2LVMA

Solution structure of human 53bp1 tandem tudor domains in complex with a histone h4k20me2 peptide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
123
structure length
123
Chain Sequence
GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor suppressor p53-binding protein 1
publication title Acetylation limits 53BP1 association with damaged chromatin to promote homologous recombination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 27
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lvmA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lvmA01
5KCOA 3CCUA 1YITT 1VQ6A 4BE0A 2O4XB 2JZ2A 3OYCA 2EFIA 3CCVA 4GY5A 4BDYA 3G4ST 1QVGS 2PQWA 2XHCA 3UT1A 3META 3PFSA 2OTJT 5D6WA 1VQMT 3CMAA 1VQ8T 2QEXA 5KE3A 3CC7A 5D6YA 3OB9A 3MEUA 1QVFS 1Q7YU 3CPFA 5IN1A 2YRVA 4N4HA 2LDMA 1Q7YC 3OW2A 1OI1A 4QQ6A 1Q86U 3FEOA 4B9WA 3G4SA 2EQUA 3MP6A 3H6ZA 1Q86C 4IUQA 3OQ5A 3CCMT 3CMEA 3CXCS 1YJ9A 2OTLA 2KVQG 3CCST 1NJIU 4E7KA 1EIFA 1Q81U 4QQGA 4QVZA 2KDSA 1M1KU 1VQ5A 3QJ6A 4FU6A 1KQSS 1JJ2S 3OYMA 3LGLA 3PIOA 3LGFA 3CPWA 1N8RU 3LYIA 2QA4A 2M1HA 1UEBA 3JAME 2RI5A 3CC4A 1N8RC 3CEYA 2RJCA 1YJNT 1K8AC 1VQKT 3OYHA 3OYNA 2JOYA 4QQDA 3CCSA 2RJFA 3J7AF 3CCQA 5FRNA 3CC2A 2RHYA 5FLXE 1IZ6A 4LD6A 1YHQT 3CCJA 3I55A 2IG0A 3NTKA 1OYXA 4TVRA 3OYIA 3OS0A 1OZ3A 3H8ZA 1KC8C 3OYKA 1OZ2A 2L89A 2EQKA 3NTHA 4ZN3A 3CCRT 3E9FA 3PIPA 4PLLA 3TREA 5CIUA 1VQLA 3LX7A 3E9GA 4E7IA 2K3XA 2E70A 2RI2A 3L2RA 5IAYA 3OYDA 3S3NA 1VQ7T 4IUPA 2JVVA 3CCET 3OYBA 3KUFA 1VQOT 4EDUA 1BKBA 3CCRA 3OYLA 4UC4A 3CPWS 2L3RA 2LCCA 2X35A 3SD4A 4QW2A 3BDLA 2G3RA 1W2BA 4PL6A 3FC3A 2DIGA 3L2WA 1VQNA 2P0KA 5HY6A 3DLMA 1VQ9T 2R57A 4BE1A 3OYEA 2LTOA 3MP1A 1YITA 1M1GA 2K3YA 1WJRA 2OTJA 2MWPA 1VQMA 3L42A 3S3OA 3KBGA 1VQ8A 2GF7A 3DB3A 5J39A 4Z02A 4CRIA 1YIJT 5C6SA 3OS1A 3OYGA 2GFUA 2DIQA 3OYYA 5D6XA 3GOXA 4NS5A 3UWNA 2RHZA 4IUVA 2E6ZA 1YI2T 3OYAA 2RI3A 3DLLA 4E7JA 2EIFA 1K8AU 2RHIA 2X4WA 3CCMA 3G6ET 2XK0A 4BE2A 2NLUA 3L2VA 2FHDA 3J81E 3G71T 3OYJA 2O4XA 1YBYA 2D9TA 1YJWT 4C5IA 1NZ9A 4Q5WA 2HQXA 4HCZA 3ZEHA 2M16A 3OMGA 3M9QA 1KC8U 4C5GA 1YJNA 1VQKA 1QVFA 2R5AA 3OW2S 4ZTFA 4A4EA 2WACA 2MWOA 2RJDA 2EQMA 2RJEA 1WJSA 1YHQA 1VQ4T 2CKKA 4II1A 3P8DA 3CD6T 4E7HA 3CXCA 3CCUT 3QKJA 4A4GA 1VQ6T 2RHXA 3MEWA 2B8AA 4BD3A 3ASKA 4YTLA 3CCVT 4IUTA 5C0MA 5KH6A 2HQEA 2DAQA 2BUDA 3FLGA 5FROA 1K9MU 4C5EA 5A2QE 3LLRA 3CMAT 2QEXT 1WGSA 3CC7T 2JUFA 1RL2A 2XDPA 1K9MC 1H3ZA 1Q82C 1VQPT 1M90C 1VQ7A 3CCEA 3OY9A 3Q1JA 3P8HA 5LL6S 1VQOA 3OA6A 1K73U 3CCLT 3F70A 5IT9E 3MEAA 1K73C 2F5KA 4ZTJA 4FL6A 5FRMA 2JNGA 1WJQA 2VYTA 3CMET 4BACA 3EAEA 1YJ9T 3S6WA 2OTLT 4B9XA 3O8VA 4N4GA 3L2UA 1XTDA 1VQPA 1S72T 5DM7R 2LRQA 2EKOA 1NPRA 5KE2A 1VQ9A 4IURA 1VQ5T 3CCLA 4A4HA 3OS2A 3NTIA 2QA4T 1KD1U 3CC4T 3LH0A 2DO3A 2BKDN 1X6OA 1KD1C 2JTFA 4OVAA 5KCHA 1KHIA 2BIVA 3L2QA 1S72A 2X4XA 3OMCA 4IUUA 3ER0A 4C5HA 1YIJA 3CCQT 3PNWC 3CC2T 5DLQE 1NJIC 1Q81C 3DB4A 1M1KC 1MHNA 2M0OA 3QBYA 3CCJT 1NPPA 3I55T 1W2BS 2EQJA 1YI2A 1N27A 1KHCA 1QVGA 2E6NA 3S3MA 3G6EA 5J3BA 4PLIA 4IKFA 3G71A 1VQLT 1RI0A 5M9OA 1YJWA 3PMTA 2E5QA 2R58A 4RG2A 3OYFA 2L8DA 4E7LA 2LVMA 1G5VA 2QQSA 4N4IA 3HKSA 2GFAA 3FDRA 3I56T 4ZN1A 3QIIA 3MEVA 3C4SA 3P8BB 3ME9A 4X34A 3MP8A 4L59A 2LQ8A 5J26A 2RO0A 2R5MA 2LCLA 1KQSA 1JJ2A 3MO8A 2QQRA 3J80E 2RHUA 4BDZA 3A5ZB 1VQ4A 1Q82U 1VQNT 1M90U 3PMIA 3I56A 3CD6A 1SSFA 1XNIA 2X4YA 4A4FA 2MI6A
chains in the Genus database with same CATH superfamily
2XDDA 2Y4YA 1M3BA 4F7UG 2LJ3A 2DILA 2DF6A 2VGMA 5GMKj 2QA4Q 1GCPA 2EGEA 2JZ2A 4LD9K 2O9VA 1N9SA 3LWIA 2BZXA 2EQIA 2RH2A 3L2ZA 2XHCA 2DKGA 3M0PA 2ED1A 5GAN5 2XG8D 4EMGA 5IH2A 4R56A 3M0UA 2GGRA 1D0ZA 3MEUA 1M2VB 2YHTA 1Q7YU 3CCQQ 1WPYA 1AZEA 4CI0C 2YRVA 4N4HA 1OI1A 1X01A 3OW2A 2QGGA 4FT2A 1UGPB 2MOXA 2KGTA 4WCIA 3PGGA 3H6ZA 4M7AD 2FPFA 3CMEA 1YJ9A 1HYOA 2QK0A 1TUGB 5GAOn 1FX7A 1EIFA 4QQGA 3H0HA 2DBKA 2GBQA 4M77A 3NMZC 4DOWA 2VGNA 2LJ1A 2EBPA 1IGQA 2CT4A 2D8JA 3LGLA 3CPWA 3LYIA 3JAME 2OX7A 1U1TA 1UGVA 1WHGA 4XTUA 5GMKi 1YJNT 3OYNA 2K9GA 1Y71A 3CCSA 2ZPIB 3VS1A 5IHIA 4C92G 4WTOB 1X6BA 2XMFA 3M4YA 1M5Q1 1N9RA 3VKIA 2LNVA 1M2VA 1G3SA 2F69A 2CDTA 1TU0B 2CUBA 2AKKA 3OS0A 1LOJA 3RKWA 2O01E 3VUBA 5GMKl 1KC8C 2HD0A 4M7AA 2AIRB 2FRWA 4A54A 3CCRT 1VIEA 3PIPA 4IIMA 4LXCA 3KFVA 2JS2A 3LX7A 3E9GA 2EWNA 3DKMA 2E70A 4RTVA 4MZPA 4Y28E 8ATCB 4LNPA 2Y4XA 2DMOA 3RKXA 4BI8B 3PVQA 1FXXA 3S3NA 1VQ7T 2JVVA 1PSFA 1WLPB 4M78G 1BKBA 2C0OA 2CUDA 3OYLA 4OGCA 1KSWA 4UC4A 3X28B 5GAMe 3CPWS 3V8LA 1D0XA 1AEYA 2K5LA 3SD4A 4E47A 2OAUA 2KXDA 4HCCA 5KYNA 4LDUA 1CSKA 3FC3A 1O9SA 1VQNA 1YIJQ 1R0CB 5HY6A 1OQKA 2KYMA 4NOYA 1VQ9T 4PJOD 2CZ0B 3OYEA 1WFWA 3AT1B 3M0RA 4EMHA 4FYWB 3VUZA 3R6OA 4FSXA 4R0KA 4AMCA 1S1NA 3PT9A 1YJNQ 3H0FA 1RAEB 3VRYA 1GCQC 1VQ8A 2COZA 2FYKA 5LJ3e 2E3IA 1RAIB 4KUIA 2GF7A 3SDZA 1M3CA 1IXDA 1Q82R 1M90R 2F2WA 2E65A 3SHWA 1QCFA 5CK9A 2FEIA 3JB9D 2RHZA 1BI3A 5A0LA 2I0NA 1YI2T 2EIFA 1VIFA 2KRMA 4C8QD 1KFZA 2J7IA 2RHIA 2X4WA 5KYUA 2XK0A 4OMPA 2FHDA 3HHTB 3BFMA 4LDYA 3GLXA 3WVDB 1YJWT 2Z0WA 3TCJA 2DL7A 2D1XA 2PVOB 4PJOA 2YUQA 3GP8A 1TG0A 1IREB 2M16A 1VQ7Q 2JS0A 1Y57A 3TU4K 1Q86R 1TS9A 1VQKA 2RQWA 4J6WA 2R5AA 1YFNA 5IXFA 4OB2B 2MWOA 1QLYA 1PHTA 1ZUYA 2EQMA 5IHNA 4RCBA 1NJIR 3QZ5B 3NHNA 1VQ4T 2CKKA 4II1A 3P8DA 4Z88A 4OP0A 3CD6T 3JSCA 2A36A 4E7HA 1VQ9Q 1N8RR 4F7UE 1FMWA 3CCLQ 2X4JA 4J9GA 1PC0A 3MEWA 4M7DA 2CH4W 3I35A 2B8AA 4BD3A 3ASKA 3EHRA 3TSZA 1C1AA 2HQEA 2W0ZA 2BUDA 3FLGA 5LJ5e 3FJ5A 5FROA 2OTLQ 4XTWA 2GCXA 2JJ9A 2AT1B 4MMLA 1K9MC 1VQPT 1BI2A 3RKYA 3UDCA 2A28A 3OY9A 3Q1JA 3P8HA 2V1RA 3OA6A 2DE0X 1VQOA 3A98A 5DY9A 5IT9E 2ZPHB 1YI2Q 1V1CA 3RERA 4M75F 1T3LA 2CH4A 2F5KA 4NL2A 4RTWA 3QWXX 1SF9A 4DA4A 2JNGA 3A8GB 2VYTA 3CMET 1YJ9T 2OI3A 3EG0A 2LQWA 3UA6A 4ELZC 2VB6A 4J9HA 5DM7R 2DXTA 3EFRA 2H8HA 2KE9A 1YJWQ 5CKFA 1V29B 1GBRA 5KYYA 3G1JA 1MGQA 3LH0A 3O5ZA 1X6OA 2CREA 5KCHA 1JEGA 1S72A 4M7DG 4AFSC 2CSQA 1YIJA 2XD0A 1X75C 2K5FA 3AHUA 4JZ3A 3FRNA 4J5YA 2M0OA 1VQ4Q 2YRCA 2QYZA 2VVKA 1W2BS 1PRLC 1SHGA 2O31A 1N27A 3A8LB 1QVGA 3C0CA 1G3WA 3FJPA 1PRMC 1R0BG 2CP7A 2LZ6B 5D7UA 1OEBA 2HKQB 3EHQA 4ZGEB 2DL5A 1U5SA 1UE9A 2K7AA 5M9OA 2HEQA 2DLPA 2AHJB 3EG3A 3PMTA 5KYWB 4RG2A 1JBMA 1WXTA 2DTHA 2XI9A 4E7LA 2LVMA 3TQ7P 3BY7A 2GFAA 4GBQA 2E4HA 3RMSA 2P0QA 3C95A 4AFQC 3MEVA 3P8BB 3ME9A 4M77E 2JMAA 4RTZA 1C0MA 4DOVA 5CKDA 3QJYA 2LC4A 1K8AR 1Y0MA 2NUPA 2DA9A 1PD1A 2LP5A 4Y92A 1Q95G 1NE8A 2RA2A 3J80E 2RHUA 1PM3A 3PVLA 4BDZA 2BTTA 1Q82U 1VQNT 3QUIA 3PMIA 5GAN2 1UDLA 1M90U 3I56A 4LDWA 2LCSA 3A1PA 1U1SA 4A4FA 1XJWB 4OMFB 2A37A 5KCOA 5GAOq 3JCMc 2O4XB 1WIEA 2EFIA 2EYYA 3MCAB 4OMOA 1WQ7A 1M2OA 2PQWA 1QVGS 4JPBW 2G6FX 1H641 4M7AE 2E1HA 4CC3A 1VQ8T 5CKEA 2QEXA 3CCSQ 2YUPA 5GAOl 2DEUA 2IIMA 1XOVA 3CPFA 3EH2A 2FO0A 1R77A 4M4ZA 1UGSB 4E6RA 1Q86U 3QXEB 6AT1B 5CAIA 1UECA 3G4SA 1WYXA 3MP6A 3SWNA 3URGA 1E7OA 4IUQA 2HBWA 2DNUA 2OTLA 1ZLMA 1NJIU 4E7KA 2PVDB 4BI3A 1G3YA 5IXBA 1NLPC 3QJ6A 4FU6A 2KR3A 3RR6A 1W2BP 3WXMB 1MNEA 1N8RU 4M77F 1K73R 4KUDK 4KGVB 1Z9QA 3CEYA 2RJCA 2HZYA 1NEGA 1XQHA 