJA 1S3IA 3R0IA 3WL6A 2NAFA 3NBZC 2O8CA 1PNRA 4ZT6A 1XEAA 3O4VA 3OIGA 3AEKB 4MPTA 3BJEA 4YAKA 2ZBPA 2IS4A 1QFZA 3L01A 3HTXA 2R8ZA 4DLVA 5CG1A 4Y2RA 1T2NA 3SM3A 3QKRB 1WVMA 2H2DA 4MS4B 5IN4A 4R1SA 5J23A 1JV2B 4KK3A 1AC5A 4WZBE 3RC9A 4CM6A 5JI2E 2VBFA 1E5TA 5AI6A 4AKTA 4LZWA 1E8DA 1NYTA 4I0WB 3IVXA 2YRWA 3SE7A 3VXKA 2JJ2D 2CNWD 3AIMA 2XF2A 1EBFA 2O20A 3IUYA 3MOGA 4RD3A 4UHBA 2H5EA 1F6WA 4I55B 2PRZA 4Q82A 5HGJA 1XTZA 4EMTA 4A82A 1KO4A 1PQWA 2P5TB 4Y6LA 4N40A 1HE2A 4H59A 1YONA 3S2EA 1YFZA 1XBTA 4KXLA 3OPVA 1ELOA 1J90A 2FB9A 3PDIA 3Q3EA 5K0BA 3WV4A 5AW5A 1MENA 2Y0DA 3A1DA 3KAKA 1FZTA 4YBRA 3VJKA 5C8VA 5FQOA 4LISA 3H5RA 2WKWA 1FDTA 2DUNA 4K6GA 5E6SA 4YLYA 3ID6C 3RRYA 2JLUA 3BWDD 2PSDA 3WQRA 3B9RA 2D7CA 4FFOA 2ZJ7A 4OCZA 5EMKA 3HJAA 5LDGA 3HKDB 1ISSA 3ETJA 4E22A 3VPBA 5CD9A 3COPA 2Y1EA 2DT8A 1O8CA 5FKJA 1I3CA 5AXAA 4YUZA 2JLWA 1CUFA 5LD2B 3OLYA 3UK2A 1YR7A 2APJA 2XH8A 4NHEA 5LFAA 3I73A 3VGPA 2PQ0A 3HO6A 2WW8A 2SNIE 2ZANA 4MQEB 3SJAA 4I4TF 5T6BA 3ZHCA 5A6SA 1I3NA 4WNAA 1SBYA 2VRNA 5IXJA 1J8FA 4NYJQ 3SWWA 2VHCA 5KTSA 4XM1A 1SC9A 3CRRA 1H2RS 4UHHA 3LUDA 3UWMA 2VK2A 3AVVA 1I2CA 2Z4TA 3F7NA 4HDNB 2R4UA 1R64A 1D4ZA 1M8KA 2KX7A 4UCQA 3ENWA 1H3FA 3TIXB 2NLOA 3RUIA 2JHGA 3M9XA 3BSSA 4ZC1A 5HF9A 5E4JA 4GXTA 5BWOA 4E3WA 4UREA 2A1IA 1NP6A 3WIVA 3JWIA 1G8FA 1KERA 5K6AA 1M8JA 2VBCA 1ADJA 5J2UA 5F3RA 1P31A 3HJCA 3NPMA 4XOIA 4WH0A 3VHXB 5FWDA 4C4PA 3EUEA 2Y9PB 1TCVA 1Z29A 4P7BA 4O4JA 3KPWA 2C3UA 1E3TA 1N25A 1SB9A 2R84A 3PNMA 5BXYA 3EAGA 2FWRA 5B7PA 1CJCA 1QIFA 1NN5A 3FMGA 5JAPA 4BWGA 1QHHA 1JS1X 1K7XB 1PFGA 1X0VA 2AN3A 2CW5A 1XXHE 2FX5A 3KU1A 4YAOA 1A5BB 1GKYA 1L1EA 4AUEA 4DYDA 2C7QA 1VE3A 4NZPA 3CFYA 4LJAA 3D8TA 4CCYB 1Z35A 2DBYA 2NV6A 5A3QA 1W7AA 4TRRA 1YVDA 4W99A 4JNKA 4JP2A 4XB1A 1AZTA 2ZUBA 4GPTA 3L7IA 2Y4NA 3M2TA 3ZY2A 4J6EA 3AHDA 4I3HA 5KKNB 2ID4A 3LBNA 4F56A 2GPJA 3R7NA 4CIWA 3ZY4A 4U7FA 4FE7A 1R5BA 2F1KA 5LUBA 1WF3A 3KZ1E 2FF5A 2MDTA 2QRGA 4QU0A 4WWHA 5ECYA 1CC1S 3PXGA 5K8IA 2QVZX 3EGWA 3PXXA 1Q91A 5AOAA 4ZYZA 3OFKA 4BRUA 2GHQA 4KAAA 3W9UA 1Z0IA 2I8CA 2J4CA 2OESA 3WYBA 4NCJA 3TLYA 1E92A 4MCJA 3NPAA 1M6WA 4OFBA 5B3AA 1PWYE 1RFGE 3R7WA 3BSWA 2AC2A 1A8HA 3EOZA 4OJNA 5D3ZA 3W79A 2ZE5A 4C4YA 1A9XB 1N9KA 4IFIA 2ILVA 3BL6A 3C15C 3E3AA 3X1YA 1CUUA 2YC4C 1Q1NA 4KSCA 2CMHA 5IYZF 3HB5X 5CXQA 3LO5A 5F2OA 1EHCA 5EIWA 5TIIA 4HN9A 5FAXA 3T1QA 3CHYA 2FCRA 5C18A 4QL3A 3PWSA 1M1NB 1OYOA 4LY3A 4L08A 3L1HA 2YWCA 4Q18A 4DMFA 3GMDA 5E3JA 3E70C 4B35A 4HK4A 5EE1A 2OCLA 2C2HA 4U7WA 1BGVA 4HUJA 4NY1A 2IXGA 1PEAA 4IXWA 1DB3A 1AQJA 1OAAA 1PNTA 1TO6A 2CNDA 4K9PA 3EGIA 5D7NA 1BVHA 2OAGA 3CTMA 1TUBA 2B30A 2WMDA 1YGPA 2GX6A 5EYPB 3H42B 2C78A 4RADA 2GLXA 3N2GA 3KSBC 2MYPA 2B8WA 4XPIA 5CT9A 1CJUC 3EC7A 3HJBA 4C4TA 5C1OA 2MTBA 5LYJF 4MR8B 3L4KA 5EIFA 4CF4A 3R24A 1FMTA 3N2KA 3V4RA 4TXLA 5IAKA 5EG5A 3DKVA 3OCXA 4MQFA 2HPZA 4HVTA 4X1YB 2REQB 3P2IA 3D6HA 3LH5A 1OD6A 2LR0A 5CLIA 5FPYA 2IWRA 1XVLA 4JYAB 2BGKA 3ELYA 4OXRA 4DLRA 3G0OA 4E88A 3RKUA 4EY7A 1MMFB 2V4UA 2JLVA 4ZARA 4F45A 2LUOA 1KBOA 4RBNA 2UUAB 1K92A 3M9LA 5DCLA 5EHQA 3F4LA 3LBHA 4XQCA 5HP4A 4MVJF 5DGHA 3A4VA 5KNLA 1E77A 4OIMA 4P3PA 5LZ7A 3DTVA 1Y37A 2FZKA 3NOOA 4ZV4A 3EWIA 1ZW1A 4BB9A 3W3ZB 2DWQA 2GSDA 2OFXA 5IULC 1LF0A 1RI5A 3OTQA 3TSYA 2GJ8A 4R5HA 2Y1WA 1BCRB 4FHCA 5L7WA 4C4RA 1OKKA 2W83A 1A77A 1I8TA 4EARA 3RGGA 1G64A 4L51A 2JAXA 4D8YA 4PLCA 2EGHA 3A6EA 1Z2AA 3CW2A 4HWGA 3DMPA 4IV8A 4XQGA 5B7QA 3RAFC 4Z0NA 1C7ZA 1UFKA 2A9PA 1WR8A 3IOEA 1RRVA 1EXVA 1UMDB 1AB6A 2CF6A 2BBTA 2FNAA 4JOCA 1UBGA 2C9MA 1K7FB 4S2EA 2AFHE 3ZU3A 2FMTA 4Q03A 2Y6VA 2EZUA 4OQDA 2AI1A 4L5YA 3KXLA 2GCOB 3V4OA 2NNWB 1WETA 5KPJA 2D54A 1QG2A 1XQYA 4HFJA 1NN0A 4Q4AB 1P4HA 1Y80A 5EKUA 1XHLA 2FMKA 1T9KA 2VWGA 4FR5A 4L0CA 