2LVMA

Solution structure of human 53bp1 tandem tudor domains in complex with a histone h4k20me2 peptide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
123
structure length
123
Chain Sequence
GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Acetylation limits 53BP1 association with damaged chromatin to promote homologous recombination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Tumor suppressor p53-binding protein 1
total genus 27
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lvmA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lvmA01
3G6ET 3TREA 3DB3A 3NTKA 3CCMA 3ME9A 2QEXA 2RHZA 3OW2S 1S72T 4RG2A 1IZ6A 1OI1A 4N4GA 3KBGA 3O8VA 3CC2A 1RI0A 3LH0A 2LDMA 3CC4T 3CPFA 2M1HA 4BDYA 4ZTFA 3EAEA 3GOXA 2HQXA 3OYYA 5DLQE 4A4HA 4YTLA 2F5KA 3PMTA 4BDZA 1M1KU 4GY5A 3CXCS 2RHXA 4E7HA 2JVVA 3C4SA 1VQ9A 1NZ9A 3M9QA 2LQ8A 1NPPA 3KUFA 3OYBA 3L2WA 5J3BA 1W2BA 2EQJA 1YJWT 4PLLA 2QA4T 3JAME 1VQPT 3L2RA 4QVZA 1VQ7T 1N8RC 1WJSA 3LGLA 1X6OA 4QW2A 1YI2A 1YIJA 1K73C 2O4XA 2BKDN 3G4ST 4A4FA 4FL6A 1YHQT 2E70A 2VYTA 3CCLA 3CMAA 4FU6A 1Q86C 1N8RU 3PIPA 2LCCA 5DM7R 2DIQA 2GFAA 2L8DA 5FRMA 3MEAA 4ZN1A 5D6YA 3QKJA 4B9XA 3OW2A 3CCVT 4PL6A 1YJNT 1VQ5T 1VQNT 5D6XA 3DB4A 4N4IA 4NS5A 5C0MA 3S6WA 3OYHA 5KE2A 1Q86U 2B8AA 2K3XA 4ZTJA 1VQPA 3UWNA 4IUTA 3I55A 2G3RA 1EIFA 3CC7A 1VQ6A 2FHDA 3LGFA 1VQ9T 3QBYA 5LL6S 3L2QA 2K3YA 2R5AA 1QVFA 2OTJA 3S3MA 3CMET 5IN1A 4HCZA 4BACA 2EQUA 2EKOA 4L59A 3SD4A 3OYLA 1W2BS 2O4XB 3PFSA 1Q82U 3CC4A 4EDUA 5IT9E 3A5ZB 5KCHA 1Q7YC 1KQSA 3G71T 2R5MA 3G4SA 4C5HA 3MO8A 3L2UA 2D9TA 3CXCA 3OMCA 3BDLA 1YI2T 1M90U 5FLXE 1Q81U 1K9MU 2DO3A 5J39A 3MEVA 3OB9A 5M9OA 4II1A 2QA4A 3CCUA 2X4XA 5D6WA 3OYFA 2L89A 4C5GA 3CMEA 5A2QE 4IUQA 2PQWA 4Q5WA 2OTJT 2RJDA 1WJQA 1SSFA 2JNGA 2RJEA 3OYJA 1VQ6T 3P8DA 3MP8A 1Q7YU 3FC3A 3DLMA 1YITT 1QVFS 2XDPA 1KD1U 4BE2A 3NTHA 3CPWA 2WACA 3HKSA 3CD6A 1KQSS 3S3NA 4QQGA 3OA6A 3FLGA 1VQMA 1NJIC 3OS1A 3OYAA 2R57A 3OYNA 2X35A 3OYDA 2CKKA 3PNWC 3ASKA 3I56A 3CCST 1M1KC 3J80E 1OYXA 1WGSA 1WJRA 2LVMA 4BD3A 1VQ4T 4E7LA 3OS2A 2E6ZA 1VQKT 2EQKA 4IKFA 3OQ5A 1VQ4A 2XHCA 2X4WA 1OZ2A 1Q81C 5J26A 