1VQKT 3OYHA 4QQDA 4J8OA 2RJFA 4Y91A 1Y96B 2DRKA 1JRIA 4CC4B 5FRNA 3CC2A 1AWWA 2K6DA 1LCKA 2MIOA 4LD6A 2E3HA 2HL3A 5CR2A 3VYHB 4O5VA 1G2BA 2IG0A 2XU8A 1OYXA 3NTKA 4TVRA 3CCEQ 5GAN3 5LJ5g 3H0IA 3LW5E 2VV5A 1QKWA 2HBPA 3VS7A 2K3BA 1KD1R 1OZ2A 4BY6C 2EQKA 1TUDA 4HVWA 4ZN3A 1NG2A 3E9FA 4BY6B 2MK5A 3JB9H 1VQLA 4M7AF 5EC7A 2ED0A 3EG9A 1Q81R 5FWCA 2BE7D 2VWFA 3JCMQ 1M1KR 3SB2A 5IAYA 9ATCB 2KT1A 2GQVA 4M78D 2QQAA 2A0FB 1NEBA 2V26A 1TUCA 1BK2A 1SRLA 3KUFA 1VQOT 4PJOE 4DBQA 3I5RA 2CYZB 1O75A 3JB9J 2RF0A 2X35A 4C92A 4PJMA 2G3RA 1X2QA 1EZZB 3L2WA 3JCMe 2DL4A 2BZYA 2FZGB 3JCMb 1NYFA 4BE1A 1NM7A 3C94A 3INZA 1JXMA 1KG1A 2LTOA 1QKXA 2KYBA 2COYA 4X9DA 3TVTA 2ATCB 4D6WA 5LJ5j 1U8RA 2C0IA 2K2MA 2RK1A 2EVRA 2K3YA 2YUNA 4OMLA 1HSQA 1VQKQ 4C8QE 1YCSB 4M7DE 3SFMA 1YWPA 5GANg 4Z02A 5GAN7 2DL3A 1YIJT 2ECZA 2DTIA 3OYGA 1D3BB 2EGCA 4M78A 3V8KA 4GLMA 1M8VA 2QI2A 2PUOB 4NS5A 2KK4A 1X27A 2RI3A 4AG2C 1K8AU 3VV0A 3BDUA 4WF2A 2E64A 1B7TA 1QVPA 2JTMA 1WI7A 2JXBA 3J81E 2ZPFB 2PVGB 1OV3A 4LUDA 3A8OB 3KXTA 2H3JA 2JW4A 2E12A 2QTVA 5CO7A 5L8RE 4DQ2A 1IB8A 1ARKA 1YP5A 4XU2A 1OULA 1AD5A 4A53A 2CP2A 2CT3A 3M53A 4PFOA 2KBTA 3A8HB 2RM4A 4PJOF 2DJQA 1KJWA 2QXFA 3EGUA 3EG1A 2QASA 2COWA 3CCUQ 2KRNA 1VQOQ 3VS5A 1QVFA 2JM8A 3OW2S 5HK0A 2DXBA 1PWTA 1AWXA 1UGQB 1WHHA 1TSFA 3G7ZA 4ESRA 2EYZA 3MHXA 2RJEA 1MMGA 1GFCA 1U3OA 5GANj 1UTIA 1YNZA 4CC7A 1SEMA 1ZUUA 4KGZB 3CXCA 1G8XA 5ECAA 3JB9F 1MNDA 2RHXA 5GAMh 5GAMf 1TWBA 1ZHIA 2DL8A 4C8QF 5C0MA 5KH6A 1H8KA 2OAWA 2DAQA 2RQTA 2O9SA 3JCMW 2M9UA 4C5EA 1K9AA 4DBHA 5A2QE 4V2SA 2QEXT 1S72Q 1D09B 3LH5A 2L0AA 2I2LA 1Q82C 1M90C 4OB1B 3CCEA 3VJPA 1VQ5Q 2RMOA 1KC8R 3EG2A 1K73U 5I22A 2QDYB 3CCLT 2YLBA 3CC4Q 1K76A 2P4RA 2VASA 1BCOA 1GRIA 4BACA 3V7SA 2OTLT 3QDFA 1ZSGA 3L2UA 5LJ3h 5LJ3f 1XTDA 3VS2A 2DERA 2ZPBB 3CQTA 2LRQA 4MMKA 1NPRA 2WSCE 3CBOA 4N0AC 5GMKm 1I4K1 2LJ0A 3CCJQ 2L3QA 2MYSA 2X3WD 2QG9B 3OS2A 3NTIA 2HAXA 1FMKA 3EGDB 1KD1U 4C0FA 2BKDN 1B34B 4JJCA 2KEAA 2LQNA 4QVDA 2JTFA 2O2OA 1KHIA 3V7CA 4M7DD 2BIVA 2GTJA 3OMCA 2MAMA 4IUUA 3ER0A 5I11A 3PTAA 2ZGWA 3PNWC 4XTVA 3CC2T 1NJIC 2DETA 1T0JA 2DK3A 2HL5C 1KQ1A 1IHVA 3I56Q 2EQJA 1IO6A 2K57A 1HK9A 3JRZA 1KHCA 1RAAB 2E6NA 3S3MA 1RAGB 2F1LA 3RMQA 3OW2P 1B07A 2LX7A 3H9NA 3X25B 4IKFA 4PJLA 1X43A 2EJFA 2LMJA 2F2XA 5AYFA 1VQLT 2AK5A 1FYNA 1RI0A 5GMKh 2AZVA 2L8DA 2QEXQ 1G5VA 1TH7A 1PKTA 3HKSA 2YDLA 4J9IA 1P92A 1GCQA 1K4US 5I2MA 1M27C 4X34A 3JCMg 1I1JA 2M02A 4N0AA 4KH0B 4J9CA 2LQ8A 5J26A 2CP5A 3CPWP 3M57A 1I8FA 3G4SQ 2X3XD 3HFOA 2OTJQ 1KQSA 2L3PA 1JJ2A 1AHJB 2RQUA 1UFFA 3REAB 4HCKA 3EFOB 2ZAEA 1XNIA 2QTXA 1WDXA 2DTOA 3IQLA 4ELYC 3CCUA 4JUVA 4BE0A 3OYCA 1BYMA 1M9SA 2ABLA 4JS5A 4BDYA 3UT1A 3PFSA 2RNAA 2CSIA 5D6WA 4A63B 1LJOA 1EX4A 2XKOC 2V1QA 1MV0B 5KE3A 3OB9A 1RADB 3BW1A 3RBBB 2J05A 2CP3A 3CC2Q 4JJNK 3HRUA 1ZSZC 2KNBB 2LDMA 4J9BA 1Q7YC 4OB3B 1TXQA 3EH1A 4QQ6A 3FEOA 4B9WA 4L6V5 1RABB 1BCMA 2EQUA 3E19A 1CKBA 3OQ5A 3QHSA 3QO3A 2HSPA 4FIBA 3FIFA 3CCST 1K9MR 1VQLQ 2KSSA 4QVZA 4C92E 2KDSA 1VQ5A 1KQSS 4BB7A 1JJ2S 2DZCA 3HRTA 4J7FA 3OYMA 3PIOA 4DBFA 4JS4A 2EJ9A 1N5ZA 4XU3A 1ZUKA 3VS4A 2RI5A 3CC4A 2F2VA 4F7UF 4JLGA 3ULRB 2DYIA 4XTXA 2KI7A 5GANe 1K8AC 1VYUA 4XQ3A 5CCAA 2JOYA 2K2VA 3J7AF 4M75C 2JN0A 3VRZA 5CKBA 1N6AA 3OSSC 4J7IA 4JRPA 4AFZC 2J6KA 1WZOA 2RHYA 4M75B 5FLXE 1IZ6A 3JCMP 3CCJA 2HDAA 1OZ3A 3H8ZA 4M78E 4FM4B 3D7SB 3NTHA 2K79A 4DBRA 4PLLA 3TREA 2EYXA 5I21A 5GAN4 4O6JA 4E7IA 2SRCA 4FYXB 2JT4A 2RI2A 3L2RA 5GJVB 1MMNA 3SEMA 2B86A 2YSQA 3CCET 2FPDA 1A0NB 3M56A 3OYBA 4LN2A 3M55A 3BE3A 2KT8A 4OGEA 3R6NA 3CCRA 1QP3A 1FWZA 1ZBJA 1F1BB 2HSEB 3NPFA 3BDLA 1NYGA 2XDBA 1GXIE 1TTHB 4PL6A 2BE9B 2DIGA 2CZ6B 3GNGA 2P0KA 2CZ1B 2CP0A 3DLMA 2HKNA 2R57A 1M3AA 4M75A 5KYWA 4ANJA 3MP1A 1WX6A 1ZBXA 1SPKA 1YITA 2NWMA 1HJDA 3E1SA 2LT4A 4L5GA 3NFCA 3G6EQ 1WJRA 2OTJA 1VQMA 3L42A 1UJYA 4FW1A 3G71Q 7AT1B 4FYYB 3DB3A 3GNFB 5J39A 2KQWA 1D0YA 5C6SA 1ZA1B 3OS1A 2P0PA 4D8KA 3GPLA 1KQSP 4RKUE 1JJ2P 1G83A 2GFUA 4RCCA 2DIQA 1WHMA 4MZMA 2RD1A 2A7YA 3JCMJ 1PSEA 1VYVA 5FW9A 1M30A 4M78F 2E6ZA 1E6HA 2XIDA 4ORZA 4P5NA 4XU0A 2CS7A 2D8HA 2YT6A 2C06A 1MUZA 3CCMA 4BE2A 1RLPC 1OOTA 4HT8A 1ABQA 3OYJA 2O4XA 1WXBA 3X24B 4C92D 1OX8A 1YBYA 4PFZA 2FZKB 4F04B 1KK7A 4Q5WA 2HQXA 1NLOC 3M5AA 4JZ4A 5CQYA 2OJ2A 1T3SA 3GIBA 4D8DA 1OPKA 4M75G 2HMAA 1ZX6A 1AVZC 3QPHA 4ZGJB 4ZTFA 4A4EA 5GAOm 3UPUA 4KH1B 2HQHA 3VS0A 2EJGA 2K5IA 2RJDA 1UG1A 3FB9A 3CMAQ 2DYBA 2CGHA 1V76A 1WJSA 1YHQA 4XU1A 1M1FA 4OB0B 4E2FB 1SSHA 3LWHA 4RUGA 4C0ZA 3CCUT 4A4GA 2CZ7B 3MPUB 1RACB 5CKHA 4JDSA 4M77C 4YTLA 4EIKA 1QVGP 4JRKA 2ZZDA 4KT0E 3UF4A 4M77B 4CC2A 4QVCA 1K9MU 4E7SA 1WGSA 1RL2A 1Y96A 1H3ZA 2J6FA 4ATOA 1IHWA 3HL8A 5LL6S 2V8IA 1W6XA 1HXDA 2V8KA 4RTYA 2D6FA 4FYVB 2Y90A 2PU9B 4PJNA 1Z9ZA 3MEAA 3M59A 5CVIA 4F17A 1BBZA 3HP9A 4ZTJA 4LDXA 5FRMA 5GAMd 1WJQA 2LX9A 3EAEA 2EAYA 2E41A 3S6WA 5GJWB 4N4GA 3EGXB 1VQPA 1S72T 3V8JA 3M0TA 4M7AC 4IURA 1VQ5T 4OF1A 4M7AB 3I55Q 5CQXA 4HA8A 2ROTA 3CC4T 2DO3A 2P4TA 3A8MB 1ACMB 3QWYA 3L2QA 1VA7A 5DLOA 2PZ1A 2VUBA 1M8MA 3QG1A 2MCNA 4C5HA 5DLQE 5LJ3d 3QYHB 1MHNA 2P84A 2D0QB 2GTOA 3CCJT 3X20B 1NPPA 1I0CA 1WA7A 4J6XA 4A4KA 4HVVA 3ZBDA 1MV3A 3MJXA 2EYWA 3G6EA 2ESWA 5A0GA 2L3SA 2YWWA 4PLIA 1YN8A 2RB6A 3G71A 3VU3C 2MPXC 1R8OB 2YUOA 4GLKA 2DPPB 1BB9A 4RMOA 4X9CA 2R58A 3EGXA 2EW3A 2ZCFB 4DEXA 2QQSA 1UUEA 3FDRA 1QP2A 3I56T 3JCMV 1D3BA 4JJDA 4LUEA 2RN8A 3X26B 1WHKA 1VYTA 2X51A 1KIKA 2EYQA 3MP8A 4L59A 1W70A 3RNJA 1IRXA 4PKCC 1TOVA 2RO0A 1PG5B 2R5MA 4EMKC 2DD5A 3MO8A 2QQRA 4M7DF 4EMKB 1D1CA 2FVUA 4J9EA 1RAFB 1SSFA 4M77G 2X4YA 5KYUB 4HT9A 1X6GA 3THKA 1D1BA 1WHJA 1YITT 1VQ6A 4MZTA 3CBMA 3OS5A 1VOMA 3QSUA 3TEEA 2C0TA 3CCVA 1H92A 2LQKA 4GY5A 3V7RA 1U06A 4PJOC 2RQRA 1OU8A 3G4ST 2JMCA 3META 2VXEA 2OTJT 1UJ0A 1VQMT 1SRMA 3GF5A 4PJOB 3CMAA 3CC7A 5D6YA 1QVFS 3HRSA 4XTYA 5LJ5d 4KRTA 1SG5A 1I5LA 5IN1A 2A3LA 2NUZA 1OPLA 1WNLA 3GBQA 2HNIA 1E6GA 2DVJA 4XAXB 1AWOA 2AZSA 4NL3A 4QT7A 3RESA 2FG0A 1Q86C 4M7AG 2WSFE 3CCMT 3CXCS 4FT4A 1GBQA 2KVQG 2LNHB 2FPEA 1Q81U 1I81A 4C8QC 1UHFA 1M1KU 4EMKA 4M7DC 1T0HA 4FCYA 3M0QA 4DEYA 2HCKA 4C8QB 3LGFA 2E5KA 2F5TX 4VUBA 5GAOp 4M7DB 1AOJA 2QA4A 2M1HA 1UEBA 5EG2A 4J9DA 3C12A 4M75E 1N8RC 2QAZA 2PNIA 1X2KA 3CCRQ 4J83A 2VC8A 3HFNA 3REBB 4KBMB 1RLQC 1FMVA 3CCQA 1QWEA 1BIAA 1QCNA 4LDVA 1ZQ1A 2E10A 1YHQT 1JU5C 3I55A 4C0DC 2SEMA 3OYIA 1AWJA 1MMDA 1SHFA 1LNXA 4C0DB 2DRMA 2NUTB 1W4SA 1DJ7B 3HTRA 3OYKA 2WSEE 4PNOA 4JJBA 2L89A 1PNJA 1YITQ 5GANd 4Z89A 3EGDA 1PD0A 1KQ2A 5CIUA 1B34A 2RQVA 2IPOB 3I5SA 2KY9A 5GMKe 2K3XA 1VQMQ 3OBWA 5LJ5h 5LJ5f 2GNCA 5KYYB 3OYDA 5GAOr 4IUPA 4AG1C 2VXFA 2ENMA 1RUWA 4JRIA 4C8QA 4EDUA 3RUXA 2KXCA 2MF2A 2L3RA 4OMNA 2EKHA 2LCCA 4C0GA 3QZ9B 4QW2A 2JM9A 2RK2A 4XK8E 3CCMQ 1PCXA 1W2BA 1UGRB 1G3TA 1QVFP 3OSVA 2FB7A 1GFDA 2DFUA 1Y07A 4BUGA 1I07A 3UATA 4F16A 4AT1B 1Y7XA 5L23A 4PJOG 4FW2A 1JQQA 2KRSA 5GAN8 3HPWA 2DXUA 1M1GA 1ZSZB 2NUTA 5HCKA 3CXCP 2K4YA 2MWPA 5IHKA 4FSSA 3S3OA 3KBGA 2DVEA 5FWBA 4E7ZA 4QKUA 2L5QA 4HCBA 4CRIA 2O88A 4MDXA 3OYYA 5D6XA 3GOXA 1RI9A 1YHQQ 3UWNA 