3STYA 3WB9A 4D41A 4D92A 1DC3A 3B7GA 3FOCA 2C95A 4N41A 2VH5R 2RH5A 3LY8A 1P9RA 4FFNA 1SHLA 4GL4A 4Q1FA 5JARA 4ZO4A 2C83A 2D5BA 3VOAA 3D3WB 4J90A 3VSCA 2H2WA 4H6VA 2GNPA 4PO1A 3AFMA 1BXGA 2Q3LA 2RIRA 1PZGA 1P5RA 3QUAA 5CLLA 4AG3A 4DR6B 5CFOA 4V2IA 1UT6A 3STHA 1EIZA 1US8B 3Q2OA 1ZD4A 2XMPA 1PR5A 3TOVA 1U2EA 1I4LD 3AGQA 2O3SA 2R8PA 4FFLA 3RH0A 2DE0X 1T6ZA 1Y6JA 2OYSA 5E8RA 4O8ZA 3ONFA 2XWBF 1N8NA 3N28A 2EFYA 4NABA 4GYWA 4N82A 1PWEA 2BGLA 3HA3A 4IH4A 3DZKA 2W6ID 1X87A 2Q4RA 1RSZA 4LJ8A 5DNDA 4YMTA 1K5DA 1XB2A 3TRDA 3V2UA 3RYCB 2UZ1A 5AHXA 2ERCA 4PY2A 5AESA 4JU8A 4ND8B 4XH9B 2OC9A 2P27A 3Q9UA 2R79A 3CB2A 4QO8A 3HSYA 1F8XA 1PK8A 3O9MA 3UJ6A 4BLSA 2OV1A 4LK3A 2BN4A 3P19A 1M2OA 2QTLA 4CHTA 4PYNA 4E5NA 3QVKA 3MINA 3DAFA 3PEUA 4LGYA 1KETA 5DYTA 1W1WA 5ALTA 3GDFA 3SZUA 2Q2QA 2P77A 3VU1A 5BRAA 1Z18A 2CWWA 3C3BA 4KLZA 4F7WA 1K4YA 1SG9A 1KEKA 3BE5A 4CV0A 4MYHA 4UXHA 4JI8B 5JPDA 3G8YA 3UWOA 2R11A 4G5SA 1E4OA 5ICCA 1E2GA 2ZTVA 8MHTA 1BYIA 3PD0A 4FZJA 5DK6A 1GR1A 3T3GA 1KFCB 4LDRA 5DHQA 4OLBA 3OM0A 1RKUA 4MS1A 3ZHRA 4CLDA 2PE5A 3OAAD 3Q9NA 1E1CA 1W5AA 5IKMA 4YJGB 3WSWA 5ADVA 1FQWA 1W52X 3H9GA 5KYYA 3G9ZA 3EGDA 4QNNA 1SRRA 4OJQA 1DX9A 2A5FA 3ZWQA 1DO2A 3BSYA 1NQ5A 1OWMA 2NU7B 2FW1A 2JKVA 1DTWB 1RADA 3GT7A 3ICVA 4PTLA 1CXZA 2GK3A 3KAQA 4B82A 2BFDA 4ZJUA 1W2WB 3R5JA 3PUYA 1U7PA 1V9SA 3BC1A 4URHA 5CEJA 3H11A 4ZMSA 5I7SA 3A9UA 3O0TA 2NV0A 4R1OA 3H65A 3VR6H 1Z63A 3DUFB 3O2QB 1EG7A 2Q3MA 3GFQA 5LN1A 3OQOA 5A9SB 1LWOA 3JQPA 3U9SA 3KU4A 5JZBA 1RPJA 4DQ0A 5A0FA 2RGDA 3M2PA 2PJDA 1U28C 4K6FA 4PSDA 3GG9A 3JALA 2IEAA 3BMOA 4Q12A 4YO7A 4DLKA 1QNFA 2X9QA 3EF1A 4C08A 4Z53A 2QG9A 3JYPA 4KLAA 1XZGA 3NHZA 1QFJA 5FLXA 3T12A 2Y76A 4DVGA 2HF9A 1Q16A 3IV9A 3BGDA 2EL7A 1PZXA 3GRPA 3L49A 5CCDA 2JB9A 3STUA 2I22A 4RJKA 4B79A 4ZV9A 3QVTA 2P6PA 1S3GA 1ZUWA 3HY6A 2WDZA 2EG9A 3H18A 1SXHA 4DIKA 2IGTA 4RXTA 5EMJA 3ZVKA 1JPVA 2D00A 5FF9A 4D97A 5JBQA 2QXUA 1MRZA 4J0CA 4RDIA 3NHSA 3F90A 4UUNA 3EK2A 4HH1A 1LBEA 2QUKA 3N7AA 3C3AA 3JZFA 1FSSA 1WJGA 4LRTB 4BGUA 4II3A 3H4VA 3BHIA 3K0KA 2PKWA 1WDMA 3NWBA 4AN4A 3D7MA 5ELLA 3DVQX 4EHKA 5DT9A 2R5NA 2CXHA 2X9NA 3HM9A 4FW9A 1L5SA 4DPLA 2A35A 2ZIUB 4V0NA 5LQUA 3GW8A 1M8GA 3NB0A 2IC5A 1QR2A 1NTRA 3L0CA 3OQVA 4HQKA 1JLSA 2X5KO 3LT4A 4JJ4A 4LSGA 1Z2PX 4C14A 1HYBA 1FDIA 3QM1A 2KMLA 3LX6A 4YYZA 3KTOA 1N36B 1P60A 5CVTA 3DO5A 4GUAA 4NS4A 3K09C 4Q24A 5JH7F 2VT6A 3I05A 4Q4JA 4QWWA 3K9FC 2AG6A 4W5NA 1K0FA 4QAQA 5LBIA 4KFRA 5AVSA 2Z1DA 2O2IA 4OP3A 3GZJA 4CQMA 2GRUA 5AW1A 4P2GA 2ZB2A 4TL6A 1X3LA 3H75A 1RXVA 4B3RB 5FNZA 3ABOB 1SK8A 3K4PA 1EEHA 1FNBA 2OORC 3ZCPA 4NMWA 4AROA 4PWYA 2YHIA 4XARA 1A9RA 1C9EA 1NUHA 2C4MA 2I6UA 2IBMA 3D2AA 4BO5A 4HH0A 1SHJA 2W71A 5DNUA 1XJQA 1J6UA 1F38A 1ZKDA 3NT4A 3RYTC 3UJAA 3GVIA 3U17A 4NONA 3JWGA 5H4GA 1JIXA 2OOSA 3ACDA 2YUIA 1PU2A 3TZBA 1V26A 1BX1A 4DCPA 5AW7A 1FYWA 1C0IA 1ZGCA 1Z2NX 2E82A 4H2DA 3RQSA 3U3DA 3ZVRA 6REQB 4UMDA 4LF9B 3IIKA 4LJ5A 2F55A 4OHPA 4NAUA 2C5EA 1MAUA 2PKRA 3T5CA 2PUJA 4A6DA 4LNUA 1XMVA 3RG2A 4F86A 1QU2A 3MG9A 1PFYA 4QPPA 4I4NA 2WJ4A 3GD7A 2J6IA 4ZICA 3FNFA 3M4NA 1IATA 4UVEA 3U4QA 3GMTA 2ECKA 1ZGJA 5IKXA 4M9QA 5TS2A 5BORA 3ROXA 2GXAA 5IT4A 2VHTA 1NQXA 1ZK0A 4FU0A 3GMSA 1NN1A 4K05A 3DV0B 3LW7A 4IBOA 1NQAO 1WSWA 2AEMA 3ILVA 1P81A 4M0CA 4JSRA 1SC6A 2J46A 3CX6A 3HBFA 2HU2A 3WK8A 2QTWB 2O8DB 1C2TA 3RYFA 5JC8A 1YFKA 2KHZA 2GM5A 3RSQA 3T9CA 3ZQ6A 3VR5D 2VZEA 1I1OA 1DAPA 2Z6VA 1Z6AA 4BS9A 4ER6A 3G2NA 2DWOA 4NCAA 2ICAA 4JLMA 2G1PA 1ES9A 4XLZA 1J7JA 1MB2A 3ADCA 2Y68A 3N05A 2QTRA 3D7RA 3BUSA 4CM8B 4CEHA 2WIBA 3VO2A 3WGKA 3L6UA 5IARA 4AZ0A 1DGQA 1BJKA 1GTVA 1K9SA 1OGYA 3OTIA 5EHZA 4OKNA 4U6QA 4AKHA 2IW3A 1F2VA 4IQGA 1MGOA 1I51A 4X8OA 2WJWA 4HNUA 5J58A 1T2CA 1I6MA 2X6TA 5IF9A 