3OMGA 1K73U 3CCQT 2QQRA 5HY6A 3J7AF 2LRQA 3Q1JA 1NJIU 5IAYA 4A4GA 4ZN3A 3L42A 4TVRA 3CD6T 5CIUA 1VQ7A 5FRNA 2RHIA 1NPRA 1QVGS 4QQ6A 3QIIA 2OTLT 2DIGA 1K8AU 2KVQG 4CRIA 3OY9A 2X4YA 2XK0A 4A4EA 4X34A 3OYGA 3CC7T 3I55T 2GF7A 2LTOA 1VQOA 4IUVA 3PIOA 2EIFA 2RI2A 3OYMA 1KC8C 2KDSA 1UEBA 4OVAA 3ZEHA 4BE1A 4C5IA 1H3ZA 3CCRT 3G6EA 3NTIA 1VQLT 2LCLA 4E7KA 2BUDA 1Q82C 3OS0A 2RJFA 3CCLT 2P0KA 1RL2A 2MWPA 1XTDA 2IG0A 3DLLA 2EQMA 3CCRA 3H6ZA 2QQSA 2HQEA 2JOYA 5KCOA 1YJ9A 1VQMT 1YIJT 4IUPA 2L3RA 5C6SA 1VQOT 2RHYA 2JTFA 4BE0A 3FDRA 3P8HA 1VQ5A 1VQNA 3MEWA 1QVGA 1YITA 1YJ9T 2RHUA 3L2VA 3MEUA 3OYKA 3LLRA 2RI3A 3CCJT 3UT1A 1N27A 3MP1A 4E7JA 1KC8U 2M0OA 4B9WA 2E5QA 1VQ8T 3CCUT 3H8ZA 1BKBA 4QQDA 1KHIA 3FEOA 1KD1C 3CCET 3F70A 1YHQA 2BIVA 2GFUA 3META 3G71A 1S72A 2MI6A 3OYEA 2DAQA 1YBYA 4Z02A 3CCEA 1XNIA 3LX7A 5KE3A 1VQKA 3PMIA 1YJWA 3CPWS 1VQ8A 3OYCA 3LYIA 3QJ6A 5KH6A 4LD6A 2EFIA 3CCJA 3I56T 3CCSA 2E6NA 2JZ2A 2R58A 4E7IA 2OTLA 1MHNA 2YRVA 1KHCA 3CEYA 3MP6A 4N4HA 3E9GA 1OZ3A 2JUFA 4IUUA 4C5EA 1G5VA 1JJ2S 2NLUA 2RJCA 3CC2T 4UC4A 4IURA 3P8BB 3ER0A 3S3OA 1JJ2A 2RI5A 1YJNA 3J81E 3CCVA 5FROA 1M90C 1K9MC 3CCQA 1K8AC 2QEXT 3OYIA 3CCMT 2M16A 2RO0A 1M1GA 3E9FA 3CMAT 4PLIA 2MWOA 1VQLA
chains in the Genus database with same CATH superfamily
5LJ3e 3TREA 3A8HB 3VS6A 4PJOG 1R77A 1QW1A 1FYNA 1IZ6A 3EGXA 2AZVA 1SHGA 3PT9A 3KBGA 1RI0A 5KYWB 2DL7A 2M1HA 5GANj 4DBFA 4M7DB 2GCXA 3OYYA 2EJFA 2XICA 1KSWA 1CKAA 1GCPA 4GY5A 4OGCA 3CCUQ 3CPWP 4JDSA 2M51A 1VQ9A 4M7DE 2LQ8A 4M7AD 4NL2A 2DD5A 2V8KA 1VQPT 5GJWB 3EG3A 2HMAA 1JQQA 2QK0A 2EYQA 1YIJA 3X20B 5GAMd 5LJ5h 4ELZC 3KXTA 2KMTA 3G4ST 2CUBA 4F7UB 5GAOr 4OB2B 1G83A 2VYTA 4C92E 2O88A 3CMAA 3CCSQ 2K57A 4HVUA 1I1JA 1OOTA 1G3SA 4M7AE 2M0YA 2LCCA 3CCLQ 2DIQA 5FRMA 4JLIA 3SHWA 2KSSA 4F16A 1RAAB 5D6YA 1U3OA 3QKJA 4Z89A 4JRIA 2D1XA 3QSUA 1VQ5T 5D6XA 1VQNT 2E1HA 1FMVA 2E64A 4R56A 3UPUA 1WZOA 2ZAEA 2KI7A 2J06A 1Z9QA 1P92A 1OPKA 3CBPA 2PVOB 4XTWA 2BZYA 3UWNA 1EIFA 3JCMJ 2FHDA 2F2XA 2E12A 1RAHB 3L2QA 2BZ8A 2ZPFB 2R5AA 1QVFA 2OTJA 1ZA2B 3CMET 2KNBB 2GGRA 4OMOA 4JRKA 2EQUA 4FT2A 2K79A 4E2FB 2HQHA 2RB6A 3VS7A 1LCKA 2O4XB 