1MMAA 3EFOA 2M0YA 4IUVA 3JB9G 3OYAA 3M58A 2NUPB 1LVKA 3N5BB 4ZNXA 3DLLA 4E7JA 2DX1A 1OX9A 4C8QG 5GANf 1JO8A 5GANh 3G6ET 2NLUA 3L2VA 5FU6C 1X69A 1I5OB 2DBMA 4HVUA 3G71T 4EPCA 5FU6B 2D9TA 4KULA 5AT1B 4C5IA 2FRYA 1NZ9A 1Q7YR 1IGUA 3VYGA 3CD6Q 4HCZA 3ZEHA 3MKDA 3OBYA 4IIOA 3M54A 3OMGA 3M9QA 2KMTA 4M75D 1KC8U 2DXCA 8AT1B 2DD4A 2VKNA 4C5GA 2DZ9A 3JB9I 1YJNA 2M51A 1ZSZA 3JCMX 4K11A 1YCYA 1QQJA 2WACA 2EPDA 1BI1A 2GQIA 4KGXB 5GAMg 1D1AA 1UB4A 2RPNA 2QQ9A 2QQBA 4HKEA 4X1VA 3SWNC 1VQPQ 3U23A 3RDVA 1C6VX 5GAN6 3SWNB 4XTZA 1AT1B 3ZFJA 2FL7A 3M0SA 3QKJA 3E2UA 1VQ6T 3CCVT 4IUTA 5FU7C 1CKAA 3CMEQ 2JTEA 3JV3A 1YJ9Q 4AFUC 4R55A 5FU7B 2DM1A 1RAHB 3LLRA 3EFSA 4F7UB 3CMAT 1BIBA 4RTTA 3CC7T 2JUFA 2KAFA 2XDPA 4C92F 1VQ7A 4MDWA 2EGAA 5LJ3g 2IVWA 4OMQA 3F70A 4OMMA 1HD3A 2L2PA 3I9QA 1K73C 2DEQA 3HSBA 5KYXB 4FL6A 1EFNA 1BI0A 2LT1A 1K0SA 4F14A 2ROLA 4B9XA 3O8VA 4Z8AA 2AKLA 1NBEB 1OU9A 5GAMj 2X9HA 1AZGB 1ABOA 3H41A 2EKOA 1UHCA 3WVEB 5KE2A 4PFPA 1WHLA 1VQ9A 3JCMd 2DJZA 3CCLA 4J6YA 1K0XA 4A4HA 2QA4T 1YWOA 4B6MA 3UA7A 4JRQA 2YXYA 4HXJA 4ZGDB 4JLIA 4J9FA 1KD1C 4OVAA 3EG9B 2X4XA 2BZ8A 2ZPGB 1K1ZA 2FZCB 1WXUA 3CCQT 3CBPA 1QWFA 2D0NA 3QYGB 1Q81C 4F7UA 1QMCA 2PTKA 3DB4A 2J6OA 1M1KC 2PUKB 3QBYA 3I55T 1SKUB 4C92C 1JXOA 1QW1A 1YI2A 3RIRA 2J06A 5LJ3j 3L1AA 1M4ZA 1WQWA 4BI4A 2XICA 4C92B 2V8JA 2KROA 2QDLA 1VQ6Q 2QGFB 5J3BA 5KYXA 3CCVQ 1PKSA 3TSWA 1J3TA 2ZPEB 1YJWA 2E5QA 3VS3A 3OYFA 1VQNQ 1W1FA 3CC7Q 1ZA2B 1QCOA 4LE9A 4N4IA 4ZN1A 4RG8A 3QIIA 2NYSA 5I2SA 3C4SA 2A08A 3NGPA 3VS6A 2MMPA 1LPLA 2CP6A 3QDRB 4M78C 1H3HA 2W10A 3T9NA 4ME7A 2YRDA 2LCLA 4PJJA 2H3EB 4M78B 5HK3A 2YLCA 1B3QA 1VQ8Q 4RTXA 4RTUA 3A5ZB 1VUBA 1VQ4A 3PE0A 1JB0E 3CD6A 3JCMh 3JCMf 3ZL7C 4M77D 1BU1A 3M4GA 1GL5A 5A0DA 4PK4A 5HKCA 2MI6A
chains in the Genus database with same CATH topology
2XDDA 2Y4YA 4F7UG 4OMFB 2DTOA 2VGMA 4HT9A 5KCOA 4ELYC 5GMKj 5GAOq 3CCUA 3JCMc 1YITT 1VQ6A 4MZTA 4JUVA 3CBMA 4BE0A 3OS5A 2O4XB 2JZ2A 3OYCA 3TEEA 4LD9K 2EFIA 3CCVA 1M9SA 3QSUA 2LQKA 3MCAB 1N9SA 1WQ7A 4GY5A 3V7RA 3L2ZA 2RH2A 2PQWA 3LWIA 3G4ST 1QVGS 2XHCA 2DKGA 3UT1A 3META 3PFSA 2VXEA 1H641 5D6WA 2OTJT 5GAN5 1LJOA 1VQMT 2XG8D 2E1HA 2XKOC 4EMGA 4M7AE 3GF5A 4PJOB 4R56A 5CKEA 3CMAA 1VQ8T 2QEXA 5KE3A 3CC7A 5D6YA 3OB9A 3MEUA 1QVFS 3HRSA 2YHTA 3BW1A 5GAOl 4XTYA 5LJ5d 1Q7YU 1WPYA 1I5LA 1XOVA 3CPFA 4CI0C 4JJNK 5IN1A 3HRUA 2YRVA 2A3LA 2LDMA 4N4HA 1OI1A 1X01A 3OW2A 1Q7YC 1WNLA 4FT2A 1UGPB 4OB3B 2HNIA 1UGSB 4QQ6A 4XAXB 1Q86U 3QXEB 4NL3A 3FEOA 4B9WA 5CAIA 4L6V5 3G4SA 2EQUA 3MP6A 3PGGA 3H6ZA 3SWNA 3E19A 3URGA 3RESA 4M7AD 4IUQA 1Q86C 4PJOC 3OQ5A 4M7AG 2WSFE 3QHSA 3CCMT 3CMEA 3CXCS 4FT4A 1YJ9A 2OTLA 3QO3A 5GAOn 2KVQG 4FIBA 1FX7A 3FIFA 3CCST 1NJIU 4E7KA 2PVDB 1EIFA 2KSSA 1Q81U 4QQGA 4QVZA 4C92E 1I81A 1G3YA 2KDSA 4BI3A 4C8QC 1M1KU 4EMKA 4M77A 4M7DC 1VQ5A 3QJ6A 4FU6A 1KQSS 4DOWA 2VGNA 4BB7A 1JJ2S 2DZCA 3HRTA 3LGLA 4J7FA 3PIOA 3OYMA 3WXMB 4C8QB 4JS4A 2EJ9A 3LGFA 3CPWA 4XU3A 2F5TX 3LYIA 4VUBA 5GAOp 1N8RU 4M7DB 2QA4A 4M77F 2M1HA 1UEBA 3JAME 1U1TA 2RI5A 5EG2A 3CC4A 4KUDK 5GMKi 4XTUA 4F7UF 4M75E 3C12A 1N8RC 4JLGA 3CEYA 2RJCA 4XTXA 1YJNT 1K8AC 1XQHA 5GANe 1VQKT 4XQ3A 5CCAA 4J83A 3OYNA 3OYHA 2JOYA 2VC8A 4QQDA 3HFNA 2K2VA 4J8OA 1Y71A 3CCSA 2RJFA 4KBMB 2ZPIB 3J7AF 4Y91A 1Y96B 4M75C 2JN0A 4C92G 5CKBA 1JRIA 1N6AA 3CCQA 3M4YA 3OSSC 5FRNA 4J7IA 1M5Q1 4JRPA 1BIAA 3CC2A 1N9RA 4LDVA 1ZQ1A 4M75B 2RHYA 5FLXE 2E10A 1IZ6A 4LD6A 3VKIA 2LNVA 3JCMP 1YHQT 5CR2A 3CCJA 1G3SA 2F69A 3VYHB 4O5VA 3I55A 2IG0A 4C0DC 2XU8A 1OYXA 3NTKA 4TVRA 3OYIA 5GAN3 5LJ5g 3OS0A 1LOJA 1OZ3A 3LW5E 3H8ZA 1LNXA 4M78E 2VV5A 4FM4B 3RKWA 4C0DB 1W4SA 1DJ7B 2HBPA 2O01E 3VUBA 2WSEE 4PNOA 5GMKl 3OYKA 1KC8C 2HD0A 1OZ2A 4M7AA 4BY6C 2L89A 2EQKA 4A54A 3NTHA 4ZN3A 3CCRT 1VIEA 3E9FA 5GANd 1KQ2A 4PLLA 3PIPA 3TREA 4BE2A 4BY6B 5I21A 3JB9H 5CIUA 1VQLA 4M7AF 5GAN4 1B34A 3LX7A 2KY9A 3E9GA 4O6JA 2EWNA 2K3XA 3DKMA 5GMKe 4E7IA 2E70A 3JCMQ 2RI2A 3OBWA 3L2RA 4MZPA 4Y28E 5LJ5f 5LJ5h 3SB2A 2Y4XA 5IAYA 3RKXA 4BI8B 3OYDA 5GAOr 2GQVA 1FXXA 3S3NA 4M78D 1VQ7T 4IUPA 2JVVA 2VXFA 3CCET 1PSFA 4M78G 2QQAA 3M56A 3OYBA 4JRIA 3M55A 4C8QA 3KUFA 1VQOT 4PJOE 4EDUA 1BKBA 4OGEA 3CCRA 3OYLA 1QP3A 4OGCA 4UC4A 3RUXA 3X28B 5GAMe 3CPWS 1FWZA 3V8LA 2CYZB 1O75A 2MF2A 3JB9J 2L3RA 2K5LA 2LCCA 4C0GA 2X35A 3QZ9B 3SD4A 4QW2A 4C92A 4E47A 2RK2A 2OAUA 3BDLA 4XK8E 2G3RA 4HCCA 4LDUA 1W2BA 1UGRB 1G3TA 2XDBA 1GXIE 4PL6A 3FC3A 3OSVA 1O9SA 2DIGA 2CZ6B 2FB7A 3JCMe 3L2WA 1VQNA 3GNGA 2P0KA 2CZ1B 5HY6A 1Y07A 3DLMA 4BUGA 4NOYA 3JCMb 2R57A 4M75A 4BE1A 1VQ9T 4PJOD 2CZ0B 3OYEA 3C94A 3INZA 1Y7XA 4PJOG 1KG1A 2LTOA 3MP1A 1ZBXA 4EMHA 5GAN8 4X9DA 1YITA 3HPWA 4D6WA 3VUZA 5LJ5j 1U8RA 2DXUA 1M1GA 3R6OA 4FSXA 2RK1A 3E1SA 2LT4A 2K3YA 4L5GA 3NFCA 1WJRA 3PT9A 2K4YA 2OTJA 2MWPA 1VQMA 3L42A 4C8QE 3S3OA 3KBGA 2DVEA 4M7DE 1VQ8A 2FYKA 5LJ3e 3SFMA 4KUIA 2GF7A 3DB3A 2L5QA 3GNFB 3SDZA 4Z02A 4CRIA 5J39A 5GANg 5GAN7 2KQWA 1YIJT 5C6SA 4HCBA 3OS1A 2P0PA 2DTIA 3OYGA 1D3BB 3GPLA 4RKUE 2GFUA 4M78A 4RCCA 4MDXA 2DIQA 3V8KA 3OYYA 5D6XA 3GOXA 2E65A 1M8VA 2QI2A 4MZMA 2RD1A 2PUOB 5CK9A 2A7YA 4NS5A 3JCMJ 3UWNA 3JB9D 1PSEA 2RHZA 1BI3A 5A0LA 2KK4A 4IUVA 4M78F 2E6ZA 3JB9G 3OYAA 1YI2T 2RI3A 2XIDA 3M58A 3N5BB 4P5NA 3DLLA 4E7JA 2EIFA 4XU0A 2CS7A 1K8AU 3VV0A 1VIFA 4C8QD 2C06A 2RHIA 3BDUA 2X4WA 4C8QG 5GANf 4WF2A 2XK0A 2E64A 5GANh 1QVPA 3G6ET 2NLUA 3L2VA 5FU6C 3CCMA 2FHDA 2JTMA 4HT8A 3J81E 3G71T 2ZPFB 2PVGB 2O4XA 3HHTB 3OYJA 4EPCA 3A8OB 5FU6B 3BFMA 3X24B 4LDYA 3KXTA 2H3JA 3GLXA 4C92D 3WVDB 2E12A 5CO7A 5L8RE 1YBYA 2D9TA 4KULA 4DQ2A 1YJWT 3TCJA 4C5IA 4XU2A 2PVOB 4PJOA 1NZ9A 4Q5WA 2HQXA 4A53A 3VYGA 4HCZA 3M5AA 5CQYA 3M53A 3OBYA 3ZEHA 3GP8A 1IREB 3GIBA 2M16A 3A8HB 3M54A 3OMGA 3M9QA 2KMTA 2RM4A 4M75D 2DXCA 4PJOF 3TU4K 1KC8U 2QXFA 4M75G 2DD4A 4C5GA 2DZ9A 3JB9I 1YJNA 1VQKA 1QVFA 1BYMA 4J6WA 2R5AA 3QPHA 4ZGJB 5HK0A 3JCMX 3OW2S 4ZTFA 1YCYA 4A4EA 2DXBA 4OB2B 5GAOm 2WACA 3UPUA 2MWOA 1UGQB 1BI1A 2EJGA 2K5IA 2RJDA 3G7ZA 5GAMg 2EQMA 4RCBA 1UB4A 3FB9A 3QZ5B 2CGHA 2QQ9A 3MHXA 2RJEA 1WJSA 1YHQA 5GANj 2QQBA 1VQ4T 2CKKA 4HKEA 3SWNC 4II1A 3P8DA 4XU1A 4OP0A 1M1FA 3CD6T 3JSCA 4OB0B 4E7HA 5GAN6 3SWNB 3LWHA 4XTZA 3CXCA 4F7UE 3ZFJA 2FL7A 4C0ZA 3JB9F 3QKJA 3CCUT 2X4JA 4A4GA 2CZ7B 2RHXA 3MEWA 1VQ6T 5GAMh 5GAMf 4M7DA 2B8AA 5CKHA 4JDSA 4BD3A 1ZHIA 3ASKA 4M77C 4YTLA 3CCVT 4IUTA 5FU7C 4C8QF 5C0MA 5KH6A 4JRKA 2ZZDA 2HQEA 2DAQA 4KT0E 2BUDA 4M77B 3FLGA 5LJ5e 2M9UA 5FROA 4QVCA 4R55A 3JCMW 1K9MU 4XTWA 4C5EA 2GCXA 5FU7B 5A2QE 3LLRA 4F7UB 3EFSA 3CMAT 4V2SA 1WGSA 2QEXT 1BIBA 3CC7T 2JUFA 2KAFA 1RL2A 2XDPA 2I2LA 1Y96A 4MMLA 1K9MC 4C92F 1Q82C 1H3ZA 1VQPT 4ATOA 1BI2A 1M90C 4OB1B 1VQ7A 4MDWA 3RKYA 3UDCA 3VJPA 3CCEA 5LJ3g 2IVWA 3Q1JA 3OY9A 3P8HA 3HL8A 5LL6S 2V8IA 1HXDA 3OA6A 1VQOA 2V8KA 1K73U 2QDYB 3F70A 3CCLT 2YLBA 2D6FA 5DY9A 2Y90A 5IT9E 2PU9B 5CVIA 2ZPHB 3M59A 3MEAA 3RERA 4M75F 1K73C 2DEQA 2F5KA 3HSBA 3HP9A 4NL2A 4ZTJA 4LDXA 4FL6A 4DA4A 5FRMA 2JNGA 1BI0A 2LT1A 5GAMd 1WJQA 3A8GB 2LX9A 2VYTA 3CMET 4BACA 3V7SA 3EAEA 2EAYA 1YJ9T 2E41A 3S6WA 4B9XA 2OTLT 3O8VA 4N4GA 