4YACA 3P52A 1GWNA 2HCBA 4PO8A 3A3OA 2HZ7A 2FN9A 5F7ZA 1IY1A 3M5CA 3ORYA 4J0IA 4JKYA 4XYMA 2NU9B 2Q07A 4EKEA 3BMNA 1NF3A 4AXBA 4LWOA 4WRRA 3ENVA 1CX9B 1LY1A 2BTQB 3BRSA 4F2HA 1QFMA 1WBJB 3B5JA 1GPKA 1PSZA 5TF4A 3IPCA 4ARZB 4ZZIA 3LVRE 4Q66C 5ARDA 3ZU5A 5CA0F 3HU2A 3RU2A 2RD2A 2Q0QA 2H9AA 2R87A 2O7RA 1MTOA 1OHHD 4R1QA 1E6UA 3T5PA 5SY6A 4L0MA 2GXQA 1T2AA 2VS1A 4A2CA 4OU5A 1FS5A 1GGEA 1OFHA 1CKEA 3WO1A 2KLBA 3FWZA 1UP6A 5CLFA 1V39A 1UBTS 4I19A 2N0SA 4IXMA 2WEKA 1VL6A 2PRIA 3HB0A 5CVEA 2PUCA 4TVOA 5DN6A 2W6IA 4R3UC 3GU3A 4UVGA 5CX1B 3WFJA 2GD1O 2VAMA 2B5WA 5KX5B 4GNKA 4PC6A 4WLUA 3PSAA 4K3VA 4RF3A 4P36A 4KQ6A 1W29A 4XIGS 5I7EA 3NTXA 3R5FA 5CH5A 2PX4A 5DZSA 4GP6A 1VLVA 4KKXB 3A2MA 1DXQA 2I8AA 2YICA 4GMKA 1R8QA 2H29A 3BHJA 1TPYA 4N5HX 4PS0A 1VMKA 3WWZA 1UBKS 5HPYB 3FBWA 3ND5A 3AHHA 1C3VA 1FXUA 4H7KA 2NT4A 4IHJA 1HLGA 1U65A 3ELUA 1VL2A 1Q0TA 1N5KA 3KO8A 1Y48E 1R8XA 1P2GA 2ZJAA 1LRLA 1K8ZB 1KMQA 3DXZA 3LWZA 4NYJR 4LF8B 4U0JA 1J2RA 3U44B 1NDUA 3PK0A 2Q2OA 3S5UA 3QE9Y 4TS4A 3EQZA 4J49A 3WE7A 2M6LA 4ACBA 3GJ4A 1HOXA 1LDBA 3QXJA 4X91A 1ULSA 2ZT8A 1UWVA 3BMCA 1EDBA 4N18A 4RANA 3DQPA 3HPRA 1O4VA 1F3LA 3M9WA 3TLGA 4XFDA 3ZGNA 2DAPA 2P40A 2PLRA 3AW8A 3OAAA 4PG6A 5BWBA 1Z6QA 5CXUA 4FP9A 3ANXA 3UZUA 1A9PA 1LQTA 3CQ9A 4QUBA 2GZHA 3PGKA 1PFQA 1E58A 3RIXA 1GUDA 3UYLA 4G24A 4KN8A 1H9CA 3DL0A 1BN7A 2P8JA 4KZKA 1V7PC 4UBJA 2QTZA 3T54A 5LP6C 5F1PA 2FA9A 3IEPA 4YR9A 3GAMA 1U28A 2QQFA 2ZUUA 1OU4A 4JI3B 1Z4JA 2GYVA 1NI3A 1JPJA 4CM5A 2HJHA 1Q19A 1E2QA 3T4EA 2JBAB 1JAIA 1W19A 4RVUA 1E3WB 3ULKA 2CUZA 2H7YA 1ZKMA 3OMXA 2IHJA 3WK5A 4BNTA 5IVKA 3D8HA 2WMOB 3R7FA 3U0BA 4GBGA 4G09A 1SCAA 3I53A 2QYOA 5CK4A 2J9ZB 3EGEA 5LZ4A 1EUQA 5ILGA 4WN9B 5BPHA 4WFIA 1X9IA 2RHLA 3B2NA 1KZYC 3HFRA 5L45A 2PSFA 4QGBA 2AKYA 4ENRA 4ZI7F 1VHQA 4YXWA 2AOXA 3GZNB 4C4XA 2C8JA 1SHUX 4NBRA 2IEYA 1D6NA 2AR7A 5CTJA 4IUCS 3KT6A 5FADA 1VA5A 2OB2A 5CM9C 5E38A 5TPZD 1NGSA 2H2AA 3DMGA 3JPYA 5JCPA 1JQBA 1HORA 2DCUA 2E9SA 2XWSA 3B51X 3CLSD 3FTQA 3U4IA 2QX8A 3LJKA 2Q9CA 1BGWA 2NO1A 4H7HA 4M76B 5BY2A 2XA2A 3UWDA 2OV8A 2HDOA 3P2OA 1GVNB 3K9WA 3H17A 4P3XA 2EJBA 5E0KB 4CYMA 1MQSA 4ZKEA 4H1UA 1Q7TA 4MV4A 2AKAB 1WMAA 4LJ9A 2YYSA 2P6UA 3CBGA 4XUEA 3H5TA 5FPSA 1D2AA 4IAOA 4L4XA 4O3FA 2XRZA 1FDUA 1OV4A 1PF7E 2NZ2A 3AYZB 3CLSC 4P5PA 5IKOA 3VR4A 4LNAA 3RC7A 2FWBA 5JY1A 5JZ9A 4D25A 2JKZA 1WMFA 3OLXA 1QHGA 1ZICA 3K09A 1IM8A 2BFCB 2C4NA 4GM1A 4HADA 2IELA 1RKVA 3UMJA 1WD5A 3L7YA 2VNHA 1WU7A 2BMDA 4E31A 3IILA 1DKMA 1YRBA 1ODKA 2A9JA 4JJKA 5BMVB 1FP1D 3JARB 2OORA 3LPDA 1NY6A 5BV0A 5HZMA 1KFJB 1AKYA 1QRAA 3U7EB 1ONNA 2BIFA 1N33B 1IK4A 1JG1A 2O3QA 1XQWA 4G4IA 3RF6A 5E0OA 2FPMA 4QRDA 2L18A 2ZEJA 3OP4A 3KM0A 4G5OA 4GOKA 5DHUA 4BNYA 1ESZA 1O87A 2BL4A 4MO9A 2EGUA 1NVAA 2OCYC 4G1BA 4I81A 5GWXA 1X9HA 3OG9A 2X86A 1M1UA 2AFIE 2HHAA 2JZOA 4P22A 5T4BA 6LDHA 5JCXA 1QRTA 3VZRA 5B1EA 3EIEA 4V0KA 1CFJA 3QMVA 3W5HA 1LLDA 3ZGXA 4HDMB 5CDTA 1ZESA 3LC0A 4U6NA 3R7AA 1OH7A 3DWIA 3OOHA 4BFXA 2C2OA 3Q8LA 2GNOA 1VSUA 3H1TA 3D8NA 3KQQA 4Q9LA 5F64A 1JKMA 3L04A 1M0SA 3RS4A 3W8NA 3KDPA 3BQMB 2DHQA 2QAJA 4JR0A 4G0QA 3ETHA 1PUIA 3WYDA 4TXMA 1JQJC 4I1OA 3CUWA 1JQ3A 2ZUVA 2D74A 4XIJA 5FBWB 1VOTA 3RTBA 4RFSA 4G5HA 4AS2A 4BMZA 1JG6A 1QVRA 2OM2A 3MIZA 3T3HA 3MTDA 4GZMA 1BD4A 1C3EA 4I36A 3I1YA 5ALWA 3Q3VA 4MCHA 2A4KA 2DUJA 4BU0A 5F7XA 2Z3WA 1H2EA 3I23A 4BAZA 1ZCFA 3D1JA 3OU2A 2QUZA 3JQAB 4UM5A 3MC1A 4FB4A 1Z6XA 1PDWA 2GEKA 1MAAA 4S0ZA 3C45A 4TKVA 4YDHB 1IM5A 1VHJA 1VQ1A 2YQ4A 4C7KA 5FA6A 1EIWA 1VIYA 5JYCA 3IDFA 3O03A 3O38A 2O52A 3B1FA 2A57A 4K1LA 4QHTA 1IBRA 3GRVA 4RACA 1TIKA 3Q10A 3D4PA 5TE9A 4KACA 2IHTA 3VR5A 2UKDA 1A4XA 3C4VA 3BGWA 3IESA 4QDOA 5IVHA 3F46A 2ZIAA 1GNQA 3EPPA 1V5FA 1WPGA 2O8VA 3E0QA 4QXOA 2I6TA 1XAJA 