1WYXA 3OYLA 2EBPA 4XK8E 4EDUA 1AZEA 5KCHA 2LX9A 2M9UA 5KYXA 2R5MA 4C5HA 5GMKh 3OW2P 2MMPA 1AOJA 2RNAA 4E47A 1EX4A 1QKXA 1M90U 2EYYA 4M75E 3ZBDA 2GBQA 5J39A 1IB8A 3MEVA 2L3QA 2OTLQ 2WSEE 2AIRB 2QA4A 1PG5B 2E3HA 2CH4A 3V7SA 3VUZA 3C95A 1J3TA 2QXFA 4L5GA 2JNGA 2K2MA 5CKHA 1VQ6T 3P8DA 5I21A 2OI3A 1Q7YU 3FC3A 1BYMA 1YITT 2FZKB 2SEMA 3NTHA 1AT1B 2WACA 1HSQA 2O2OA 3CD6A 2PTKA 4JJDA 3UA7A 5GANh 1NJIC 3OYAA 3AHUA 3M0UA 3SFMA 2I2LA 3RMQA 2CKKA 2VC8A 1QWEA 4IIOA 4P5NA 3J80E 1D1BA 4PJMA 2DJZA 1VQ4T 1PSEA 1KJWA 3OS2A 3CBOA 1VQKT 4C8QC 2M02A 3OQ5A 2CP7A 2XHCA 2KT8A 5GMKj 1HYOA 1OX8A 2E3IA 3X26B 5J26A 4DQ2A 2KK4A 3CCQT 2C0OA 4ORZA 1WHHA 3A98A 2LRQA 3H9NA 1VYTA 2ZCFB 4ZN3A 1AWWA 5GMKl 1Y57A 2WSCE 2DTOA 3WXMB 3G4SQ 2W10A 1X2KA 2JXBA 3RESA 1NPRA 3GIBA 1QVGS 5KYNA 1WIEA 4QQ6A 4E6RA 2COWA 2OTLT 1ACMB 2FEIA 2V26A 3WVDB 4PJOA 1F1BB 2KVQG 2EYWA 1TH7A 3OY9A 4PJOF 1RAGB 2CDTA 2EVRA 5GANg 5FW9A 3RNJA 1BCMA 4X34A 4C8QE 5GAOq 4CC3A 3CC7T 3QO3A 4X9CA 1QCOA 5GAMh 4J6WA 4KUIA 4OB0B 4Y28E 3HRTA 1ZUKA 2LQNA 4IUVA 4V2SA 1IO6A 2D8HA 4PFPA 2EIFA 4PKCC 2NUTA 4XAXB 1B07A 2EGEA 2O01E 5IXBA 1OQKA 3SB2A 4C5IA 1H3ZA 3CCRT 1M4ZA 5CKDA 1WLPB 4QKUA 2DEUA 2JS0A 1QLYA 2RJFA 4J5YA 2ABLA 2E4HA 3DLLA 2IG0A 1WQWA 2VWFA 4FT4A 1G3YA 2HQEA 2P0PA 1GBQA 2JM9A 3TQ7P 1LVKA 4M78F 1YWPA 4C8QD 5C6SA 2HL3A 2RHYA 2JTFA 4BE0A 3P8HA 1HJDA 3MEWA 1YITA 2RHUA 2MPXC 2CP5A 3MEUA 1M1FA 3U23A 3OYKA 3JCMW 5I22A 4BI8B 5GMKm 3CBMA 2YRDA 5IXFA 3I9QA 3CCJT 3UT1A 1YIJQ 1FMWA 1KC8U 1NE8A 5IH2A 2HSEB 2M0OA 1QVGP 3E19A 3QPHA 1BKBA 1I07A 3I35A 4M78G 3EH1A 1KHIA 5CAIA 2DTIA 1YHQA 2L2PA 2BIVA 2GFUA 1MV3A 1AD5A 2YUQA 3A8OB 2L3PA 1S72A 1QP3A 3R6NA 5AYFA 5HKCA 4Z02A 3DKMA 1S1NA 4RTWA 1RABB 2X3XD 3PMIA 1KK7A 5FU7B 1QQJA 1RACB 1M3CA 3LYIA 1BI3A 4AMCA 4M77F 3CCJA 3I56T 3CMAQ 3CCSA 1E7OA 4PJJA 1U06A 2P4RA 1X69A 4LDVA 1LOJA 4EMKC 2YRVA 3MCAB 3TEEA 1UGQB 3G7ZA 5KYWA 3CEYA 1NJIR 3CCQQ 3E9GA 4ZGEB 1OZ3A 4IUUA 5I2MA 2RJCA 4UC4A 3ZFJA 3P8BB 1OU8A 3C0CA 2FPDA 3ER0A 2RI5A 5FROA 2FZCB 2QEXT 3CCMQ 3OSVA 3NHNA 2M16A 4ZGDB 4N0AC 1I4K1 3JB9G 4DEXA 2QQ9A 2PZ1A 1RAIB 4LXCA 4J7FA 1UB4A 4M78A 3C12A 3NTKA 4J8OA 2YWWA 