3L2UA 5LJ3h 5LJ3f 1XTDA 4ELZC 1VQPA 1S72T 2ZPBB 2DXTA 2LRQA 3V8JA 3EFRA 5DM7R 5GAMj 4MMKA 2EKOA 1NPRA 4M7AC 3WVEB 5KE2A 2WSCE 4IURA 3CBOA 4N0AC 1VQ9A 5GMKm 3JCMd 1VQ5T 1I4K1 5CKFA 1V29B 2DJZA 4OF1A 4M7AB 3CCLA 5CQXA 4HA8A 4J6YA 4A4HA 3OS2A 3NTIA 2QA4T 2HAXA 1MGQA 1KD1U 3CC4T 4JRQA 3LH0A 2DO3A 4C0FA 2BKDN 1B34B 4ZGDB 1X6OA 2P4TA 3A8MB 4JLIA 4QVDA 1KD1C 2JTFA 4OVAA 5KCHA 1KHIA 3V7CA 4M7DD 2BIVA 3L2QA 1S72A 4M7DG 2X4XA 3OMCA 5DLOA 2MAMA 2VUBA 4IUUA 3ER0A 3PTAA 2ZPGB 3QG1A 4C5HA 4JS5A 1YIJA 2ZGWA 3CBPA 3PNWC 4XTVA 3CCQT 4BDYA 1X75C 2XD0A 3CC2T 5DLQE 1NJIC 2K5FA 3QYGB 1Q81C 3AHUA 5LJ3d 3FRNA 4F7UA 3QYHB 3DB4A 4J5YA 2M0OA 1MHNA 2PUKB 1M1KC 2D0QB 2DK3A 3QBYA 3CCJT 3X20B 1NPPA 1KQ1A 3I55T 1W2BS 4C92C 2EQJA 1QW1A 1YI2A 3JRZA 2K57A 1HK9A 4J6XA 3L1AA 1N27A 3RIRA 5LJ3j 1M4ZA 1WQWA 1KHCA 3A8LB 4BI4A 4A4KA 1QVGA 2XICA 2E6NA 1G3WA 3S3MA 4C92B 3FJPA 3ZBDA 2V8JA 3RMQA 3G6EA 5A0GA 5J3BA 4PLIA 3X25B 4IKFA 2RB6A 3G71A 4ZGEB 2EJFA 3VU3C 5AYFA 1VQLT 1R8OB 4GLKA 2DPPB 1RI0A 2ZPEB 5M9OA 4RMOA 1YJWA 3PMTA 2AHJB 5GMKh 4X9CA 2E5QA 2R58A 4RG2A 1JBMA 3OYFA 2L8DA 2DTHA 2XI9A 4E7LA 2LVMA 2ZCFB 1G5VA 2QQSA 1TH7A 3BY7A 4N4IA 3HKSA 2GFAA 3FDRA 1QP2A 1P92A 4ZN1A 3I56T 3RMSA 3JCMV 4RG8A 1D3BA 2P0QA 3C95A 3QIIA 5I2MA 3MEVA 5I2SA 3C4SA 3P8BB 3ME9A 4M77E 3X26B 4X34A 3JCMg 4N0AA 2EYQA 3MP8A 4L59A 4DOVA 5CKDA 3QJYA 2LC4A 2MMPA 2LQ8A 5J26A 4PKCC 3M57A 2RO0A 3QDRB 4M78C 3T9NA 4ME7A 1I8FA 2R5MA 4EMKC 2LCLA 3HFOA 1KQSA 2DD5A 4M78B 5HK3A 1JJ2A 1AHJB 1NE8A 2RA2A 3MO8A 2QQRA 2YLCA 4M7DF 4EMKB 3J80E 2RHUA 4BDZA 3A5ZB 1VUBA 1VQ4A 1Q82U 1VQNT 3QUIA 3PMIA 5GAN2 1JB0E 1M90U 3I56A 4LDWA 2FVUA 3CD6A 3JCMh 3JCMf 4M77D 3M4GA 1SSFA 1U1SA 1XNIA 2X4YA 4M77G 5A0DA 5HKCA 4A4FA 2MI6A 2QTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KCO A;  3CCU A;  1YIT T;  1VQ6 A;  4BE0 A;  2O4X B;  2JZ2 A;  3OYC A;  2EFI A;  3CCV A;  4GY5 A;  4BDY A;  3G4S T;  1QVG S;  2PQW A;  2XHC A;  3UT1 A;  3MET A;  3PFS A;  2OTJ T;  5D6W A;  1VQM T;  3CMA A;  1VQ8 T;  2QEX A;  5KE3 A;  3CC7 A;  5D6Y A;  3OB9 A;  3MEU A;  1QVF S;  1Q7Y U;  3CPF A;  5IN1 A;  2YRV A;  4N4H A;  2LDM A;  1Q7Y C;  3OW2 A;  1OI1 A;  4QQ6 A;  1Q86 U;  3FEO A;  4B9W A;  3G4S A;  2EQU A;  3MP6 A;  3H6Z A;  1Q86 C;  4IUQ A;  3OQ5 A;  3CCM T;  3CME A;  3CXC S;  1YJ9 A;  2OTL A;  2KVQ G;  3CCS T;  1NJI U;  4E7K A;  1EIF A;  1Q81 U;  4QQG A;  4QVZ A;  2KDS A;  1M1K U;  1VQ5 A;  3QJ6 A;  4FU6 A;  1KQS S;  1JJ2 S;  3OYM A;  3LGL A;  3PIO A;  3LGF A;  3CPW A;  1N8R U;  3LYI A;  2QA4 A;  2M1H A;  1UEB A;  3JAM E;  2RI5 A;  3CC4 A;  1N8R C;  3CEY A;  2RJC A;  1YJN T;  1K8A C;  1VQK T;  3OYH A;  3OYN A;  2JOY A;  4QQD A;  3CCS A;  2RJF A;  3J7A F;  3CCQ A;  5FRN A;  3CC2 A;  2RHY A;  5FLX E;  1IZ6 A;  4LD6 A;  1YHQ T;  3CCJ A;  3I55 A;  2IG0 A;  3NTK A;  1OYX A;  4TVR A;  3OYI A;  3OS0 A;  1OZ3 A;  3H8Z A;  1KC8 C;  3OYK A;  1OZ2 A;  2L89 A;  2EQK A;  3NTH A;  4ZN3 A;  3CCR T;  3E9F A;  3PIP A;  4PLL A;  3TRE A;  5CIU A;  1VQL A;  3LX7 A;  3E9G A;  4E7I A;  2K3X A;  2E70 A;  2RI2 A;  3L2R A;  5IAY A;  3OYD A;  3S3N A;  1VQ7 T;  4IUP A;  2JVV A;  3CCE T;  3OYB A;  3KUF A;  1VQO T;  4EDU A;  1BKB A;  3CCR A;  3OYL A;  4UC4 A;  3CPW S;  2L3R A;  2LCC A;  2X35 A;  3SD4 A;  4QW2 A;  3BDL A;  2G3R A;  1W2B A;  4PL6 A;  3FC3 A;  2DIG A;  3L2W A;  1VQN A;  2P0K A;  5HY6 A;  3DLM A;  1VQ9 T;  2R57 A;  4BE1 A;  3OYE A;  2LTO A;  3MP1 A;  1YIT A;  1M1G A;  2K3Y A;  1WJR A;  2OTJ A;  2MWP A;  1VQM A;  3L42 A;  3S3O A;  3KBG A;  1VQ8 A;  2GF7 A;  3DB3 A;  5J39 A;  4Z02 A;  4CRI A;  1YIJ T;  5C6S A;  3OS1 A;  3OYG A;  2GFU A;  2DIQ A;  3OYY A;  5D6X A;  3GOX A;  4NS5 A;  3UWN A;  2RHZ A;  4IUV A;  2E6Z A;  1YI2 T;  3OYA A;  2RI3 A;  3DLL A;  4E7J A;  2EIF A;  1K8A U;  2RHI A;  2X4W A;  3CCM A;  3G6E T;  2XK0 A;  4BE2 A;  2NLU A;  3L2V A;  2FHD A;  3J81 E;  3G71 T;  3OYJ A;  2O4X A;  1YBY A;  2D9T A;  1YJW T;  4C5I A;  1NZ9 A;  4Q5W A;  2HQX A;  4HCZ A;  3ZEH A;  2M16 A;  3OMG A;  3M9Q A;  1KC8 U;  4C5G A;  1YJN A;  1VQK A;  1QVF A;  2R5A A;  3OW2 S;  4ZTF A;  4A4E A;  2WAC A;  2MWO A;  2RJD A;  2EQM A;  2RJE A;  1WJS A;  1YHQ A;  1VQ4 T;  2CKK A;  4II1 A;  3P8D A;  3CD6 T;  4E7H A;  3CXC A;  3CCU T;  3QKJ A;  4A4G A;  1VQ6 T;  2RHX A;  3MEW A;  2B8A A;  4BD3 A;  3ASK A;  4YTL A;  3CCV T;  4IUT A;  5C0M A;  5KH6 A;  2HQE A;  2DAQ A;  2BUD A;  3FLG A;  5FRO A;  1K9M U;  4C5E A;  5A2Q E;  3LLR A;  3CMA T;  2QEX T;  1WGS A;  3CC7 T;  2JUF A;  1RL2 A;  2XDP A;  1K9M C;  1H3Z A;  1Q82 C;  1VQP T;  1M90 C;  1VQ7 A;  3CCE A;  3OY9 A;  3Q1J A;  3P8H A;  5LL6 S;  1VQO A;  3OA6 A;  1K73 U;  3CCL T;  3F70 A;  5IT9 E;  3MEA A;  1K73 C;  2F5K A;  4ZTJ A;  4FL6 A;  5FRM A;  2JNG A;  1WJQ A;  2VYT A;  3CME T;  4BAC A;  3EAE A;  1YJ9 T;  3S6W A;  2OTL T;  4B9X A;  3O8V A;  4N4G A;  3L2U A;  1XTD A;  1VQP A;  1S72 T;  5DM7 R;  2LRQ A;  2EKO A;  1NPR A;  5KE2 A;  1VQ9 A;  4IUR A;  1VQ5 T;  3CCL A;  4A4H A;  3OS2 A;  3NTI A;  2QA4 T;  1KD1 U;  3CC4 T;  3LH0 A;  2DO3 A;  2BKD N;  1X6O A;  1KD1 C;  2JTF A;  4OVA A;  5KCH A;  1KHI A;  2BIV A;  3L2Q A;  1S72 A;  2X4X A;  3OMC A;  4IUU A;  3ER0 A;  4C5H A;  1YIJ A;  3CCQ T;  3PNW C;  3CC2 T;  5DLQ E;  1NJI C;  1Q81 C;  3DB4 A;  1M1K C;  1MHN A;  2M0O A;  3QBY A;  3CCJ T;  1NPP A;  3I55 T;  1W2B S;  2EQJ A;  1YI2 A;  1N27 A;  1KHC A;  1QVG A;  2E6N A;  3S3M A;  3G6E A;  5J3B A;  4PLI A;  4IKF A;  3G71 A;  1VQL T;  1RI0 A;  5M9O A;  1YJW A;  3PMT A;  2E5Q A;  2R58 A;  4RG2 A;  3OYF A;  2L8D A;  4E7L A;  2LVM A;  1G5V A;  2QQS A;  4N4I A;  3HKS A;  2GFA A;  3FDR A;  3I56 T;  4ZN1 A;  3QII A;  3MEV A;  3C4S A;  3P8B B;  3ME9 A;  4X34 A;  3MP8 A;  4L59 A;  2LQ8 A;  5J26 A;  2RO0 A;  2R5M A;  2LCL A;  1KQS A;  1JJ2 A;  3MO8 A;  2QQR A;  3J80 E;  2RHU A;  4BDZ A;  3A5Z B;  1VQ4 A;  1Q82 U;  1VQN T;  1M90 U;  3PMI A;  3I56 A;  3CD6 A;  1SSF A;  1XNI A;  2X4Y A;  4A4F A;  2MI6 A; 
#chains in the Genus database with same CATH topology