3AU9A 3DHWC 3HB9A 1HNNA 2ZI9A 2A6PA 5EAIA 3TMAA 4CUJA 3FZQA 4KMSA 3KB8A 1YZUA 1T1JA 2OBFA 3AR8A 4M4SA 4Z9AA 3STXA 3HJNA 2WUFA 1VYVA 3QLVA 4ML3A 1PRYA 1R0XA 4NCIA 3TQHA 5JRJA 3OJEA 4GPIB 1TL7C 5EZYA 4BPBA 1F0KA 1TU0A 1D5CA 2Y2VA 4LDQA 4JI1B 1JEYA 2UYHA 1SCIA 1RWWA 2XX3A 3GUCA 4TTTS 4OFWA 3NEPX 2WJYA 1FX1A 3PFNA 1E69A 1YOVB 1OVGA 3QBEA 4E2WA 3KB6A 4GS5A 3B36A 3ZGYA 2D5AA 3H86A 3NDPA 3TZEA 3U56A 3B6EA 5J2TA 3QW4B 1NPTO 4RVCA 2R5FA 4LRSB 4JNCA 4EGAA 2PZBA 5DM70 4ZQFA 2BM9A 5DHAA 5BV1A 1C9JA 2C5LA 3QX3A 1OHHA 3I45A 1U8XX 2CFRA 3R9XB 3G23A 1WUHS 3CB4A 4KLCA 3TTTA 3WBKA 3EVFA 4QUEA 2I6GA 4NFYA 2JIBA 3BXZA 1U7XA 5E9QA 1A2QA 2FZLA 1WV0A 1L7DA 1XRQA 2AOUA 1TM3E 1KFEB 3CWCA 2NVUB 3S8MA 1UKAA 2ZJ5A 4N6GA 5J5VA 2OZVA 5A4FS 2JBHA 3PGXA 4RA9A 3C8DA 3ZDDA 2IH4A 5HK9A 3Q7TA 2E55A 1JEQA 2WINI 4LJ4A 3MXOA 1FJHA 1TD9A 3DP7A 2IS6A 2P5SA 1H1TA 2K6GA 3EQ7A 3JVDA 1F4PA 5HM6A 1LVGA 3FOAA 4OB7A 1IN4A 5EP1A 2GF9A 1DAOA 1Z8DA 5J59A 4PG8A 1GPMA 2G9RA 3F96A 4G41A 2C82A 1VA4A 1X1DA 5FBZA 1BU5A 2PJUA 5T4HA 3RAGA 4BB5A 3RRBA 3ISJA 4C7OA 4D43A 5AUPB 1TT5A 3KVVA 2H31A 1ACLA 4JC5A 4PVDA 4HYTA 1WHTB 1VHDA 3D3NA 4QVGA 5CVDA 4D8UA 4F4DA 1ZJYA 1XZPA 2QS9A 1DOZA 2W2KA 3FZGA 4DB4A 3STTA 4MUHA 1PAUA 5AVJA 1A8SA 5JLAA 4AZ3A 1VG9B 2O48X 1YH3A 1ZS9A 4BKUA 2ZRQA 1P2VA 1A8PA 5KINB 5F76A 4GZ6A 1QM5A 4PBTA 3QX8A 1BFUA 4NJMA 4KRXA 1SKMA 1Z36A 2HDHA 3QBVA 4MROA 2RGXA 4Y6RA 2VPYA 1IIRA 3GJYA 2VRCD 3BXXA 3MILA 5J4KA 3EGOA 1XAIA 1FYVA 2OMKA 4FONA 3JD0A 4RV4A 4F5ZA 4WOPA 1UBSB 4MV0A 2FQQA 2VQEB 1J07A 4JP3A 1KJIA 3EN0A 3I1IA 4GI2A 5DB4A 4GI1A 3KQVA 3H2JA 1ICEA 1YWGO 4FUTA 5CK5A 4DLAA 1EVLA 4RTLA 1V5GA 1PDVA 3KZCA 2PS0A 4NFSA 5G41A 4Q00A 4ZCLA 3DZBA 1P77A 1I13A 4H1TA 2JH3A 5MN5A 3MTIA 2JLRA 2FPGA 1QANA 2V8OA 1HWYA 2H1IA 4JQCA 4CEIA 3W5DA 2H5LA 4W8HA 2XB4A 2XE8A 3TCXB 4BNVA 2EFGA 2H51A 5LZ2A 1M75A 1H5QA 2W90A 3IDZA 1K7EB 4FGUA 3UUGA 4RPCA 4QGGA 3KTAB 5FNVF 5LA6B 2H11A 3DFUA 5LU9A 3QQ5A 2O1EA 3CX7A 3GLRA 4OYLA 4U5XA 5F1OA 5TPZA 1Y7PA 3P2YA 4AJLA 2BVNA 3CRW1 2KQUA 2BCGY 4PF1A 2IHNA 2DHCA 2WD7A 1FTYA 1YQ9A 1F9EA 4ZKDA 4YJ3F 2O7NA 4QUJA 4KXXA 4MR7A 2CXTA 4K6HA 3IVCA 4P3OA 1C2YA 3E5HA 1R4NA 1N2BA 4CJXA 1X86B 2C7BA 1QYDA 2PXHA 3DOEA 1JLLA 5LNK1 4BMXA 5T6MA 3KCNA 1UFRA 1SG0A 3G2JA 5K0NA 1D6JA 1FNNA 4Y6SA 4HN4B 1HPLA 2C1EA 3K0CA 1G20A 2ZVJA 2V7EA 1EUZA 1RVDA 1T6YA 2O50A 2PSHA 4F72A 3ELDA 4TUYF 1Y5RA 3TX6A 4REQA 4EUEA 3M3DA 1JQKA 3FJOA 3L7NA 3NLLA 4G0OA 4WSOA 5JLJA 2E4YA 3TG2A 1T29A 1FDOA 3EDQA 3GPIA 2Q8PA 1JVBA 1SCUB 2C0QA 3GLVA 4OXXA 4P3NA 3JAMA 1IXKA 2CFTA 4MVJH 3NFRA 4NPAA 3F7TA 3GJ5A 4QTUB 5A7GA 2KS6A 3GEIA 1JPNA 3PUZA 2REOA 3A3PA 3N8DA 4PG4A 4UDYX 3C4QA 4FMDF 5FORA 1P6QA 1AS0A 2DQSA 2FW9A 4OXQA 3R5HA 3JQEA 4FXOA 1G59A 5HDBB 4FFWA 1LRKA 2XT6A 1Z33A 1NC3A 4K6CA 4RVNA 3TDMA 5L3VA 1PQ4A 1FEZA 3CGGA 3OEWA 3ZGVA 5BW4A 3VHLB 5FAKA 4F3NA 2H0QA 1Y3CE 4PANA 4PBSA 4B2PA 2X9GA 3AB7A 1TO2E 1JRLA 3DOOA 4DMKA 4O4LA 4DPMA 1R8JA 5DLDA 2EWWA 2VDPB 4XQ0A 1KE2A 3E1KA 2YWBA 1A8UA 1ZD3A 2CMKA 1LPBB 2IZ1A 4ID3A 5AO9A 1NWHA 4EF6A 1XKLA 3OF3A 2BMFA 4MP3A 4O4HA 1ZD9A 5I7RA 1JLMA 1Z0FA 2J5BA 2WI8A 3QU5A 4PZAA 5DHRA 3NW9A 4HZUB 2CY0A 4JJ6A 4OA5A 2Q5FA 4A03A 1CRQA 3EXIB 1M8PA 1PQPA 3RVRA 2QBYB 4XCVA 1P2SA 4IKEA 3VC3A 1QIIA 4XKJA 5T5QA 3VNQA 3SDBA 3ND8A 1E18A 3TECE 3FWPA 2WZQA 4AIIA 4HH3C 2PKXA 4LDNA 4PR0A 3RD5A 2P1ZA 1KAQA 3DL7A 3PJDA 3UC9A 2JL1A 13PKA 3C3WA 3S2GA 1Z8FA 1YQQA 1AGNA 1FVOA 5EWLA 3G88A 3MMSA 4NSNA 5JQGB 1KVUA 2D7DA 1ZH0A 3T9FA 5BVHB 3FAKA 1I4OA 1DJPA 4BMYA 1N5OX 1YCFA 4LY9A 5CB0A 1PSDA 4L3VA 5JRZA 4BP3A 3HJFA 4IIJF 2F3PA 1K3FA 5GM2A 1W36D 2QVGA 4P33A 3FZYA 5TMEA 2RI1A 2DKNA 3FVWA 1ORIA 2Q9BA 4QLOA 2VR1A 4BEWA 4GYYA 5DXAA 4LEIA 4ZYYA 2C03A 1EX6A 2XMGA 2NAPA 2XEXA 