3VS3A 3ME9A 2YUPA 2QEXA 1S72T 4RG2A 2X9HA 2PU9B 1GCQC 1OI1A 4FSSA 1QVPA 1RAFB 2DJQA 3O8VA 3LH0A 3CC4T 4HKEA 1D0XA 3LWHA 3EHRA 4HVVA 3JCMX 1V29B 1BIAA 3EAEA 2YLBA 2HKQB 3GOXA 4A4HA 1UDLA 5DLQE 4JZ4A 4M7DA 3QWYA 4M77C 4AG2C 2F5KA 4OP0A 1VIFA 2EGAA 3PMTA 3G71Q 1M1KU 1Q7YR 4J9FA 2RQRA 2RHXA 4M75B 1G2BA 4E7HA 2BE9B 3M9QA 2VGMA 3M4GA 5J3BA 2YSQA 2DZ9A 1WFWA 2DYBA 1WPYA 1M9SA 3V8JA 3JCMQ 2DA9A 2L0AA 2LJ0A 2NWMA 1X6OA 4QW2A 1SF9A 2E41A 2QG9B 3CXCP 2X51A 2DXUA 2X4JA 1VQKQ 4FYVB 2O4XA 5FU6B 1WDXA 3EH2A 4FSXA 4AFUC 5LJ3f 4A4FA 4FL6A 1YHQT 1T3LA 3BDUA 1X43A 3JB9D 3VS2A 2XD0A 1G8XA 2EJ9A 1PWTA 1M5Q1 1ZSGA 1N8RU 2HAXA 2ROTA 5GAN8 5GAN6 1PC0A 2V8JA 3PIPA 4PJLA 3QYHB 2L8DA 1H92A 3MEAA 2RH2A 4ZN1A 2G6FX 3JRZA 1VQ5Q 3RIRA 1VQNQ 2A08A 2DTHA 1HXDA 1OV3A 3OBWA 4PL6A 1MMGA 3GLXA 1D3BA 3OBYA 1VQ4Q 1FX7A 3HRSA 3DB4A 4BY6C 4AFQC 5CVIA 5C0MA 2DFUA 1RADB 2B8AA 4D6WA 3JCMg 4IUTA 4FM4B 1UHFA 2G3RA 3CC7A 1VQ6A 1Q81R 1YNZA 2JTEA 2A7YA 2RD1A 3RUXA 4NL3A 3JCMP 5IN1A 4HCZA 2NYSA 2BZXA 3MJXA 2EKOA 3SD4A 3PFSA 3EG2A 1V76A 3A5ZB 2LCSA 1B3QA 1KQSA 4J9CA 1BI1A 3G71T 1TUCA 2VXEA 4KRTA 3L2UA 3RKXA 2D9TA 2BTTA 3CXCA 3OMCA 2JM8A 1Z9ZA 3X24B 2LNHB 1YI2T 5FLXE 2DO3A 1YP5A 1B34B 3QXEB 4LD9K 5HK0A 3PVQA 1YFNA 3CCUA 2E10A 3UDCA 1ZUYA 5D6WA 1TTHB 4MZPA 2L89A 1WXTA 5A2QE 2KQWA 2RJDA 4F17A 3SDZA 1WHLA 1U1TA 1SSFA 3M58A 2ZZDA 1SRLA 2ESWA 3MP8A 3VUBA 1TOVA 4M78C 3CPWA 3TCJA 3X28B 4XU1A 3OS1A 5GAMj 2R57A 2ZPHB 3BY7A 4LDUA 1KQ1A 4DA4A 4M77G 3ULRB 4ELYC 4BD3A 2OJ2A 3MHXA 2W0ZA 2J6FA 4D8DA 3G6EQ 1VQ4A 2KGTA 2O9SA 1ZLMA 4XTXA 2EJGA 3HRUA 1VQ7Q 4M7AC 2GQIA 2QQRA 1K73U 5I11A 2J05A 4XTYA 5GANd 5IAYA 4A4GA 2HSPA 3CD6T 3MPUB 1VYUA 1YJ9Q 5FRNA 3RKYA 4JLGA 1FXXA 1UE9A 5GAN4 2DIGA 4J7IA 2JS2A 2HZYA 1RUWA 4NOYA 2HKNA 5AT1B 2L3SA 5FWBA 2DRKA 1WHKA 2FG0A 1K9MR 1VQLQ 1TUDA 2A3LA 2GF7A 2AT1B 1HK9A 1S72Q 2HCKA 4ESRA 1RLQC 3EFOA 2EYXA 2RI2A 2X3WD 3OYMA 2DLPA 4M75F 1C6VX 3EG1A 4RTXA 3OSSC 2VV5A 4J9DA 3TVTA 1RI9A 3I55Q 2EW3A 4KBMB 2LCLA 2QDLA 3M57A 1Y07A 2MAMA 1WXUA 2QTVA 4F7UG 2K4YA 1RL2A 2F2WA 1XTDA 2MWPA 2RK2A 4A53A 1W70A 2EQMA 1Q82R 1VIEA 3JCMc 3H6ZA 4OF1A 2MYSA 2HBWA 1YJ9A 1SSHA 