 2XDD A;  2Y4Y A;  1M3B A;  4F7U G;  2LJ3 A;  2DIL A;  2DF6 A;  2VGM A;  5GMK j;  2QA4 Q;  1GCP A;  2EGE A;  2JZ2 A;  4LD9 K;  2O9V A;  1N9S A;  3LWI A;  2BZX A;  2EQI A;  2RH2 A;  3L2Z A;  2XHC A;  2DKG A;  3M0P A;  2ED1 A;  5GAN 5;  2XG8 D;  4EMG A;  5IH2 A;  4R56 A;  3M0U A;  2GGR A;  1D0Z A;  3MEU A;  1M2V B;  2YHT A;  1Q7Y U;  3CCQ Q;  1WPY A;  1AZE A;  4CI0 C;  2YRV A;  4N4H A;  1OI1 A;  1X01 A;  3OW2 A;  2QGG A;  4FT2 A;  1UGP B;  2MOX A;  2KGT A;  4WCI A;  3PGG A;  3H6Z A;  4M7A D;  2FPF A;  3CME A;  1YJ9 A;  1HYO A;  2QK0 A;  1TUG B;  5GAO n;  1FX7 A;  1EIF A;  4QQG A;  3H0H A;  2DBK A;  2GBQ A;  4M77 A;  3NMZ C;  4DOW A;  2VGN A;  2LJ1 A;  2EBP A;  1IGQ A;  2CT4 A;  2D8J A;  3LGL A;  3CPW A;  3LYI A;  3JAM E;  2OX7 A;  1U1T A;  1UGV A;  1WHG A;  4XTU A;  5GMK i;  1YJN T;  3OYN A;  2K9G A;  1Y71 A;  3CCS A;  2ZPI B;  3VS1 A;  5IHI A;  4C92 G;  4WTO B;  1X6B A;  2XMF A;  3M4Y A;  1M5Q 1;  1N9R A;  3VKI A;  2LNV A;  1M2V A;  1G3S A;  2F69 A;  2CDT A;  1TU0 B;  2CUB A;  2AKK A;  3OS0 A;  1LOJ A;  3RKW A;  2O01 E;  3VUB A;  5GMK l;  1KC8 C;  2HD0 A;  4M7A A;  2AIR B;  2FRW A;  4A54 A;  3CCR T;  1VIE A;  3PIP A;  4IIM A;  4LXC A;  3KFV A;  2JS2 A;  3LX7 A;  3E9G A;  2EWN A;  3DKM A;  2E70 A;  4RTV A;  4MZP A;  4Y28 E;  8ATC B;  4LNP A;  2Y4X A;  2DMO A;  3RKX A;  4BI8 B;  3PVQ A;  1FXX A;  3S3N A;  1VQ7 T;  2JVV A;  1PSF A;  1WLP B;  4M78 G;  1BKB A;  2C0O A;  2CUD A;  3OYL A;  4OGC A;  1KSW A;  4UC4 A;  3X28 B;  5GAM e;  3CPW S;  3V8L A;  1D0X A;  1AEY A;  2K5L A;  3SD4 A;  4E47 A;  2OAU A;  2KXD A;  4HCC A;  5KYN A;  4LDU A;  1CSK A;  3FC3 A;  1O9S A;  1VQN A;  1YIJ Q;  1R0C B;  5HY6 A;  1OQK A;  2KYM A;  4NOY A;  1VQ9 T;  4PJO D;  2CZ0 B;  3OYE A;  1WFW A;  3AT1 B;  3M0R A;  4EMH A;  4FYW B;  3VUZ A;  3R6O A;  4FSX A;  4R0K A;  4AMC A;  1S1N A;  3PT9 A;  1YJN Q;  3H0F A;  1RAE B;  3VRY A;  1GCQ C;  1VQ8 A;  2COZ A;  2FYK A;  5LJ3 e;  2E3I A;  1RAI B;  4KUI A;  2GF7 A;  3SDZ A;  1M3C A;  1IXD A;  1Q82 R;  1M90 R;  2F2W A;  2E65 A;  3SHW A;  1QCF A;  5CK9 A;  2FEI A;  3JB9 D;  2RHZ A;  1BI3 A;  5A0L A;  2I0N A;  1YI2 T;  2EIF A;  1VIF A;  2KRM A;  4C8Q D;  1KFZ A;  2J7I A;  2RHI A;  2X4W A;  5KYU A;  2XK0 A;  4OMP A;  2FHD A;  3HHT B;  3BFM A;  4LDY A;  3GLX A;  3WVD B;  1YJW T;  2Z0W A;  3TCJ A;  2DL7 A;  2D1X A;  2PVO B;  4PJO A;  2YUQ A;  3GP8 A;  1TG0 A;  1IRE B;  2M16 A;  1VQ7 Q;  2JS0 A;  1Y57 A;  3TU4 K;  1Q86 R;  1TS9 A;  1VQK A;  2RQW A;  4J6W A;  2R5A A;  1YFN A;  5IXF A;  4OB2 B;  2MWO A;  1QLY A;  1PHT A;  1ZUY A;  2EQM A;  5IHN A;  4RCB A;  1NJI R;  3QZ5 B;  3NHN A;  1VQ4 T;  2CKK A;  4II1 A;  3P8D A;  4Z88 A;  4OP0 A;  3CD6 T;  3JSC A;  2A36 A;  4E7H A;  1VQ9 Q;  1N8R R;  4F7U E;  1FMW A;  3CCL Q;  2X4J A;  4J9G A;  1PC0 A;  3MEW A;  4M7D A;  2CH4 W;  3I35 A;  2B8A A;  4BD3 A;  3ASK A;  3EHR A;  3TSZ A;  1C1A A;  2HQE A;  2W0Z A;  2BUD A;  3FLG A;  5LJ5 e;  3FJ5 A;  5FRO A;  2OTL Q;  4XTW A;  2GCX A;  2JJ9 A;  2AT1 B;  4MML A;  1K9M C;  1VQP T;  1BI2 A;  3RKY A;  3UDC A;  2A28 A;  3OY9 A;  3Q1J A;  3P8H A;  2V1R A;  3OA6 A;  2DE0 X;  1VQO A;  3A98 A;  5DY9 A;  5IT9 E;  2ZPH B;  1YI2 Q;  1V1C A;  3RER A;  4M75 F;  1T3L A;  2CH4 A;  2F5K A;  4NL2 A;  4RTW A;  3QWX X;  1SF9 A;  4DA4 A;  2JNG A;  3A8G B;  2VYT A;  3CME T;  1YJ9 T;  2OI3 A;  3EG0 A;  2LQW A;  3UA6 A;  4ELZ C;  2VB6 A;  4J9H A;  5DM7 R;  2DXT A;  3EFR A;  2H8H A;  2KE9 A;  1YJW Q;  5CKF A;  1V29 B;  1GBR A;  5KYY A;  3G1J A;  1MGQ A;  3LH0 A;  3O5Z A;  1X6O A;  2CRE A;  5KCH A;  1JEG A;  1S72 A;  4M7D G;  4AFS C;  2CSQ A;  1YIJ A;  2XD0 A;  1X75 C;  2K5F A;  3AHU A;  4JZ3 A;  3FRN A;  4J5Y A;  2M0O A;  1VQ4 Q;  2YRC A;  2QYZ A;  2VVK A;  1W2B S;  1PRL C;  1SHG A;  2O31 A;  1N27 A;  3A8L B;  1QVG A;  3C0C A;  1G3W A;  3FJP A;  1PRM C;  1R0B G;  2CP7 A;  2LZ6 B;  5D7U A;  1OEB A;  2HKQ B;  3EHQ A;  4ZGE B;  2DL5 A;  1U5S A;  1UE9 A;  2K7A A;  5M9O A;  2HEQ A;  2DLP A;  2AHJ B;  3EG3 A;  3PMT A;  5KYW B;  4RG2 A;  1JBM A;  1WXT A;  2DTH A;  2XI9 A;  4E7L A;  2LVM A;  3TQ7 P;  3BY7 A;  2GFA A;  4GBQ A;  2E4H A;  3RMS A;  2P0Q A;  3C95 A;  4AFQ C;  3MEV A;  3P8B B;  3ME9 A;  4M77 E;  2JMA A;  4RTZ A;  1C0M A;  4DOV A;  5CKD A;  3QJY A;  2LC4 A;  1K8A R;  1Y0M A;  2NUP A;  2DA9 A;  1PD1 A;  2LP5 A;  4Y92 A;  1Q95 G;  1NE8 A;  2RA2 A;  3J80 E;  2RHU A;  1PM3 A;  3PVL A;  4BDZ A;  2BTT A;  1Q82 U;  1VQN T;  3QUI A;  3PMI A;  5GAN 2;  1UDL A;  1M90 U;  3I56 A;  4LDW A;  2LCS A;  3A1P A;  1U1S A;  4A4F A;  1XJW B;  4OMF B;  2A37 A;  5KCO A;  5GAO q;  3JCM c;  2O4X B;  1WIE A;  2EFI A;  2EYY A;  3MCA B;  4OMO A;  1WQ7 A;  1M2O A;  2PQW A;  1QVG S;  4JPB W;  2G6F X;  1H64 1;  4M7A E;  2E1H A;  4CC3 A;  1VQ8 T;  5CKE A;  2QEX A;  3CCS Q;  2YUP A;  5GAO l;  2DEU A;  2IIM A;  1XOV A;  3CPF A;  3EH2 A;  2FO0 A;  1R77 A;  4M4Z A;  1UGS B;  4E6R A;  1Q86 U;  3QXE B;  6AT1 B;  5CAI A;  1UEC A;  3G4S A;  1WYX A;  3MP6 A;  3SWN A;  3URG A;  1E7O A;  4IUQ A;  2HBW A;  2DNU A;  2OTL A;  1ZLM A;  1NJI U;  4E7K A;  2PVD B;  4BI3 A;  1G3Y A;  5IXB A;  1NLP C;  3QJ6 A;  4FU6 A;  2KR3 A;  3RR6 A;  1W2B P;  3WXM B;  1MNE A;  1N8R U;  4M77 F;  1K73 R;  4KUD K;  4KGV B;  1Z9Q A;  3CEY A;  2RJC A;  2HZY A;  1NEG A;  1XQH A;  1VQK T;  3OYH A;  4QQD A;  4J8O A;  2RJF A;  4Y91 A;  1Y96 B;  2DRK A;  1JRI A;  4CC4 B;  5FRN A;  3CC2 A;  1AWW A;  2K6D A;  1LCK A;  2MIO A;  4LD6 A;  2E3H A;  2HL3 A;  5CR2 A;  3VYH B;  4O5V A;  1G2B A;  2IG0 A;  2XU8 A;  1OYX A;  3NTK A;  4TVR A;  3CCE Q;  5GAN 3;  5LJ5 g;  3H0I A;  3LW5 E;  2VV5 A;  1QKW A;  2HBP A;  3VS7 A;  2K3B A;  1KD1 R;  1OZ2 A;  4BY6 C;  2EQK A;  1TUD A;  4HVW A;  4ZN3 A;  1NG2 A;  3E9F A;  4BY6 B;  2MK5 A;  3JB9 H;  1VQL A;  4M7A F;  5EC7 A;  2ED0 A;  3EG9 A;  1Q81 R;  5FWC A;  2BE7 D;  2VWF A;  3JCM Q;  1M1K R;  3SB2 A;  5IAY A;  9ATC B;  2KT1 A;  2GQV A;  4M78 D;  2QQA A;  2A0F B;  1NEB A;  2V26 A;  1TUC A;  1BK2 A;  1SRL A;  3KUF A;  1VQO T;  4PJO E;  4DBQ A;  3I5R A;  2CYZ B;  1O75 A;  3JB9 J;  2RF0 A;  2X35 A;  4C92 A;  4PJM A;  2G3R A;  1X2Q A;  1EZZ B;  3L2W A;  3JCM e;  2DL4 A;  2BZY A;  2FZG B;  3JCM b;  1NYF A;  4BE1 A;  1NM7 A;  3C94 A;  3INZ A;  1JXM A;  1KG1 A;  2LTO A;  1QKX A;  2KYB A;  2COY A;  4X9D A;  3TVT A;  2ATC B;  4D6W A;  5LJ5 j;  1U8R A;  2C0I A;  2K2M A;  2RK1 A;  2EVR A;  2K3Y A;  2YUN A;  4OML A;  1HSQ A;  1VQK Q;  4C8Q E;  1YCS B;  4M7D E;  3SFM A;  1YWP A;  5GAN g;  4Z02 A;  5GAN 7;  2DL3 A;  1YIJ T;  2ECZ A;  2DTI A;  3OYG A;  1D3B B;  2EGC A;  4M78 A;  3V8K A;  4GLM A;  1M8V A;  2QI2 A;  2PUO B;  4NS5 A;  2KK4 A;  1X27 A;  2RI3 A;  4AG2 C;  1K8A U;  3VV0 A;  3BDU A;  4WF2 A;  2E64 A;  1B7T A;  1QVP A;  2JTM A;  1WI7 A;  2JXB A;  3J81 E;  2ZPF B;  2PVG B;  1OV3 A;  4LUD A;  3A8O B;  3KXT A;  2H3J A;  2JW4 A;  2E12 A;  2QTV A;  5CO7 A;  5L8R E;  4DQ2 A;  1IB8 A;  1ARK A;  1YP5 A;  4XU2 A;  1OUL A;  1AD5 A;  4A53 A;  2CP2 A;  2CT3 A;  3M53 A;  4PFO A;  2KBT A;  3A8H B;  2RM4 A;  4PJO F;  2DJQ A;  1KJW A;  2QXF A;  3EGU A;  3EG1 A;  2QAS A;  2COW A;  3CCU Q;  2KRN A;  1VQO Q;  3VS5 A;  1QVF A;  2JM8 A;  3OW2 S;  5HK0 A;  2DXB A;  1PWT A;  1AWX A;  1UGQ B;  1WHH A;  1TSF A;  3G7Z A;  4ESR A;  2EYZ A;  3MHX A;  2RJE A;  1MMG A;  1GFC A;  1U3O A;  5GAN j;  1UTI A;  1YNZ A;  4CC7 A;  1SEM A;  1ZUU A;  4KGZ B;  3CXC A;  1G8X A;  5ECA A;  3JB9 F;  1MND A;  2RHX A;  5GAM h;  5GAM f;  1TWB A;  1ZHI A;  2DL8 A;  4C8Q F;  5C0M A;  5KH6 A;  1H8K A;  2OAW A;  2DAQ A;  2RQT A;  2O9S A;  3JCM W;  2M9U A;  4C5E A;  1K9A A;  4DBH A;  5A2Q E;  4V2S A;  2QEX T;  1S72 Q;  1D09 B;  3LH5 A;  2L0A A;  2I2L A;  1Q82 C;  1M90 C;  4OB1 B;  3CCE A;  3VJP A;  1VQ5 Q;  2RMO A;  1KC8 R;  3EG2 A;  1K73 U;  5I22 A;  2QDY B;  3CCL T;  2YLB A;  3CC4 Q;  1K76 A;  2P4R A;  2VAS A;  1BCO A;  1GRI A;  4BAC A;  3V7S A;  2OTL T;  3QDF A;  1ZSG A;  