4B48A 4M98A 4BWFB 2GI4A 3OHSX 4AX4A 3ZIAA 3MTAA 1XZFA 3DM9B 1NW7A 1OVMA 3U16A 1W46A 2BDTA 1W36C 3OE7D 3FPGA 1KMCA 4RF4A 1ORRA 3GEBA 3KZMA 4TV8A 5FFMA 1T4MA 2XPCA 1CP3A 3M33A 2ZR8A 1NF2A 4MIOA 2R1VA 3UY4A 2QGFA 3CLRD 3NBQA 4MS3A 5DP1A 4I50B 2OTCA 2ZSHA 5JSUA 4XR4A 5AKIA 5DX8A 2AYYA 4QREA 2FWPA 4EG6A 2VDUE 3JVUA 3T9EA 4I1PA 3IIJA 1A72A 1MOPA 1KORA 1G63A 4ZA2A 2JIPA 1TMOA 1MJNA 2YJ5A 3K31A 3RJMA 1GNTA 3V9AA 1OX5A 2P3QA 4IJQA 4ZEWA 2ZAOA 3RIGA 2YN0A 3CLRC 1UADA 2O07A 4PRKA 1AH2A 1U1CA 3BJZA 1U2SA 3P97A 5CEFA 2PGOA 4NK4A 2OKCA 2B9VA 1PYDA 1CDDA 4FYMA 3WO0A 3P9IA 1CUVA 3PFIA 3IBYA 2C7GA 2VT7A 2WK1A 1AXRA 1YIDA 1V71A 2BFBA 3GJ0A 3QBTA 4R2LA 4P53A 5H0IA 4JC4A 5FWXB 3ZW8A 4LXIA 1A69A 2DPYA 4S3MA 1BOOA 3DUWA 2QNRA 3QWFA 5ES3A 3O93A 4YRTA 3DWGA 4LRXA 5B12A 4YONB 1AKRA 4QXQA 1IHDA 3NC0C 2BSAA 1XU9A 2EKDA 5ECWA 4W5HA 4XFKA 4AAYA 5JO9A 4CG0A 4DNQA 5CJPA 3EG9A 4HDKA 5GIOE 1NBME 3BH6A 4V0LA 4RNDB 4WXHA 4J1SA 3HUUA 4PYMA 3II6X 2QRMA 1T9AA 3KTDA 4HGOA 4RENA 3NTLA 1P7VA 3ESAA 3KPVA 3R09A 4QUKA 1VCOA 3MUNA 5FTWA 2FWMX 1L1RA 3FR8A 1DVRA 4EVRA 1RTTA 1V3UA 4RKYA 4BO3A 1I0IA 2ENWA 4ZQHA 3TIFA 4F6CA 1I01A 2F00A 1JEEA 2O0JA 4N8EA 4JLNA 2GPSA 5D85A 3PJGA 4RTQA 2J07A 1G8AA 2COEA 3EQ6A 3WHPA 1L5VA 1DG3A 3CT4A 3DC2A 5IM5A 1DO0A 1TF5A 1ST3A 1IU9A 1PG5A 2W4QA 4ZHQA 2DETA 3IL2A 2VATA 2IUUA 3LO8A 3TYXA 5C8YF 3DPIA 4L95C 2I66A 4PEVA 2C7PA 1M34A 3FDIA 5CURA 3A9WA 5HILA 4F85A 1Q17A 1N6RA 1Z39A 2OZLA 3OFVA 1UQTA 2QAGA 2C92A 3IPYA 4MQ5A 2SHKA 1BJTA 4R3WA 4K0KB 4Y18A 4DGQA 1C14A 1YR8A 1MNAA 3MN1A 2M32A 4F2GA 1U1GA 3UMYA 1C8VB 4JLKA 2J0SA 1E0JA 1NX6A 4J16C 3CA8A 1BS9A 2VRCA 1BTOA 1NFQA 1RHRA 1X7DA 3GFTA 1XN4A 3JW8A 2R8XA 5FPPA 3BWBA 3C7KA 4UAJA 1RPNA 3OHMA 2ZW9A 4LXYA 4F12A 2AHOA 4E2FA 1Z5UA 5ELXA 4P4UA 4C5AA 3KJQA 3PXAA 3EEOA 1GNRA 4BFVA 2JI8A 2VDOB 9LDBA 3PWKA 1N5DA 1EDEA 2GHRA 2PDAA 4PHCA 4DC9A 3NHBA 4BIIA 4NCBA 2GAJA 3KOZA 3IBGA 3TAHA 1VPTA 4X62B 1G6Q1 4G0WA 2NUTA 1S7CA 3G0DA 1P61B 2I65A 2VXCA 3NJ4A 3S6JA 3ZK9A 4JL8A 2B8TA 1ZGBA 1EDDA 3B20A 4S1OA 3GFRA 4YY3B 3P4XA 5FUVA 1T36A 1Y3AA 3AYXB 2B2NA 1CB7A 3EMBA 3GT4A 4PLZA 2H4HA 2HH9A 1DBQA 3UA4A 2LWIA 2Z6AA 1AJEA 1PEYA 3AILA 4QGHA 4DLNA 3C5HA 1DCFA 1JKFA 2ODEA 4H7DA 1QO7A 4DAEA 4ZAZA 4WXMA 1HFEL 1S01A 3ME5A 1MO6A 3L7KA 3OJFA 4GZ3A 5ERGB 2B8EA 1FFXB 3P45A 1PKXA 1VIMA 3BMQA 4KIUA 1OB2A 1ZY2A 2ZJ0A 4P92A 5IDVA 1XRNA 3G9TA 5MN4A 3WV5A 2DFKB 3O92A 4LJ6A 2HMTA 4TXNA 1FPQA 4EA6A 3TRKA 1ZQ9A 3KR9A 2ZQYA 3B1KA 3G7SA 4YX9A 2NYUA 2XXAB 3FR7A 1XRLA 3UT5A 4WI1A 3H1AA 1QHSA 4WHMA 3KXIA 5K0CA 1TD1A 1PBNA 1QRRA 2G08A 4JVSB 4EF4A 2WWXA 1W0KD 3G2PA 2WP0A 1Q0SA 3ANYB 3KYBA 4BFUA 1OZHA 1XTIA 1YDEA 2CNKA 2IQ5A 2WBLC 4JBYA 1E2BA 3THRA 1FXWA 1G2IA 3NVAA 4BO8A 2BGWA 2FR1A 2OGTA 2CLIB 3KYCB 2C2GA 3CH5A 3EIOA 3HRIA 2QROA 2VPWA 4MV8A 4CLEA 3D0KA 2B34A 1GZUA 1RPTA 1Q77A 2O3JA 3RTGA 4YT5A 3RBXA 3NIWA 5LSAA 3KKLA 4F8EA 2CUTA 2GAFA 3QYJA 4IS2A 3I9V6 4QEDA 4EQ6A 2R5WA 2HMSA 2COUA 3LD9A 2X3YA 4BFLA 4QRHA 2I2BA 2I4OA 2QLMA 1GPAA 4I3GA 4BO0A 4GECA 3JATB 1HYGA 1XZ8A 3F73A 3TF5A 1KYWA 5IP5A 1G7SA 2EW1A 3VU8A 2P9QA 2GN1A 1AOXA 2DKFA 2NZUG 4E5SA 4NMHA 3H9BA 3E22B 4KDEA 4XX1A 1SIBE 1NXQA 1Z25A 2G63A 1SBQA 1Y3HA 1YDFA 2ZJYA 1EFUA 4TKZA 3QNUA 1P1IA 4A8TA 1CQIA 4KJZA 3WGMA 5C81A 2W2TA 1KY3A 2OAEA 3Q2KA 1W2GA 1UMKA 2CVPA 4JI6B 1QDEA 4MWBA 3V4FA 4O08A 4TRMA 2C1ZA 4BQRA 1TI7A 2WA1A 2HWYA 4HL6A 4CUZA 2F8TA 4IIGA 1YRYE 2AG8A 1VG8A 2OT3B 4WESA 5DSZA 3N0XA 3UIEA 1U9YA 2PU5A 3QWHA 3MWJA 4R9UC 5DBOA 5EPEA 1W4LA 4N0QA 3VYWA 1RLMA 2ODBA 4QQRA 1DQNA 5T3UA 1KJYA 1JIQA 4R8RA 4A8JC 4NBTA 3CM0A 5EESA 2GZSA 2QSUA 5CPFA 5HHTA 2QLNA 2RKBA 2FFRA 4GX0A 1IHPA 4FYKA 5AYVA 3ZK8A 5KKCA 3K9CA 3UPDA 1NVTA 1NE7A 1ISHA 3E8SA 2IZ7A 5NLLA 1J70A 2IOYA 5AKXA 