4C92C 1VQMT 4J6XA 4IUPA 1YIJT 2KEAA 2CREA 2DE0X 5GMKi 2A37A 1YI2Q 4C0DC 4MMLA 1VQ5A 2IVWA 1VQNA 1QVGA 1YJ9T 4M75D 1K9AA 2SRCA 5GAOl 4RTVA 1X2QA 1N27A 4JJCA 2HBPA 1JXOA 4B9WA 4LDWA 2QQAA 1VQ8T 2C0IA 4L6V5 2CS7A 3LH5A 2DPPB 1R0BG 1QCFA 4M7DC 3NPFA 3REBB 3GNGA 4QQDA 4C92D 1QWFA 3FEOA 4BUGA 1KD1C 4RTYA 3CCET 3V8LA 5LJ3d 2DXCA 3V7CA 5L23A 4LUDA 1T0JA 3SWNC 2DYIA 3OYEA 1JU5C 2CT4A 2DK3A 3CCEA 4QVCA 3NMZC 2JN0A 5GAMg 1R8OB 2FZGB 2MF2A 4ME7A 3CPWS 3VS1A 3OYCA 1T0HA 3FJ5A 4LD6A 2KY9A 4M7DD 1C0MA 2C06A 2AHJB 3BE3A 2CZ1B 5KYUA 2O31A 1YHQQ 1MHNA 2GTJA 3A1PA 1VYVA 3INZA 3WVEB 1KQSP 1KHCA 1PRMC 3MP6A 4N4HA 4DEYA 5LJ3j 2VXFA 1BI0A 1N9SA 1YJNA 2RA2A 2VASA 3CCVA 2RMOA 1K9MC 2YRCA 4F7UF 2DRMA 3OYIA 1GFDA 3M0TA 4O5VA 3M0PA 3TU4K 4JS5A 1VQMQ 1M2OA 2QGFB 5LJ5e 1UGSB 2RF0A 2P4TA 1X6BA 2K5LA 1VQLA 3H0FA 3G6ET 2K5IA 1N8RR 1MMNA 1SKUB 3QDRB 5L8RE 3CCMA 2AKKA 2RM4A 1N6AA 3OW2S 5A0LA 1H641 2K6DA 4N4GA 3CMEQ 1M8VA 2MOXA 2NUTB 4PFZA 1X27A 4AFSC 3CC2A 2LDMA 3D7SB 2YUNA 2XKOC 3M56A 2LQKA 2OTJQ 1MMAA 4ZTFA 4X1VA 1ZSZB 1Q86R 2HQXA 3JCMd 5DY9A 4YTLA 1BB9A 1W4SA 1IXDA 2DL5A 4BDZA 3A8MB 2FPFA 3CQTA 3EG9B 1ARKA 2YHTA 1NBEB 3C4SA 1YWOA 4XTVA 3OYBA 3L2WA 1VQ6Q 3JB9H 2CP6A 1QCNA 3OS5A 1W2BA 2EQJA 4QT7A 5EG2A 3JCMb 1GCQA 4QVZA 1VQ7T 1WJSA 3E2UA 1YI2A 1V1CA 3EFRA 4JUVA 1MNEA 2DERA 2AZSA 1EZZB 4C92A 4FIBA 2KRSA 3EGXB 9ATCB 2XMFA 1PM3A 2E70A 3GF5A 3RKWA 4EMKB 4LUEA 1ZX6A 4FU6A 1Q86C 4M77E 2HNIA 1UGPB 4EMHA 2VUBA 5KYYB 1MV0B 5GAOn 2A0FB 4LE9A 1BBZA 3GPLA 4FW2A 2FL7A 1LPLA 2F1LA 3GBQA 2CZ6B 4HA8A 2CSIA 3RDVA 1CSKA 2NUPB 3VU3C 3CCVQ 1TS9A 2DEQA 1E6HA 1UJYA 5KE2A 3REAB 1Q86U 1ABQA 4KH0B 4ZTJA 5GJVB 2XDDA 2V8IA 5CCAA 5GAMf 1K73R 5GAN7 2QI2A 4X9DA 3LGFA 2J6KA 3GNFB 2K3YA 3FRNA 1NLPC 4BACA 2ZPBB 4OMPA 1AWOA 2A36A 1JXMA 3EG9A 2XI9A 3M0RA 4L59A 1Q82U 2KR3A 5KYYA 3CC4A 3JB9J 5D7UA 5IT9E 1X6GA 2LC4A 5IHIA 3VRYA 1Q7YC 4ATOA 3MO8A 5GMKe 1UHCA 4PJOC 2OX7A 2V1QA 3H0HA 3BDLA 1K9MU 1Q81U 2CH4W 1TXQA 4EIKA 2QA4Q 2KT1A 3OB9A 3JB9I 3EFSA 1VQ9Q 2A28A 4K11A 2JT4A 4GLKA 3OYFA 2QGGA 1QKWA 3RMSA 1WJQA 3OYJA 2RJEA 1DJ7B 3UA6A 5FU6C 1UGRB 3DLMA 2RPNA 4HXJA 4XQ3A 1QVFS 2XDPA 1IHWA 