3L2U A;  5LJ3 h;  5LJ3 f;  1XTD A;  3VS2 A;  2DER A;  2ZPB B;  3CQT A;  2LRQ A;  4MMK A;  1NPR A;  2WSC E;  3CBO A;  4N0A C;  5GMK m;  1I4K 1;  2LJ0 A;  3CCJ Q;  2L3Q A;  2MYS A;  2X3W D;  2QG9 B;  3OS2 A;  3NTI A;  2HAX A;  1FMK A;  3EGD B;  1KD1 U;  4C0F A;  2BKD N;  1B34 B;  4JJC A;  2KEA A;  2LQN A;  4QVD A;  2JTF A;  2O2O A;  1KHI A;  3V7C A;  4M7D D;  2BIV A;  2GTJ A;  3OMC A;  2MAM A;  4IUU A;  3ER0 A;  5I11 A;  3PTA A;  2ZGW A;  3PNW C;  4XTV A;  3CC2 T;  1NJI C;  2DET A;  1T0J A;  2DK3 A;  2HL5 C;  1KQ1 A;  1IHV A;  3I56 Q;  2EQJ A;  1IO6 A;  2K57 A;  1HK9 A;  3JRZ A;  1KHC A;  1RAA B;  2E6N A;  3S3M A;  1RAG B;  2F1L A;  3RMQ A;  3OW2 P;  1B07 A;  2LX7 A;  3H9N A;  3X25 B;  4IKF A;  4PJL A;  1X43 A;  2EJF A;  2LMJ A;  2F2X A;  5AYF A;  1VQL T;  2AK5 A;  1FYN A;  1RI0 A;  5GMK h;  2AZV A;  2L8D A;  2QEX Q;  1G5V A;  1TH7 A;  1PKT A;  3HKS A;  2YDL A;  4J9I A;  1P92 A;  1GCQ A;  1K4U S;  5I2M A;  1M27 C;  4X34 A;  3JCM g;  1I1J A;  2M02 A;  4N0A A;  4KH0 B;  4J9C A;  2LQ8 A;  5J26 A;  2CP5 A;  3CPW P;  3M57 A;  1I8F A;  3G4S Q;  2X3X D;  3HFO A;  2OTJ Q;  1KQS A;  2L3P A;  1JJ2 A;  1AHJ B;  2RQU A;  1UFF A;  3REA B;  4HCK A;  3EFO B;  2ZAE A;  1XNI A;  2QTX A;  1WDX A;  2DTO A;  3IQL A;  4ELY C;  3CCU A;  4JUV A;  4BE0 A;  3OYC A;  1BYM A;  1M9S A;  2ABL A;  4JS5 A;  4BDY A;  3UT1 A;  3PFS A;  2RNA A;  2CSI A;  5D6W A;  4A63 B;  1LJO A;  1EX4 A;  2XKO C;  2V1Q A;  1MV0 B;  5KE3 A;  3OB9 A;  1RAD B;  3BW1 A;  3RBB B;  2J05 A;  2CP3 A;  3CC2 Q;  4JJN K;  3HRU A;  1ZSZ C;  2KNB B;  2LDM A;  4J9B A;  1Q7Y C;  4OB3 B;  1TXQ A;  3EH1 A;  4QQ6 A;  3FEO A;  4B9W A;  4L6V 5;  1RAB B;  1BCM A;  2EQU A;  3E19 A;  1CKB A;  3OQ5 A;  3QHS A;  3QO3 A;  2HSP A;  4FIB A;  3FIF A;  3CCS T;  1K9M R;  1VQL Q;  2KSS A;  4QVZ A;  4C92 E;  2KDS A;  1VQ5 A;  1KQS S;  4BB7 A;  1JJ2 S;  2DZC A;  3HRT A;  4J7F A;  3OYM A;  3PIO A;  4DBF A;  4JS4 A;  2EJ9 A;  1N5Z A;  4XU3 A;  1ZUK A;  3VS4 A;  2RI5 A;  3CC4 A;  2F2V A;  4F7U F;  4JLG A;  3ULR B;  2DYI A;  4XTX A;  2KI7 A;  5GAN e;  1K8A C;  1VYU A;  4XQ3 A;  5CCA A;  2JOY A;  2K2V A;  3J7A F;  4M75 C;  2JN0 A;  3VRZ A;  5CKB A;  1N6A A;  3OSS C;  4J7I A;  4JRP A;  4AFZ C;  2J6K A;  1WZO A;  2RHY A;  4M75 B;  5FLX E;  1IZ6 A;  3JCM P;  3CCJ A;  2HDA A;  1OZ3 A;  3H8Z A;  4M78 E;  4FM4 B;  3D7S B;  3NTH A;  2K79 A;  4DBR A;  4PLL A;  3TRE A;  2EYX A;  5I21 A;  5GAN 4;  4O6J A;  4E7I A;  2SRC A;  4FYX B;  2JT4 A;  2RI2 A;  3L2R A;  5GJV B;  1MMN A;  3SEM A;  2B86 A;  2YSQ A;  3CCE T;  2FPD A;  1A0N B;  3M56 A;  3OYB A;  4LN2 A;  3M55 A;  3BE3 A;  2KT8 A;  4OGE A;  3R6N A;  3CCR A;  1QP3 A;  1FWZ A;  1ZBJ A;  1F1B B;  2HSE B;  3NPF A;  3BDL A;  1NYG A;  2XDB A;  1GXI E;  1TTH B;  4PL6 A;  2BE9 B;  2DIG A;  2CZ6 B;  3GNG A;  2P0K A;  2CZ1 B;  2CP0 A;  3DLM A;  2HKN A;  2R57 A;  1M3A A;  4M75 A;  5KYW A;  4ANJ A;  3MP1 A;  1WX6 A;  1ZBX A;  1SPK A;  1YIT A;  2NWM A;  1HJD A;  3E1S A;  2LT4 A;  4L5G A;  3NFC A;  3G6E Q;  1WJR A;  2OTJ A;  1VQM A;  3L42 A;  1UJY A;  4FW1 A;  3G71 Q;  7AT1 B;  4FYY B;  3DB3 A;  3GNF B;  5J39 A;  2KQW A;  1D0Y A;  5C6S A;  1ZA1 B;  3OS1 A;  2P0P A;  4D8K A;  3GPL A;  1KQS P;  4RKU E;  1JJ2 P;  1G83 A;  2GFU A;  4RCC A;  2DIQ A;  1WHM A;  4MZM A;  2RD1 A;  2A7Y A;  3JCM J;  1PSE A;  1VYV A;  5FW9 A;  1M30 A;  4M78 F;  2E6Z A;  1E6H A;  2XID A;  4ORZ A;  4P5N A;  4XU0 A;  2CS7 A;  2D8H A;  2YT6 A;  2C06 A;  1MUZ A;  3CCM A;  4BE2 A;  1RLP C;  1OOT A;  4HT8 A;  1ABQ A;  3OYJ A;  2O4X A;  1WXB A;  3X24 B;  4C92 D;  1OX8 A;  1YBY A;  4PFZ A;  2FZK B;  4F04 B;  1KK7 A;  4Q5W A;  2HQX A;  1NLO C;  3M5A A;  4JZ4 A;  5CQY A;  2OJ2 A;  1T3S A;  3GIB A;  4D8D A;  1OPK A;  4M75 G;  2HMA A;  1ZX6 A;  1AVZ C;  3QPH A;  4ZGJ B;  4ZTF A;  4A4E A;  5GAO m;  3UPU A;  4KH1 B;  2HQH A;  3VS0 A;  2EJG A;  2K5I A;  2RJD A;  1UG1 A;  3FB9 A;  3CMA Q;  2DYB A;  2CGH A;  1V76 A;  1WJS A;  1YHQ A;  4XU1 A;  1M1F A;  4OB0 B;  4E2F B;  1SSH A;  3LWH A;  4RUG A;  4C0Z A;  3CCU T;  4A4G A;  2CZ7 B;  3MPU B;  1RAC B;  5CKH A;  4JDS A;  4M77 C;  4YTL A;  4EIK A;  1QVG P;  4JRK A;  2ZZD A;  4KT0 E;  3UF4 A;  4M77 B;  4CC2 A;  4QVC A;  1K9M U;  4E7S A;  1WGS A;  1RL2 A;  1Y96 A;  1H3Z A;  2J6F A;  4ATO A;  1IHW A;  3HL8 A;  5LL6 S;  2V8I A;  1W6X A;  1HXD A;  2V8K A;  4RTY A;  2D6F A;  4FYV B;  2Y90 A;  2PU9 B;  4PJN A;  1Z9Z A;  3MEA A;  3M59 A;  5CVI A;  4F17 A;  1BBZ A;  3HP9 A;  4ZTJ A;  4LDX A;  5FRM A;  5GAM d;  1WJQ A;  2LX9 A;  3EAE A;  2EAY A;  2E41 A;  3S6W A;  5GJW B;  4N4G A;  3EGX B;  1VQP A;  1S72 T;  3V8J A;  3M0T A;  4M7A C;  4IUR A;  1VQ5 T;  4OF1 A;  4M7A B;  3I55 Q;  5CQX A;  4HA8 A;  2ROT A;  3CC4 T;  2DO3 A;  2P4T A;  3A8M B;  1ACM B;  3QWY A;  3L2Q A;  1VA7 A;  5DLO A;  2PZ1 A;  2VUB A;  1M8M A;  3QG1 A;  2MCN A;  4C5H A;  5DLQ E;  5LJ3 d;  3QYH B;  1MHN A;  2P84 A;  2D0Q B;  2GTO A;  3CCJ T;  3X20 B;  1NPP A;  1I0C A;  1WA7 A;  4J6X A;  4A4K A;  4HVV A;  3ZBD A;  1MV3 A;  3MJX A;  2EYW A;  3G6E A;  2ESW A;  5A0G A;  2L3S A;  2YWW A;  4PLI A;  1YN8 A;  2RB6 A;  3G71 A;  3VU3 C;  2MPX C;  1R8O B;  2YUO A;  4GLK A;  2DPP B;  1BB9 A;  4RMO A;  4X9C A;  2R58 A;  3EGX A;  2EW3 A;  2ZCF B;  4DEX A;  2QQS A;  1UUE A;  3FDR A;  1QP2 A;  3I56 T;  3JCM V;  1D3B A;  4JJD A;  4LUE A;  2RN8 A;  3X26 B;  1WHK A;  1VYT A;  2X51 A;  1KIK A;  2EYQ A;  3MP8 A;  4L59 A;  1W70 A;  3RNJ A;  1IRX A;  4PKC C;  1TOV A;  2RO0 A;  1PG5 B;  2R5M A;  4EMK C;  2DD5 A;  3MO8 A;  2QQR A;  4M7D F;  4EMK B;  1D1C A;  2FVU A;  4J9E A;  1RAF B;  1SSF A;  4M77 G;  2X4Y A;  5KYU B;  4HT9 A;  1X6G A;  3THK A;  1D1B A;  1WHJ A;  1YIT T;  1VQ6 A;  4MZT A;  3CBM A;  3OS5 A;  1VOM A;  3QSU A;  3TEE A;  2C0T A;  3CCV A;  1H92 A;  2LQK A;  4GY5 A;  3V7R A;  1U06 A;  4PJO C;  2RQR A;  1OU8 A;  3G4S T;  2JMC A;  3MET A;  2VXE A;  2OTJ T;  1UJ0 A;  1VQM T;  1SRM A;  3GF5 A;  4PJO B;  3CMA A;  3CC7 A;  5D6Y A;  1QVF S;  3HRS A;  4XTY A;  5LJ5 d;  4KRT A;  1SG5 A;  1I5L A;  5IN1 A;  2A3L A;  2NUZ A;  1OPL A;  1WNL A;  3GBQ A;  2HNI A;  1E6G A;  2DVJ A;  4XAX B;  1AWO A;  2AZS A;  4NL3 A;  4QT7 A;  3RES A;  2FG0 A;  1Q86 C;  4M7A G;  2WSF E;  3CCM T;  3CXC S;  4FT4 A;  1GBQ A;  2KVQ G;  2LNH B;  2FPE A;  1Q81 U;  1I81 A;  4C8Q C;  1UHF A;  1M1K U;  4EMK A;  4M7D C;  1T0H A;  4FCY A;  3M0Q A;  4DEY A;  2HCK A;  4C8Q B;  3LGF A;  2E5K A;  2F5T X;  4VUB A;  5GAO p;  4M7D B;  1AOJ A;  2QA4 A;  2M1H A;  1UEB A;  5EG2 A;  4J9D A;  3C12 A;  4M75 E;  1N8R C;  2QAZ A;  2PNI A;  1X2K A;  3CCR Q;  4J83 A;  2VC8 A;  3HFN A;  3REB B;  4KBM B;  1RLQ C;  1FMV A;  3CCQ A;  1QWE A;  1BIA A;  1QCN A;  4LDV A;  1ZQ1 A;  2E10 A;  1YHQ T;  1JU5 C;  3I55 A;  4C0D C;  2SEM A;  3OYI A;  1AWJ A;  1MMD A;  1SHF A;  1LNX A;  4C0D B;  2DRM A;  2NUT B;  1W4S A;  1DJ7 B;  3HTR A;  3OYK A;  2WSE E;  4PNO A;  4JJB A;  2L89 A;  1PNJ A;  1YIT Q;  5GAN d;  4Z89 A;  3EGD