5L8VA 1T3LA 2GBLC 3QEOA 2WJJA 1X1AA 3ZBQA 1GA1A 2FG7C 3G9QA 3SEAA 2GFHA 4JVMA 4CG3A 2EOAA 5K09A 4GBED 2XYHA 5DI3A 4KMOA 2GEUA 2R7LA 2VCYA 4CN9A 1TLTA 3RVOA 1FFAA 1KO5A 1IJKA 2V7TA 4P38A 2Y67A 4ERNA 2FN3A 4JN6B 3V34A 2FDCA 1HZZA 2DQKA 2QX9A 4AQYB 4MAMA 3NVKI 1KTIA 1NU8A 3IHLA 4OQXA 5EXTA 1LPPA 1QP7A 2WQZA 2FSHA 3KPJA 1SD5A 3AI3A 2UVDA 4BMSA 1UKZA 1WO8A 4MA0A 4G3XA 4MGZR 2QORA 5BSFA 3ICEA 1FRNA 4FMCF 4ZRNA 3CTPA 4JOBA 4CG2A 2B37A 1UR5A 2B4RO 3FDZB 5GGYA 1E1YA 1UC5B 4UNPA 2HWUA 3S0JA 4XZ3A 1XYYA 4DJTA 5AJWA 2AJBA 1EQ2A 3EEFA 3INRA 1YZFA 4X20A 2O4UX 1G9XA 4RKFA 2YX1A 3KHTA 3H83A 5DBIA 3TR0A 4YIHA 2BE7A 1YRLA 3E9QA 3ZDEA 3ZOZA 4Z7OB 4ND5A 5CP8A 3OKPA 3RFUA 1MJFA 3EEQA 1F2UB 5KHOC 1CFZA 2UVPA 3C41J 4M0MA 1VL1A 1AN9A 1FP6A 1AN0A 2Z9BA 4BV2A 1KEVA 1XMSA 4GPEA 1SU6A 4EHDA 2ZRLA 4R9RA 2C7OA 4C6SA 4ER7A 4EY4A 5K5EA 3DLHA 4BC1A 5I8WA 2H9YA 5DM0A 4IZIA 5EKXA 2C99A 1UKBA 5IH3A 4CI9A 2AK3A 4W63A 1FS6A 2MR5A 2BC9A 2O7VA 1YF3A 4JUIA 2XOEA 2O8CB 5LVAA 1V48A 2OV3A 4E5PA 3C70A 4Y2SA 1RW4A 4HVLA 2G07A 3GH1A 4LJSA 3LTNC 2IYZA 1H1DA 3MLEA 4R9SA 1E3SA 1C3LA 3LYUA 3PQEA 1VJ0A 4GSKA 4AJKA 2YFKA 3IOBA 3OQPA 3VKVA 4PG7A 3DF9A 1U5AA 1XVTA 2JVKA 2R97A 1XF9A 1N0WA 3WL4A 1FBNA 5HJ5A 1OQAA 1T15A 2ZSDA 3HSKA 3ZW7A 4GX5A 1DL5A 4LE0A 5EFZA 1C1DA 1TEHA 1DAIA 2Y1GA 1SCBA 1C50A 4RKRA 2D0PB 3SMVA 3ZLJA 3DBVO 3HU1A 3LA8A 1W9MA 3ZNOA 1XDZA 4Q9DA 4DSOA 1EI9A 2OBYA 4DIDA 2FOLA 1PYGA 2C3PA 1JALA 4QM6A 3ZDXB 1ZU5A 5K3BA 3PEFA 5KQSA 3SJBA 1TQDA 2WILA 4GH5A 2X2PA 3RARA 2J48A 2BGJA 1R0YA 3HWSA 3UWKA 2RONA 1LLFA 1BZYA 2BEJA 2HKIA 4N49A 1D2CA 2DLNA 4ESOA 1DV1A 4DWVA 1QU3A 1L8LA 4DMRA 2EBHX 2ZJ6A 5G0SA 1DFGA 5AI5A 3HGTA 1YC2A 4H0FA 1HQCA 1C9MA 4AKGA 1N6KA 2A8YA 2BFEA 3OEED 3T0IA 2BMVA 3KDAA 4LAFA 3CNOA 3JYOA 1G17A 2DJIA 3L4BC 4UU7A 4MYCA 1RNLA 4AWAA 5B37A 4Z4EA 4FB5A 1BKDR 5FUBA 1SUEA 3JYNA 3D1VA 5LDDC 2DYKA 1EFAA 2II6A 3N8HA 4WKPA 4EVQA 2J3DA 4HUQA 2WSLA 4H1HA 5HKLA 3ORFA 5LLDA 3KALA 1F2DA 3MCWA 1OZGA 1GQSA 5KYVA 1BA2A 4Z0HO 3U1VA 3L92A 2VTVA 3WZ2A 4TWZA 4QDTA 4MCAA 2IH2A 1KOFA 3VAAA 3OQMA 2PO5A 1UWLA 2A0KA 4FX5A 3X1JA 2VEDA 1SUFA 1ZZEA 1WHSA 1GNSA 1MX5A 4WY2A 4LF5B 2F3TA 3VPAA 2R8YA 3KEOA 3DOHA 4NG4A 3U7QA 3JASB 3F4KA 3DKIA 2D06A 1E6EA 1QRDA 3D6MA 3KOOA 4AS3A 5JMTA 4W1PA 3AI2A 4HXGA 2Z4RA 2OUKA 2E1PA 3IDOA 5AM2A 3E9NA 1MFPA 1Q0ZA 5ARCA 5J2UB 2XWQA 3RCBA 1Z5OA 1RKXA 4FZRA 4ROSA 1ZNWA 1SC3A 1O54A 2WRZA 4YPOA 4CW7A 4ZCRA 3NTQA 4ZFNA 1K3TA 1FQJA 2NTNA 4PX2A 5B5SA 2O6LA 1ENOA 2VF5X 4EEKA 1JKJB 2CNLA 1QHHB 4C6TB 1W0KA 3TLAA 4RC9A 2HCFA 3QPUA 4P4NA 5H70A 2R60A 3GCWA 4OAPA 5EJMA 4CT0A 2Y9MB 2JGKA 2O2YA 4REMA 4EW1A 5AVZA 1P80A 1RXUA 5LQSA 3SHWA 1NN3A 3A6DA 2WE8A 3T5TA 4WXYB 2J9RA 4YMLA 4ER0A 4O33A 2A9QA 3F47A 1T91A 2WTXA 3BYZA 1J00A 3HYTA 3NH9A 3GLFA 2WWFA 3V7NA 5K01A 4ZOLA 5I7FA 1L7XA 1OE0A 2OHGA 4KO2S 4TROA 4HP8A 3I6ZA 1WMEA 2PT7A 1JFVA 5B36A 1NNSA 1P4GA 2ZYDA 3AESB 1CHNA 4OK5A 3UO8B 4LJLA 3CSUA 4EPVA 5I3CA 3WGHA 2Q3HA 2PZGA 4EP1A 1XNRB 2R96A 3OBBA 2CLOB 3B7WA 3EDYA 3NZEA 1OY1A 4EI8A 2HBQA 4GOLD 4BNLA 4CKBA 3IHTA 2VAXA 1HLPA 3IAUA 2BHSA 1YJ5A 5JNTA 2PX0A 2PVPA 3JWHA 3LZCA 2DECA 3TXYA 2DPMA 4D7AA 2MOKA 4EJSB 1NOIA 4YCBA 1ADCA 4JLDA 3TZQA 4B6QA 4B73A 2G4VA 3SR0A 4BO4A 1X14A 4MWOA 3C7AA 4A8JA 1SVSA 3TSAA 5JI3E 2WA2A 3F6BX 4MV1A 1TUBB 1N9GA 4ITVA 2G77B 3E1SA 3UXMA 1WMDA 3TEFA 1MB3A 2ZTHA 4L74A 1MC1A 2XQVA 4RVOA 2VP2A 2B6HA 5HCUA 4GBJA 1QG0A 1MNQA 2VA8A 4KFSA 4XLTA 4FBGA 2GBLA 3C8UA 3VNSA 3CE6A 2OXCA 3QEBZ 1O5TA 3D02A 3CZPA 2CV0A 2AZTA 2FRDC 1F8GA 1K4MA 3PZRA 2Q1YA 1A76A 1LDGA 2H18A 3SJCA 2EJVA 4NZYA 1QX4A 3HO8A 4I5DA 3PFWO 3IEXA 3UW1A 1FTSA 1D5WA 2DUMA 1P0IA 1Z28A 5AVWA 2B83A 1Q7GA 1CEQA 4WGGA 5CVCA 4EITA 4QTXA 3ROQA 4IUYA 3SZRA 2JFXA 1Y5IA 2J7PA 