4BE2A 2C0TA 1O75A 1UGVA 1KQSS 3S3NA 1GBRA 4QQGA 3OA6A 1K0SA 1TU0B 4F14A 4AG1C 1OU9A 4ZNXA 1Y71A 1GFCA 3HSBA 4M78D 3OYNA 3VYHB 3OYDA 3CCRQ 5CKEA 4KULA 1UUEA 2F69A 3PNWC 3I56A 3CCST 3SWNB 1RAEB 2LVMA 1G3WA 4E7LA 3HFNA 4C0DB 1AZGB 2HL5C 4CC2A 2E6ZA 5IHNA 4IKFA 1KFZA 1MMDA 3BW1A 1NEGA 4GLMA 2F2VA 1D1AA 1UTIA 2CP3A 1YITQ 1W6XA 3O5ZA 4A63B 5GAN5 1JBMA 3HL8A 2B86A 3M54A 5HY6A 3J7AF 4C0FA 1BK2A 1NJIU 2WSFE 3CD6Q 3L42A 4TVRA 3JV3A 2RHIA 4KGZB 2GNCA 4XTZA 2KBTA 1ZQ1A 2JMAA 3QIIA 1AHJB 2DM1A 5HCKA 2RQWA 2FB7A 2K3BA 1BU1A 1K8AU 4CRIA 2DNUA 1KQ2A 2X4YA 3M4YA 3PTAA 1SEMA 3ZL7C 4A4EA 3M5AA 1UG1A 1Y96B 2GQVA 4HCCA 3I55T 3L2ZA 2CUDA 3M53A 4FYXB 1IREB 4M7DF 2CT3A 5KYXB 3VV0A 2MCNA 2LTOA 2EGCA 3THKA 2RQUA 3JCMf 2DBKA 4WF2A 4BE1A 3CC7Q 2DZCA 4C8QB 3PGGA 4E7KA 4DBHA 4EMKA 1Q82C 6AT1B 3OS0A 2RQVA 4JPBW 3QZ5B 2YDLA 3CCLT 3NFCA 4C92F 1WA7A 4PJOB 1YN8A 2PNIA 3CCRA 4KH1B 2D0QB 1M8MA 1NYGA 4J83A 1ZA1B 3JCMe 3VS0A 4MDWA 1X01A 1YCYA 3QZ9B 3RERA 4AT1B 4C0ZA 2L3RA 2CZ0B 1U5SA 2VKNA 3I5RA 1TG0A 3IQLA 3FDRA 1K8AR 3EHQA 1E6GA 3L2VA 2LP5A 4A4KA 1Y7XA 4QVDA 1JEGA 3LLRA 1Q95G 2DL8A 2LNVA 3MP1A 4E7JA 4F7UE 5CQYA 2DVEA 2MIOA 1ZSZA 1K76A 4Y92A 1JB0E 3CCUT 2FYKA 2ZPEB 4HVWA 4WTOB 1XQHA 1M1KR 2BE7D 3HPWA 1K4US 4M75A 3F70A 1UECA 2COYA 2JMCA 4J9IA 5GANf 4HCKA 1EFNA 3G71A 5GAOm 4EMGA 2AKLA 8ATCB 3CC4Q 2V1RA 2DAQA 1YBYA 2XIDA 1SHFA 1XNIA 2FRYA 2Y4XA 1VQKA 1YJWA 2KRNA 3QJ6A 2EFIA 5FU7C 2E65A 2E6NA 5IHKA 1N9RA 4M7AF 1Y0MA 3EGDB 5LJ3h 1M3AA 3AT1B 1MUZA 2OTLA 2L5QA 4KGXB 4LN2A 1WNLA 2P84A 5FWCA 2AK5A 2NUPA 1HD3A 3RBBB 1NM7A 1KG1A 3PE0A 1G5VA 1WHJA 4IURA 4FCYA 4DBRA 3S3OA 1JJ2A 5DLOA 2QTXA 1YJWQ 2OAUA 4RTUA 1M2VB 4ZGJB 2DETA 4IIMA 3RR6A 3CCQA 1I5OB 1K8AC 4RUGA 2RN8A 4E7ZA 2YUOA 4A54A 4XTUA 1KIKA 2RO0A 3EG0A 2ROLA 2YLCA 1D3BB 1M1GA 1PD0A 4RCBA 4C92B 5LJ5g 2PVGB 3M0QA 1CKBA 4F7UA 1ZUUA 3DB3A 1LJOA 3QG1A 4PJOD 3EFOB 3A8LB 2RHZA 2O9VA 3UF4A 4HT8A 2COZA 1OPLA 2ECZA 2EQIA 3UATA 2ENMA 4PK4A 1I8FA 1PKTA 3CPFA 4BDYA 5GAOp 3TSWA 2DILA 3VS4A 1VUBA 4FYWB 1PSFA 1W2BP 1B7TA 4C0GA 4EPCA 3QWXX 5CQXA 1JO8A 4OMFB 4J9GA 5A0GA 3CXCS 2MK5A 2LZ6B 3NGPA 1BIBA 2JVVA 2K9GA 4M7AG 