A;  1PD0 A;  1KQ2 A;  5CIU A;  1B34 A;  2RQV A;  2IPO B;  3I5S A;  2KY9 A;  5GMK e;  2K3X A;  1VQM Q;  3OBW A;  5LJ5 h;  5LJ5 f;  2GNC A;  5KYY B;  3OYD A;  5GAO r;  4IUP A;  4AG1 C;  2VXF A;  2ENM A;  1RUW A;  4JRI A;  4C8Q A;  4EDU A;  3RUX A;  2KXC A;  2MF2 A;  2L3R A;  4OMN A;  2EKH A;  2LCC A;  4C0G A;  3QZ9 B;  4QW2 A;  2JM9 A;  2RK2 A;  4XK8 E;  3CCM Q;  1PCX A;  1W2B A;  1UGR B;  1G3T A;  1QVF P;  3OSV A;  2FB7 A;  1GFD A;  2DFU A;  1Y07 A;  4BUG A;  1I07 A;  3UAT A;  4F16 A;  4AT1 B;  1Y7X A;  5L23 A;  4PJO G;  4FW2 A;  1JQQ A;  2KRS A;  5GAN 8;  3HPW A;  2DXU A;  1M1G A;  1ZSZ B;  2NUT A;  5HCK A;  3CXC P;  2K4Y A;  2MWP A;  5IHK A;  4FSS A;  3S3O A;  3KBG A;  2DVE A;  5FWB A;  4E7Z A;  4QKU A;  2L5Q A;  4HCB A;  4CRI A;  2O88 A;  4MDX A;  3OYY A;  5D6X A;  3GOX A;  1RI9 A;  1YHQ Q;  3UWN A;  1MMA A;  3EFO A;  2M0Y A;  4IUV A;  3JB9 G;  3OYA A;  3M58 A;  2NUP B;  1LVK A;  3N5B B;  4ZNX A;  3DLL A;  4E7J A;  2DX1 A;  1OX9 A;  4C8Q G;  5GAN f;  1JO8 A;  5GAN h;  3G6E T;  2NLU A;  3L2V A;  5FU6 C;  1X69 A;  1I5O B;  2DBM A;  4HVU A;  3G71 T;  4EPC A;  5FU6 B;  2D9T A;  4KUL A;  5AT1 B;  4C5I A;  2FRY A;  1NZ9 A;  1Q7Y R;  1IGU A;  3VYG A;  3CD6 Q;  4HCZ A;  3ZEH A;  3MKD A;  3OBY A;  4IIO A;  3M54 A;  3OMG A;  3M9Q A;  2KMT A;  4M75 D;  1KC8 U;  2DXC A;  8AT1 B;  2DD4 A;  2VKN A;  4C5G A;  2DZ9 A;  3JB9 I;  1YJN A;  2M51 A;  1ZSZ A;  3JCM X;  4K11 A;  1YCY A;  1QQJ A;  2WAC A;  2EPD A;  1BI1 A;  2GQI A;  4KGX B;  5GAM g;  1D1A A;  1UB4 A;  2RPN A;  2QQ9 A;  2QQB A;  4HKE A;  4X1V A;  3SWN C;  1VQP Q;  3U23 A;  3RDV A;  1C6V X;  5GAN 6;  3SWN B;  4XTZ A;  1AT1 B;  3ZFJ A;  2FL7 A;  3M0S A;  3QKJ A;  3E2U A;  1VQ6 T;  3CCV T;  4IUT A;  5FU7 C;  1CKA A;  3CME Q;  2JTE A;  3JV3 A;  1YJ9 Q;  4AFU C;  4R55 A;  5FU7 B;  2DM1 A;  1RAH B;  3LLR A;  3EFS A;  4F7U B;  3CMA T;  1BIB A;  4RTT A;  3CC7 T;  2JUF A;  2KAF A;  2XDP A;  4C92 F;  1VQ7 A;  4MDW A;  2EGA A;  5LJ3 g;  2IVW A;  4OMQ A;  3F70 A;  4OMM A;  1HD3 A;  2L2P A;  3I9Q A;  1K73 C;  2DEQ A;  3HSB A;  5KYX B;  4FL6 A;  1EFN A;  1BI0 A;  2LT1 A;  1K0S A;  4F14 A;  2ROL A;  4B9X A;  3O8V A;  4Z8A A;  2AKL A;  1NBE B;  1OU9 A;  5GAM j;  2X9H A;  1AZG B;  1ABO A;  3H41 A;  2EKO A;  1UHC A;  3WVE B;  5KE2 A;  4PFP A;  1WHL A;  1VQ9 A;  3JCM d;  2DJZ A;  3CCL A;  4J6Y A;  1K0X A;  4A4H A;  2QA4 T;  1YWO A;  4B6M A;  3UA7 A;  4JRQ A;  2YXY A;  4HXJ A;  4ZGD B;  4JLI A;  4J9F A;  1KD1 C;  4OVA A;  3EG9 B;  2X4X A;  2BZ8 A;  2ZPG B;  1K1Z A;  2FZC B;  1WXU A;  3CCQ T;  3CBP A;  1QWF A;  2D0N A;  3QYG B;  1Q81 C;  4F7U A;  1QMC A;  2PTK A;  3DB4 A;  2J6O A;  1M1K C;  2PUK B;  3QBY A;  3I55 T;  1SKU B;  4C92 C;  1JXO A;  1QW1 A;  1YI2 A;  3RIR A;  2J06 A;  5LJ3 j;  3L1A A;  1M4Z A;  1WQW A;  4BI4 A;  2XIC A;  4C92 B;  2V8J A;  2KRO A;  2QDL A;  1VQ6 Q;  2QGF B;  5J3B A;  5KYX A;  3CCV Q;  1PKS A;  3TSW A;  1J3T A;  2ZPE B;  1YJW A;  2E5Q A;  3VS3 A;  3OYF A;  1VQN Q;  1W1F A;  3CC7 Q;  1ZA2 B;  1QCO A;  4LE9 A;  4N4I A;  4ZN1 A;  4RG8 A;  3QII A;  2NYS A;  5I2S A;  3C4S A;  2A08 A;  3NGP A;  3VS6 A;  2MMP A;  1LPL A;  2CP6 A;  3QDR B;  4M78 C;  1H3H A;  2W10 A;  3T9N A;  4ME7 A;  2YRD A;  2LCL A;  4PJJ A;  2H3E B;  4M78 B;  5HK3 A;  2YLC A;  1B3Q A;  1VQ8 Q;  4RTX A;  4RTU A;  3A5Z B;  1VUB A;  1VQ4 A;  3PE0 A;  1JB0 E;  3CD6 A;  3JCM h;  3JCM f;  3ZL7 C;  4M77 D;  1BU1 A;  3M4G A;  1GL5 A;  5A0D A;  4PK4 A;  5HKC A;  2MI6 A; 
#chains in the Genus database with same CATH homology
 2XDD A;  2Y4Y A;  4F7U G;  4OMF B;  2DTO A;  2VGM A;  4HT9 A;  5KCO A;  4ELY C;  5GMK j;  5GAO q;  3CCU A;  3JCM c;  1YIT T;  1VQ6 A;  4MZT A;  4JUV A;  3CBM A;  4BE0 A;  3OS5 A;  2O4X B;  2JZ2 A;  3OYC A;  3TEE A;  4LD9 K;  2EFI A;  3CCV A;  1M9S A;  3QSU A;  2LQK A;  3MCA B;  1N9S A;  1WQ7 A;  4GY5 A;  3V7R A;  3L2Z A;  2RH2 A;  2PQW A;  3LWI A;  3G4S T;  1QVG S;  2XHC A;  2DKG A;  3UT1 A;  3MET A;  3PFS A;  2VXE A;  1H64 1;  5D6W A;  2OTJ T;  5GAN 5;  1LJO A;  1VQM T;  2XG8 D;  2E1H A;  2XKO C;  4EMG A;  4M7A E;  3GF5 A;  4PJO B;  4R56 A;  5CKE A;  3CMA A;  1VQ8 T;  2QEX A;  5KE3 A;  3CC7 A;  5D6Y A;  3OB9 A;  3MEU A;  1QVF S;  3HRS A;  2YHT A;  3BW1 A;  5GAO l;  4XTY A;  5LJ5 d;  1Q7Y U;  1WPY A;  1I5L A;  1XOV A;  3CPF A;  4CI0 C;  4JJN K;  5IN1 A;  3HRU A;  2YRV A;  2A3L A;  2LDM A;  4N4H A;  1OI1 A;  1X01 A;  3OW2 A;  1Q7Y C;  1WNL A;  4FT2 A;  1UGP B;  4OB3 B;  2HNI A;  1UGS B;  4QQ6 A;  4XAX B;  1Q86 U;  3QXE B;  4NL3 A;  3FEO A;  4B9W A;  5CAI A;  4L6V 5;  3G4S A;  2EQU A;  3MP6 A;  3PGG A;  3H6Z A;  3SWN A;  3E19 A;  3URG A;  3RES A;  4M7A D;  4IUQ A;  1Q86 C;  4PJO C;  3OQ5 A;  4M7A G;  2WSF E;  3QHS A;  3CCM T;  3CME A;  3CXC S;  4FT4 A;  1YJ9 A;  2OTL A;  3QO3 A;  5GAO n;  2KVQ G;  4FIB A;  1FX7 A;  3FIF A;  3CCS T;  1NJI U;  4E7K A;  2PVD B;  1EIF A;  2KSS A;  1Q81 U;  4QQG A;  4QVZ A;  4C92 E;  1I81 A;  1G3Y A;  2KDS A;  4BI3 A;  4C8Q C;  1M1K U;  4EMK A;  4M77 A;  4M7D C;  1VQ5 A;  3QJ6 A;  4FU6 A;  1KQS S;  4DOW A;  2VGN A;  4BB7 A;  1JJ2 S;  2DZC A;  3HRT A;  3LGL A;  4J7F A;  3PIO A;  3OYM A;  3WXM B;  4C8Q B;  4JS4 A;  2EJ9 A;  3LGF A;  3CPW A;  4XU3 A;  2F5T X;  3LYI A;  4VUB A;  5GAO p;  1N8R U;  4M7D B;  2QA4 A;  4M77 F;  2M1H A;  1UEB A;  3JAM E;  1U1T A;  2RI5 A;  5EG2 A;  3CC4 A;  4KUD K;  5GMK i;  4XTU A;  4F7U F;  4M75 E;  3C12 A;  1N8R C;  4JLG A;  3CEY A;  2RJC A;  4XTX A;  1YJN T;  1K8A C;  1XQH A;  5GAN e;  1VQK T;  4XQ3 A;  5CCA A;  4J83 A;  3OYN A;  3OYH A;  2JOY A;  2VC8 A;  4QQD A;  3HFN A;  2K2V A;  4J8O A;  1Y71 A;  3CCS A;  2RJF A;  4KBM B;  2ZPI B;  3J7A F;  4Y91 A;  1Y96 B;  4M75 C;  2JN0 A;  4C92 G;  5CKB A;  1JRI A;  1N6A A;  3CCQ A;  3M4Y A;  3OSS C;  5FRN A;  4J7I A;  1M5Q 1;  4JRP A;  1BIA A;  3CC2 A;  1N9R A;  4LDV A;  1ZQ1 A;  4M75 B;  2RHY A;  5FLX E;  2E10 A;  1IZ6 A;  4LD6 A;  3VKI A;  2LNV A;  3JCM P;  1YHQ T;  5CR2 A;  3CCJ A;  1G3S A;  2F69 A;  3VYH B;  4O5V A;  3I55 A;  2IG0 A;  4C0D C;  2XU8 A;  1OYX A;  3NTK A;  4TVR A;  3OYI A;  5GAN 3;  5LJ5 g;  3OS0 A;  1LOJ A;  1OZ3 A;  3LW5 E;  3H8Z A;  1LNX A;  4M78 E;  2VV5 A;  4FM4 B;  3RKW A;  4C0D B;  1W4S A;  1DJ7 B;  2HBP A;  2O01 E;  3VUB A;  2WSE E;  4PNO A;  5GMK l;  3OYK A;  1KC8 C;  2HD0 A;  1OZ2 A;  4M7A A;  4BY6 C;  2L89 A;  2EQK A;  4A54 A;  3NTH A;  4ZN3 A;  3CCR T;  1VIE A;  3E9F A;  5GAN d;  1KQ2 A;  4PLL A;  3PIP A;  3TRE A;  4BE2 A;  4BY6 B;  5I21 A;  3JB9 H;  5CIU A;  1VQL A;  4M7A F;  5GAN 4;  1B34 A;  3LX7 A;  2KY9 A;  3E9G A;  4O6J A;  2EWN A;  2K3X A;  3DKM A;  5GMK e;  4E7I A;  2E70 A;  3JCM Q;  2RI2 A;  3OBW A;  3L2R A;  4MZP A;  4Y28 E;  5LJ5 f;  5LJ5 h;  3SB2 A;  2Y4X A;  5IAY A;  3RKX A;  4BI8 B;  3OYD A;  5GAO r;  2GQV A;  1FXX A;  3S3N A;  4M78 D;  1VQ7 T;  4IUP A;  2JVV A;  2VXF A;  3CCE T;  1PSF A;  4M78 G;  2QQA A;  3M56 A;  3OYB A;  4JRI A;  3M55 A;  4C8Q A;  3KUF A;  1VQO T;  