3IC5A 2O7SA 6ABPA 4BP8A 1J5EB 4OGGA 3WLRA 3CR7A 3P9YA 1JTFA 1HTWA 4KE9A 2PL5A 2WNSA 4EPRA 3F5DA 2IHYA 3FW1A 1T9BA 4LQ4A 4A10A 4B3SB 1II9A 4J0QA 3GNSA 2GLTA 4GI7A 4HO1X 4GUDA 4DCCA 1LPNA 4DCNA 4Q6WA 4M22A 4YA6A 2PD4A 5KJFA 1D2RA 3DWFA 3FWHA 1JI0A 3OE5A 4C03A 5KNBH 2F62A 3K1AB 1T5DX 2VT2A 3H19A 3P0HA 4P5DA 5AKLA 3ZI7A 4DZZA 3ILSA 3HYLA 1ODFA 2J85A 2WB4A 4D9HA 3CJQA 1QGOA 1N6PA 1SGWA 2UYYA 2YMPA 2EQ5A 3EZYA 3FHLA 3HN6A 3PR3A 4UZFA 4ZVRA 3FPLA 4GPBA 4DMMA 2CKDA 1RLUA 3FYCA 4OGWA 2PYZA 1KQOA 1JA9A 5ESWA 4FTWA 4EO7A 2FFBA 2V3CC 1GL3A 4UHCA 3OZRA 3HY3A 3U26A 4ZAVA 1CYDA 4M7OA 2GKGA 3WB1A 1KGSA 1EFRD 2CMFA 2EF1A 3EVEA 4FFBB 1NUTA 1P17A 1GCGA 2WVGA 1BXGB 3ABSB 3JV7A 4FS3A 4GQBA 4DBVO 3AY7A 2Q6LA 1KJQA 4B6GA 5CFPA 2AJTA 4OG2A 9GPBA 3N2LA 5JNLA 1J49A 2DT5A 3CMMA 2F6RA 3P9QA 5HSGA 5GJBA 1RP7A 5EERA 1QAMA 2OFOA 1WIWA 2RI0A 1PX0A 5K3OA 1HKUA 4DY6A 2GF2A 3H2BA 1YB6A 2XYPA 1T1IA 4YMIA 3AR3A 3PQFA 4QUDA 3FCSB 4PFKA 4S1VA 4KMRA 3TDKA 3I9LA 1LPMA 2Z5GA 4CFYA 3UPUA 1JGTA 1Y8QA 3T5MA 1RPZA 5JOQA 3BXOA 2W7TA 3OU6A 2H4ZA 4WOCA 4BMDA 1I6LA 1JSZA 3E35A 1MX1A 1AKMA 2B4TO 1CR4A 3NONA 1JDSA 1DSSG 1NASA 2C9BA 1ZC4A 2UZ1B 3E61A 1X7WA 3ENZA 3W4IA 2CXUA 3NNNA 1RAGA 3WIOA 1W85B 5BSUA 2HLDD 4OA8A 2LE0A 3S1SA 1IRXA 3O91A 4EY5A 4EKYA 1R15A 4PLHA 3O4RA 3CVWA 1GG9A 1JR4A 4LOJA 4RS3A 3SCZA 4C30A 2BCEA 3DE6X 1HDOA 1Z82A 2LIPA 2D62A 3L4BA 1WB9A 2XE4A 1JA1A 4ENSA 3L84A 5SICE 1PK9A 1UXIA 5BSTA 1V5EA 4S1PA 4G2TA 4KIGA 5EXDA 3ZQJA 3I83A 2WAYA 4UMFA 3KE9A 5TS3A 4H3SA 1E2EA 4RDCA 4Y7DA 5DHTA 1CE8A 2CK3D 3PWTA 3CN9A 3MWLA 2FR8C 2J3JA 2AC7A 3PX3A 2YRFA 4CTMA 5L4SA 4NBWA 1PCXA 3OEEA 4UBKA 3GRZA 2XBMA 4MS1B 2GZ3A 3K2EA 5FOUA 1XZDA 1RD4A 1FUYB 1BOFA 4OQ4A 1Y6GA 2GZMA 2IOHA 2IS1A 1W94A 2H7XA 3THYB 2WYOA 2DQZA 3OCJA 5KVCA 2P68A 3KV1A 3TSZA 1PWZA 3EYAA 2VYVD 3WBBA 3ESRA 3MZ0A 4YUAA 4LI0A 1ZSNA 1E9RA 3KZKA 5SZKB 4WADA 1QIDA 3W7VA 1DBSA 4M1SA 4M46A 3RFCA 3TW8A 5AM4A 5IK2A 4MRPA 3IALA 3U3XA 4TVSA 2HW8A 5DVZA 2ACKA 4Y6GB 1OAOA 3FPEA 5LMUB 4RF2A 4RVHA 2ZBUA 3KUUA 3KPUA 2D5CA 4KXQA 1GRRA 1FQKA 1KBQA 2HY7A 4HD8A 1GPJA 4B34A 3MBIA 1WXDA 2VK8A 4KYTA 4N4AA 1QH1A 4D44A 5IPFA 4JXZA 1BCSA 4FCTA 3WGVA 1EVQA 4FFRA 4JQZA 2ARKA 2HZBA 1T6BY 3UWPA 3ZHZA 2VTBA 721PA 5F5XA 4RZHA 2LIVA 3BMOB 4YGXB 4ZO8A 3VR6A 1T2FA 4AG5A 4JT2A 4GBMA 1MZPA 4B45A 1AXGA 1X7ZA 4IM7A 4EENA 2ZR9A 3A6ZA 4AJ2A 1K88A 3EIFA 5HUHA 1XNQB 4S1WA 3KKMA 2D0OB 4UFNA 4DDWA 1H8ED 1GG8A 2NNLD 1J2EA 2WD8A 3HVUA 3TTUA 4C4AA 4WQMA 4KDFA 1S02A 4YN3A 1DAMA 3PFGA 2OGSA 1TMKA 2Z1MA 2P9YA 3OX1A 3ADPA 3KWFA 2V65A 3RYIB 2AE2A 2JFGA 2BPOA 1JJVA 4KG7A 1RBYA 3SJ7A 3C7CB 1QYVA 4WKOA 1VJCA 3ZUGA 5CDFA 1QYXA 1YBVA 2WT9A 3BN3A 4CRWB 5HR5A 4YAGA 4GVPA 4U7JA 3TNDA 2H1VA 5HQ3A 4XSVA 3WL3A 4R83A 1QP0A 2DRIA 2Z3VA 1XCMA 2A88A 3WDLA 4PYQA 2VUTA 3OCWA 1DLJA 4MGEA 5BXQC 3O0DA 1CZKA 4WCFC 2LNDA 1C3OA 3O84A 3PG5A 1GCOA 1Z7WA 2WF9A 3EEBA 4UD2A 5JXIA 1LTHR 3C1UA 3NRBA 4MVWA 4CMEA 1DADA 1EGMB 1L4FA 3B3QA 3QU2A 3WTBA 3ASUA 3ONDA 3LIPA 5ES4B 5M04A 3V8VA 1T1GA 1MX3A 4BRSA 1T2UA 4W1QA 1R6BX 1P9LA 2EYUA 4D1YA 4FSDA 4HXYA 4HEQA 4CG1A 4KPEC 4C0HA 1V7QA 2IKSA 1VPWA 4RVSA 4LZZA 1VP3A 4IUDS 4URYR 4AZSA 1RZRD 3AVYA 1ULAA 3LLSA 2ZBEA 1O89A 4JA0A 2W9XA 3V8RA 4Q47A 1OIWA 1L6IA 1RWMA 4P31A 1TKBA 2HMVA 4B32A 1YUMA 5DXJA 4B3IA 2WJVA 3K1JA 2AEJA 4EEXA 2FRDA 2WU8A 2EDCA 1LF5A 4XTRA 3MPUA 1KMHA 3AJAA 4ZT4A 4FWIB 1H65A 2ZRCA 4PAWA 3HWWA 4DXAA 1N4DA 1WD7A 2ZUDA 4BNFA 5LKRA 2IDMA 3C39A 1RAEA 3OC6A 4FGSA 1E0DA 3W2EA 2JJMA 4MDFA 4TSRA 1MF7A 1MN6A 4RULA 1XTUA 4KXFB 1FPMA 1G4UR 1YL6A 5E8JA 2C9OA 2HQOA 4E0BA 3HA5A 2FX2A 3TQQA 4LCJA 1RYDA 1WY7A 2YWGA 3AZQA 3OI7A 5TY0A 2C5AA 1GKLA 4RWEA 4GOXA 1AZWA 1KK0A 1T8WA 3UGJA 1AMNA 1KIFA 5KQLA 2VLBA 4MWZA 2C61A 5EJ7A 