1NZ9A 1R0CB 3URGA 1NPPA 3EGUA 3KUFA 1YJWT 4PLLA 2QA4T 3JAME 3L2RA 3CCJQ 2DVJA 4B6MA 1N8RC 4J9HA 5ECAA 3LGLA 3CC2Q 1B34A 1AWXA 1K73C 5LJ5f 2KAFA 4LDYA 2BKDN 3E1SA 1W1FA 3JCMh 4JZ3A 1WX6A 2DX1A 3CCLA 4J9EA 1AWJA 2DMOA 4RG8A 2HEQA 1TWBA 1K0XA 1D09B 5DM7R 2GFAA 5CO7A 3GP8A 1NLOC 1FWZA 1ZBJA 4PNOA 1KC8R 2ED1A 4DOWA 4B9XA 2ED0A 4Z8AA 3OW2A 3CCVT 2CYZB 4DBQA 1SRMA 4Y91A 1YJNT 2J6OA 4N4IA 1YJNQ 4NS5A 2LMJA 3S6WA 3OYHA 4MZTA 4BI3A 2QQBA 1PKSA 2K3XA 4PFOA 1VQPA 3VRZA 3I55A 3QHSA 2QEXQ 2IPOB 4M75G 4JJNK 4FW1A 2FPEA 5GAN3 1M27C 2H8HA 2FVUA 1VQ9T 4MDXA 3QBYA 2EYZA 5LL6S 3FJPA 2DL4A 3S3MA 3EGDA 4M7AA 1MGQA 1PD1A 1ZHIA 5CK9A 4PJOE 4RTTA 2EPDA 4JRPA 1W2BS 1SG5A 4XU0A 3JCMV 2HD0A 1QVFP 1GL5A 1U1SA 1D0ZA 5HK3A 1I5LA 2K5FA 4CI0C 3G4SA 3A8GB 4KGVB 1KD1R 1WI7A 3V8KA 2DL3A 3H41A 3LW5E 3SEMA 2CP2A 3C94A 5M9OA 4II1A 1NG2A 2RQTA 1I81A 2X4XA 3L1AA 5EC7A 4M7DG 1BCOA 1QP2A 4DOVA 1VQOQ 8AT1B 4C5GA 4IUQA 3CMEA 4Q5WA 2PQWA 2OTJT 2QASA 2I0NA 4BY6B 4ANJA 1N5ZA 5GAMe 1UJ0A 1G3TA 4C8QA 1LNXA 1KD1U 2XG8D 4CC7A 2JW4A 3HKSA 4LDXA 1VA7A 2LT4A 3QJYA 4RCCA 1OULA 3FLGA 3KFVA 1VQMA 4OMLA 4C92G 2X35A 2DXBA 1D0YA 3ASKA 2DD4A 2Y4YA 1M1KC 1IGUA 1OYXA 1WGSA 1WJRA 1PRLC 2J7IA 4F04B 3HP9A 1NYFA 2Y90A 3QYGB 1VQ8Q 2ATCB 2EKHA 3N5BB 4M78B 2EQKA 2RK1A 4XU2A 4VUBA 2DKGA 2H3JA 1C1AA 2KE9A 2X4WA 1OZ2A 4MMKA 1Q81C 3OMGA 1ZSZC 4D8KA 1YCSB 2KXCA 3Q1JA 1JJ2P 1WXBA 5GAN2 5CKFA 4M7AB 2LJ3A 4J9BA 5CIUA 4M75C 1IHVA 1VQ7A 2F5TX 2D6FA 3I5SA 2CZ7B 2HDAA 4Z88A 4MZMA 3QUIA 1WQ7A 4OGEA 1GRIA 4FYYB 1Y96A 4RMOA 2XK0A 2ZGWA 4OMMA 3OYGA 1BI2A 3SWNA 3JSCA 4R55A 5I2SA 1M90R 2IIMA 1TSFA 3H0IA 2EAYA 4JJBA 1VQOA 2ZPGB 4M77B 3VS5A 3PIOA 3M55A 2KROA 4XU3A 4OMQA 2D0NA 1XJWB 1KC8C 2H3EB 2KDSA 1UEBA 4OVAA 3ZEHA 1SPKA 4RTZA 3FIFA 4JRQA 3NTIA 1PHTA 3G6EA 1VQLT 2D8JA 1H8KA 2KXDA 3JB9F 3M0SA 2BUDA 1T3SA 1X75C 1AVZC 2QAZA 2VGNA 2LJ1A 5CKBA 2P0KA 5KYUB 2PUKB 1M2VA 4WCIA 2QQSA 4J6YA 2QYZA 1D1CA 2DBMA 4M78E 2JOYA 5KCOA 3VJPA 2PUOB 1JRIA 3T9NA 1ABOA 4BB7A 3BFMA 1VQOT 3VKIA 4BI4A 2KYBA 4GBQA 1K1ZA 4JS4A 2QDYB 1I0CA 1WHMA 2LQWA 1O9SA 3MKDA 4HCBA 2DXTA 1VQPQ 2CGHA 1PNJA 2VB6A 4M77D 3G1JA 1AEYA 1MNDA 1VOMA 