4PJO E;  4EDU A;  1BKB A;  4OGE A;  3CCR A;  3OYL A;  1QP3 A;  4OGC A;  4UC4 A;  3RUX A;  3X28 B;  5GAM e;  3CPW S;  1FWZ A;  3V8L A;  2CYZ B;  1O75 A;  2MF2 A;  3JB9 J;  2L3R A;  2K5L A;  2LCC A;  4C0G A;  2X35 A;  3QZ9 B;  3SD4 A;  4QW2 A;  4C92 A;  4E47 A;  2RK2 A;  2OAU A;  3BDL A;  4XK8 E;  2G3R A;  4HCC A;  4LDU A;  1W2B A;  1UGR B;  1G3T A;  2XDB A;  1GXI E;  4PL6 A;  3FC3 A;  3OSV A;  1O9S A;  2DIG A;  2CZ6 B;  2FB7 A;  3JCM e;  3L2W A;  1VQN A;  3GNG A;  2P0K A;  2CZ1 B;  5HY6 A;  1Y07 A;  3DLM A;  4BUG A;  4NOY A;  3JCM b;  2R57 A;  4M75 A;  4BE1 A;  1VQ9 T;  4PJO D;  2CZ0 B;  3OYE A;  3C94 A;  3INZ A;  1Y7X A;  4PJO G;  1KG1 A;  2LTO A;  3MP1 A;  1ZBX A;  4EMH A;  5GAN 8;  4X9D A;  1YIT A;  3HPW A;  4D6W A;  3VUZ A;  5LJ5 j;  1U8R A;  2DXU A;  1M1G A;  3R6O A;  4FSX A;  2RK1 A;  3E1S A;  2LT4 A;  2K3Y A;  4L5G A;  3NFC A;  1WJR A;  3PT9 A;  2K4Y A;  2OTJ A;  2MWP A;  1VQM A;  3L42 A;  4C8Q E;  3S3O A;  3KBG A;  2DVE A;  4M7D E;  1VQ8 A;  2FYK A;  5LJ3 e;  3SFM A;  4KUI A;  2GF7 A;  3DB3 A;  2L5Q A;  3GNF B;  3SDZ A;  4Z02 A;  4CRI A;  5J39 A;  5GAN g;  5GAN 7;  2KQW A;  1YIJ T;  5C6S A;  4HCB A;  3OS1 A;  2P0P A;  2DTI A;  3OYG A;  1D3B B;  3GPL A;  4RKU E;  2GFU A;  4M78 A;  4RCC A;  4MDX A;  2DIQ A;  3V8K A;  3OYY A;  5D6X A;  3GOX A;  2E65 A;  1M8V A;  2QI2 A;  4MZM A;  2RD1 A;  2PUO B;  5CK9 A;  2A7Y A;  4NS5 A;  3JCM J;  3UWN A;  3JB9 D;  1PSE A;  2RHZ A;  1BI3 A;  5A0L A;  2KK4 A;  4IUV A;  4M78 F;  2E6Z A;  3JB9 G;  3OYA A;  1YI2 T;  2RI3 A;  2XID A;  3M58 A;  3N5B B;  4P5N A;  3DLL A;  4E7J A;  2EIF A;  4XU0 A;  2CS7 A;  1K8A U;  3VV0 A;  1VIF A;  4C8Q D;  2C06 A;  2RHI A;  3BDU A;  2X4W A;  4C8Q G;  5GAN f;  4WF2 A;  2XK0 A;  2E64 A;  5GAN h;  1QVP A;  3G6E T;  2NLU A;  3L2V A;  5FU6 C;  3CCM A;  2FHD A;  2JTM A;  4HT8 A;  3J81 E;  3G71 T;  2ZPF B;  2PVG B;  2O4X A;  3HHT B;  3OYJ A;  4EPC A;  3A8O B;  5FU6 B;  3BFM A;  3X24 B;  4LDY A;  3KXT A;  2H3J A;  3GLX A;  4C92 D;  3WVD B;  2E12 A;  5CO7 A;  5L8R E;  1YBY A;  2D9T A;  4KUL A;  4DQ2 A;  1YJW T;  3TCJ A;  4C5I A;  4XU2 A;  2PVO B;  4PJO A;  1NZ9 A;  4Q5W A;  2HQX A;  4A53 A;  3VYG A;  4HCZ A;  3M5A A;  5CQY A;  3M53 A;  3OBY A;  3ZEH A;  3GP8 A;  1IRE B;  3GIB A;  2M16 A;  3A8H B;  3M54 A;  3OMG A;  3M9Q A;  2KMT A;  2RM4 A;  4M75 D;  2DXC A;  4PJO F;  3TU4 K;  1KC8 U;  2QXF A;  4M75 G;  2DD4 A;  4C5G A;  2DZ9 A;  3JB9 I;  1YJN A;  1VQK A;  1QVF A;  1BYM A;  4J6W A;  2R5A A;  3QPH A;  4ZGJ B;  5HK0 A;  3JCM X;  3OW2 S;  4ZTF A;  1YCY A;  4A4E A;  2DXB A;  4OB2 B;  5GAO m;  2WAC A;  3UPU A;  2MWO A;  1UGQ B;  1BI1 A;  2EJG A;  2K5I A;  2RJD A;  3G7Z A;  5GAM g;  2EQM A;  4RCB A;  1UB4 A;  3FB9 A;  3QZ5 B;  2CGH A;  2QQ9 A;  3MHX A;  2RJE A;  1WJS A;  1YHQ A;  5GAN j;  2QQB A;  1VQ4 T;  2CKK A;  4HKE A;  3SWN C;  4II1 A;  3P8D A;  4XU1 A;  4OP0 A;  1M1F A;  3CD6 T;  3JSC A;  4OB0 B;  4E7H A;  5GAN 6;  3SWN B;  3LWH A;  4XTZ A;  3CXC A;  4F7U E;  3ZFJ A;  2FL7 A;  4C0Z A;  3JB9 F;  3QKJ A;  3CCU T;  2X4J A;  4A4G A;  2CZ7 B;  2RHX A;  3MEW A;  1VQ6 T;  5GAM h;  5GAM f;  4M7D A;  2B8A A;  5CKH A;  4JDS A;  4BD3 A;  1ZHI A;  3ASK A;  4M77 C;  4YTL A;  3CCV T;  4IUT A;  5FU7 C;  4C8Q F;  5C0M A;  5KH6 A;  4JRK A;  2ZZD A;  2HQE A;  2DAQ A;  4KT0 E;  2BUD A;  4M77 B;  3FLG A;  5LJ5 e;  2M9U A;  5FRO A;  4QVC A;  4R55 A;  3JCM W;  1K9M U;  4XTW A;  4C5E A;  2GCX A;  5FU7 B;  5A2Q E;  3LLR A;  4F7U B;  3EFS A;  3CMA T;  4V2S A;  1WGS A;  2QEX T;  1BIB A;  3CC7 T;  2JUF A;  2KAF A;  1RL2 A;  2XDP A;  2I2L A;  1Y96 A;  4MML A;  1K9M C;  4C92 F;  1Q82 C;  1H3Z A;  1VQP T;  4ATO A;  1BI2 A;  1M90 C;  4OB1 B;  1VQ7 A;  4MDW A;  3RKY A;  3UDC A;  3VJP A;  3CCE A;  5LJ3 g;  2IVW A;  3Q1J A;  3OY9 A;  3P8H A;  3HL8 A;  5LL6 S;  2V8I A;  1HXD A;  3OA6 A;  1VQO A;  2V8K A;  1K73 U;  2QDY B;  3F70 A;  3CCL T;  2YLB A;  2D6F A;  5DY9 A;  2Y90 A;  5IT9 E;  2PU9 B;  5CVI A;  2ZPH B;  3M59 A;  3MEA A;  3RER A;  4M75 F;  1K73 C;  2DEQ A;  2F5K A;  3HSB A;  3HP9 A;  4NL2 A;  4ZTJ A;  4LDX A;  4FL6 A;  4DA4 A;  5FRM A;  2JNG A;  1BI0 A;  2LT1 A;  5GAM d;  1WJQ A;  3A8G B;  2LX9 A;  2VYT A;  3CME T;  4BAC A;  3V7S A;  3EAE A;  2EAY A;  1YJ9 T;  2E41 A;  3S6W A;  4B9X A;  2OTL T;  3O8V A;  4N4G A;  3L2U A;  5LJ3 h;  5LJ3 f;  1XTD A;  4ELZ C;  1VQP A;  1S72 T;  2ZPB B;  2DXT A;  2LRQ A;  3V8J A;  3EFR A;  5DM7 R;  5GAM j;  4MMK A;  2EKO A;  1NPR A;  4M7A C;  3WVE B;  5KE2 A;  2WSC E;  4IUR A;  3CBO A;  4N0A C;  1VQ9 A;  5GMK m;  3JCM d;  1VQ5 T;  1I4K 1;  5CKF A;  1V29 B;  2DJZ A;  4OF1 A;  4M7A B;  3CCL A;  5CQX A;  4HA8 A;  4J6Y A;  4A4H A;  3OS2 A;  3NTI A;  2QA4 T;  2HAX A;  1MGQ A;  1KD1 U;  3CC4 T;  4JRQ A;  3LH0 A;  2DO3 A;  4C0F A;  2BKD N;  1B34 B;  4ZGD B;  1X6O A;  2P4T A;  3A8M B;  4JLI A;  4QVD A;  1KD1 C;  2JTF A;  4OVA A;  5KCH A;  1KHI A;  3V7C A;  4M7D D;  2BIV A;  3L2Q A;  1S72 A;  4M7D G;  2X4X A;  3OMC A;  5DLO A;  2MAM A;  2VUB A;  4IUU A;  3ER0 A;  3PTA A;  2ZPG B;  3QG1 A;  4C5H A;  4JS5 A;  1YIJ A;  2ZGW A;  3CBP A;  3PNW C;  4XTV A;  3CCQ T;  4BDY A;  1X75 C;  2XD0 A;  3CC2 T;  5DLQ E;  1NJI C;  2K5F A;  3QYG B;  1Q81 C;  3AHU A;  5LJ3 d;  3FRN A;  4F7U A;  3QYH B;  3DB4 A;  4J5Y A;  2M0O A;  1MHN A;  2PUK B;  1M1K C;  2D0Q B;  2DK3 A;  3QBY A;  3CCJ T;  3X20 B;  1NPP A;  1KQ1 A;  3I55 T;  1W2B S;  4C92 C;  2EQJ A;  1QW1 A;  1YI2 A;  3JRZ A;  2K57 A;  1HK9 A;  4J6X A;  3L1A A;  1N27 A;  3RIR A;  5LJ3 j;  1M4Z A;  1WQW A;  1KHC A;  3A8L B;  4BI4 A;  4A4K A;  1QVG A;  2XIC A;  2E6N A;  1G3W A;  3S3M A;  4C92 B;  3FJP A;  3ZBD A;  2V8J A;  3RMQ A;  3G6E A;  5A0G A;  5J3B A;  4PLI A;  3X25 B;  4IKF A;  2RB6 A;  3G71 A;  4ZGE B;  2EJF A;  3VU3 C;  5AYF A;  1VQL T;  1R8O B;  4GLK A;  2DPP B;  1RI0 A;  2ZPE B;  5M9O A;  4RMO A;  1YJW A;  3PMT A;  2AHJ B;  5GMK h;  4X9C A;  2E5Q A;  2R58 A;  4RG2 A;  1JBM A;  3OYF A;  2L8D A;  2DTH A;  2XI9 A;  4E7L A;  2LVM A;  2ZCF B;  1G5V A;  2QQS A;  1TH7 A;  3BY7 A;  4N4I A;  3HKS A;  2GFA A;  3FDR A;  1QP2 A;  1P92 A;  4ZN1 A;  3I56 T;  3RMS A;  3JCM V;  4RG8 A;  1D3B A;  2P0Q A;  3C95 A;  3QII A;  5I2M A;  3MEV A;  5I2S A;  3C4S A;  3P8B B;  3ME9 A;  4M77 E;  3X26 B;  4X34 A;  3JCM g;  4N0A A;  2EYQ A;  3MP8 A;  4L59 A;  4DOV A;  5CKD A;  3QJY A;  2LC4 A;  2MMP A;  2LQ8 A;  5J26 A;  4PKC C;  3M57 A;  2RO0 A;  3QDR B;  4M78 C;  3T9N A;  4ME7 A;  1I8F A;  2R5M A;  4EMK C;  2LCL A;  3HFO A;  1KQS A;  2DD5 A;  4M78 B;  5HK3 A;  1JJ2 A;  1AHJ B;  1NE8 A;  2RA2 A;  3MO8 A;  2QQR A;  2YLC A;  4M7D F;  4EMK B;  3J80 E;  2RHU A;  4BDZ A;  3A5Z B;  1VUB A;  1VQ4 A;  1Q82 U;  1VQN T;  3QUI A;  3PMI A;  5GAN 2;  1JB0 E;  1M90 U;  3I56 A;  4LDW A;  2FVU A;  3CD6 A;  3JCM h;  3JCM f;  4M77 D;  3M4G A;  1SSF A;  1U1S A;  1XNI A;  2X4Y A;  4M77 G;  5A0D A;  5HKC A;  4A4F A;  2MI6 A;  2QTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...