5DMHA 1WF6A 3ESZA 1QRSA 3D59A 3T9AA 2WOOA 1OWNA 2Q1TA 3LHIA 4QGFA 2OG1A 4COOA 5AW3A 5KQPA 2Y6UA 1Z47A 1ODSA 1P0PA 2RGAA 3CX3A 2J7KA 2I7TA 3EZXA 3QVJA 3B60A 4QAJA 5NULA 1GHTA 3RT9A 3D6UA 5JS7A 5IUJC 3IIEA 1KEEA 1Q50A 5JAMA 1ID1A 1DAKA 1HDRA 2G04A 2W8BA 2Q4EA 5BYBA 4P0QB 4RIHA 1DRJA 2XODA 1TYZA 4RGVA 2HF2A 4UM9D 4ZODA 1IC6A 5KYWA 1QZTA 1GPH1 2EERA 4HNHA 5F2NA 2XB2A 4LXGA 3OY2A 3BXEA 4YRKA 4HYEA 2IX9A 1W6RA 1Q14A 2VJKA 3A3NA 3KVRA 5HIMA 4KIFA 2E4UA 4OBWA 4Y30A 3GEMA 1NW9B 2G36A 1TJ4A 1MT3A 1HE5A 1GCAA 4CLRA 1HEYA 3TVTA 4BMNA 1HK7A 3JQFC 2R47A 3ESXA 3LX4A 4O6VA 5JSHA 1GGMA 2V4ZA 1B2RA 2YH2A 3GEEA 3DE5X 1RYMA 3A04A 4XDHA 3H2KA 1KKMA 2HN9A 4OL0A 1QQ6A 4A0RA 1HYEA 4J0KA 5J1TB 4FQ5A 2FSVC 1BFDA 3VH3A 1CUYA 3WHIA 4B83A 4DBLE 5CB4A 5HW0A 2HSEA 4HATA 5L3ZA 3DFIA 4BLUA 4U7PB 4OAQA 3TQCA 4TS3A 521PA 3V32A 1CJKC 3VX3A 3UMMA 1EFRA 2ZYHA 4PE5B 1HE8B 1LJLA 1E9FA 3I72A 4ZAFA 2C2ZA 3B85A 4KR2A 1UPAA 4ROTA 2RHWA 2PO7A 3QPWA 4WZZA 5JBNA 1KAMA 3BTSA 4G01B 3RUHA 4AK9A 1JTVA 2LBPA 3V42A 1UMBB 4BVLA 3U39A 3FHJA 3K6JA 4HRYA 1YT5A 1JU4A 1P1JA 2AIRA 3LT5A 1D2NA 3D0RA 4QGAA 4XIIA 1GL6A 3RUPA 5C1PA 1KZ6A 1RYHA 2Q46A 2EKBA 3MSCA 2X4DA 1MHTA 1R0KA 5I48A 3N6RA 2Z2IA 3F5FA 3P32A 1TIPA 4ZVQA 4C07A 5C52B 3DOCA 2I2XB 3LYHA 4Z4GA 3FJ1A 1WUTA 1YMQA 3K9BA 4PPNA 2F1JA 4B7ZA 1J8QA 2RG1A 4X6XA 3DFMA 5I01A 2PH1A 1CNEA 5DGIA 5CYFA 3QHAA 5CG2A 1T4CA 3N6XA 3GAFA 3EUWA 3PYMA 1RXIA 4L8GA 1O6GA 2WUDA 5K3FB 1W4CA 3WGUA 2XKBA 3D7KA 3K30A 5KX5F 4PWZA 2HLDA 4FMBB 3BL8A 4WZBA 4OQLA 1G291 3D43A 2I5PO 2GWHA 2ZIWB 3ROPA 3AM1A 2VAWA 3LRXA 4IHJF 1PVVA 3ESYA 3V2GA 2VXYA 1ONOA 2VI5A 4TLEA 4BQSA 2WM3A 4KHZA 3T3OA 2CXQA 2WYIA 5G3YA 1HZJA 2H0AA 3R4CA 5ICGA 4KVZA 2CGEA 1I32A 3QH4A 1XQ9A 2VWQA 2NIPA 4FDVA 3RS9A 1STOA 1U5CA 3FRHA 3B1ZA 3HS3A 4REOA 4BX3A 5JECA 1Y6RA 3ABQB 3LVFO 4TTIA 2CK3A 2J3HA 3O4GA 3B8HA 3OESA 3RLFA 3UTDA 2DTXA 3GXOA 3L1VA 4BBPA 3AKYA 4X1KB 3ZOKA 4DM7A 2OLEA 3JTMA 2DJ5A 4NTZA 5UKDA 5IDWA 1L2TA 1RBQA 2CYBA 3B6JA 2R6HA 2OQVA 1WDWB 2YRXA 4DR2B 4G0VA 1EAYA 3JSAA 3AY3A 3EOBI 4I08A 5IX8A 3A27A 2ONZA 1D0SA 5ENDA 3KQUA 1GITA 1X3SA 1A9QA 2VYVA 2GD6A 1DIGA 3TTWA 1SVMA 1U7DA 4CIXA 5IFLA 1LQ2A 3RSOA 2AA3A 3BRWA 5DKFA 1K86A 3P4UA 1DBWA 1Q3KA 3I9JA 1XR3A 2UU9B 4U2DA 1HV8A 2OENG 4C0BA 4C78A 2OY0A 1ZMRA 2EFDB 2J6CA 4KQWA 4MUJA 5GZ3A 1QYWA 3FX2A 3RNLA 6NULA 3GEHA 1GIAA 3E48A 3QXCA 3ZCSA 1WWKA 2K2WA 2VFAA 2X14A 3AJDA 2DWPA 3K9HA 1Z34A 2GJKA 1ZRSA 3LBIA 1PDOA 3COVA 4FCWA 2WFZA 4YQYA 4KL8S 5BYAA 1DT5A 3S3TA 3N2ZB 1VPLA 3OOSA 3DKKA 4AO8A 1TM1E 3CG4A 5DOZA 3AOEC 1LEHA 3COSA 4FIZA 3VZCA 5CYPA 3T3MB 2FF7A 3U4DA 3L6CA 2GDJA 1PJSA 2EJUA 4XLLA 5EXSA 2I4RA 5JNUA 2GQ0A 2Y1OA 1RRGA 3M1AA 3F5SA 5EWMB 3GP3A 4Q3LA 2YIDA 3RODA 1U3FA 3AKEA 4WCFA 3S29A 4M1YA 1U7HA 4N3CA 4RPLA 1R5NA 2CD9A 2FE4A 1JIKA 1M2JA 1OXMA 4L8WB 1SIUA 5DJ5A 1N0IA 2YXDA 2JKYA 2KE5A 4TMVA 3ZNPA 4YDSA 3W3AD 5LXTA 3X3HA 5ENZA 3DCJA 4ZVMA 2P35A 5FHRA 1JNXX 5FI5A 3JQ8B 3OA0A 2XMRA 1XZAA 4NU8X 2I4TA 1P2UA 2B1IA 1U99A 2B78A 4LDZA 1WM1A 4JYCA 1WVGA 2C20A 1NV9A 1ZJ6A 4IW3B 3QVGB 2PX6A 1DI0A 3U7RA 3AJ8A 4CZ2A 3PQCA 1K9VF 1IBMB 2VPXA 3NBUA 3R6LA 1ZA1A 4IGAA 5LQDA 5AJHA 4CM7A 1PWHA 4M1OA 3LKBA 3VU3A 1O95D 1SXJD 1R9GA 2BEWA 2I3ZA 1C7RA 1FSFA 1OH6A 4KN9S 1QPZA 1U81A 1RZRA 5EHGA 1F0PA 4LW8A 2EIHA 4TKUB 5FFNA 4WDQA 4MVJD 1PJ8A 4GF5A 1R00A 1GRQA 1DT3A 1Z0DA 2CDAA 5HIKA 2W22A 1X1QA 4C3ZA 2IZOA 4G81A 3THWB 4EA7A 3WLJA 3DFKA 5B58T 4KQ9A 2PXXA 3OOEA 4ETWA 4P83A 4BNWA 1O95C 1ORHA 1SXJC 1TQ4A 3EZ6A 1VYUA 3HCFA 1C7IA 4G0XA 1VXOA 1AUVA 2G8LA 2EHDA 2HBYA 2Q4OA 4MQ4A 4MVJG 4FBMA 2QSYA 4O63O 4LV8B 4TWIA 4DWOA 2AJDA 1D4AA 3D81A 3DQQA 1HBJA 4JMLA 1DEXA 4LPSA 4W4TA 3QPAA 5GONB 1IZYA 4DEXA 3HWX1 2Q5JA 3OX4A 2GJ4A 1G21A 3DDSA 4JUFA 4YIKA