2RI3A 4KUDK 3R6OA 4HT9A 2JJ9A 4M4ZA 2K2VA 2YT6A 1GXIE 1QMCA 2E5QA 1XOVA 2EWNA 4OB3B 3H8ZA 5LJ5d 2XDBA 2PVDB 1M3BA 4OB1B 4E7SA 2DF6A 3META 2XU8A 2YXYA 2KYMA 1OX9A 1ZBXA 3LWIA 3FB9A 2CSQA 2MI6A 4OMNA 5LJ3g 1H3HA 4CC4B 3LX7A 3TSZA 5KE3A 1OEBA 3CCEQ 2FRWA 1IGQA 1NEBA 3V7RA 2LT1A 1VQ8A 4C8QG 5KH6A 1IRXA 2OAWA 4AFZC 2JTMA 3QDFA 3VYGA 4KT0E 1A0NB 4O6JA 5CR2A 4N0AA 1RLPC 2JZ2A 2R58A 1TUGB 4E7IA 2GTOA 3X25B 1WHGA 4C8QF 4RKUE 1U8RA 2NUZA 2FO0A 2JUFA 4LNPA 4C5EA 2NLUA 1JJ2S 3CC2T 2KRMA 2ZPIB 3PVLA 1PCXA 3HFOA 5LJ5j 4R0KA 2VVKA 3J81E 3HHTB 1M90C 1UFFA 2LX7A 1M30A 3HTRA 2K7AA 3CCMT 1FMKA 5A0DA 3M59A 3E9FA 2P0QA 2E5KA 5GANe 2Z0WA 3I56Q 4PJNA 3CMAT 4PLIA 4M77A 7AT1B 2CP0A 2MWOA
chains in the Genus database with same CATH topology
3G6ET 2K5IA 5LJ3e 3C12A 3TREA 3DB3A 1LJOA 3NTKA 3QG1A 4PJOD 3A8HB 3QDRB 4J8OA 5L8RE 3CCMA 3ME9A 4PJOG 2RM4A 1N6AA 2RHZA 1QW1A 3A8LB 2QEXA 3OW2S 4HT8A 5A0LA 1S72T 4RG2A 1IZ6A 2PU9B 1OI1A 1H641 1QVPA 4N4GA 1M8VA 3PT9A 3KBGA 3O8VA 3CC2A 1RI0A 3LH0A 2LDMA 1I8FA 3CC4T 2M1HA 3CPFA 4HKEA 3LWHA 2XKOC 3M56A 2LQKA 4BDYA 3JCMX 1V29B 5GAOp 5GANj 4ZTFA 1BIAA 1VQLA 3EAEA 2YLBA 4M7DB 1VUBA 3GOXA 2GCXA 2HQXA 3JCMd 3OYYA 5DLQE 4A4HA 1PSFA 2EJFA 5DY9A 4M7DA 4YTLA 4C0GA 4EPCA 2XICA 4M77C 1W4SA 5CQXA 2F5KA 4OMFB 1VIFA 3PMTA 4OP0A 4BDZA 1M1KU 3A8MB 5A0GA 4GY5A 3CXCS 4OGCA 2YHTA 1BIBA 2RHXA 4M75B 4JDSA 4E7HA 2JVVA 3C4SA 1VQ9A 4M7AG 1NZ9A 4XTVA 3M9QA 4M7DE 2LQ8A 3URGA 1NPPA 3KUFA 2VGMA 3M4GA 4NL2A 3OYBA 3L2WA 5J3BA 4M7AD 3JB9H 2DD5A 3OS5A 1W2BA 2EQJA 2V8KA 1YJWT 4PLLA 2DZ9A 5EG2A 3JCMb 3JAME 3L2RA 2QA4T 1VQPT 4QVZA 1VQ7T 1WPYA 1M9SA 3V8JA 3JCMQ 1WJSA 1N8RC 3LGLA 1X6OA 4QW2A 2E41A 2EYQA 1YI2A 1YIJA 2DXUA 3EFRA 2X4JA 4JUVA 1B34A 3X20B 5GAMd 5LJ5h 1K73C 5LJ5f 2KAFA 4LDYA 2O4XA 2BKDN 4C92A 2KMTA 4ELZC 3E1SA 3KXTA 5FU6B 3G4ST 4FIBA 3JCMh 4FSXA 5LJ3f 4F7UB 5GAOr 4A4FA 4FL6A 1YHQT 2E70A 3BDUA 4OB2B 3GF5A 3RKWA 3JB9D 4EMKB 2VYTA 3CCLA 2XD0A 4C92E 2EJ9A 3CMAA 4FU6A 1Q86C 1M5Q1 2HNIA 1UGPB 4M77E 2K57A 2VUBA 4RG8A 4EMHA 5GAOn 1N8RU 2HAXA 5GAN8 4M7AE 5GAN6 1G3SA 2V8JA 3PIPA 2LCCA 3QYHB 3GPLA 2L8DA 2DIQA 2FL7A 2GFAA 5CO7A 5DM7R 4JLIA 2CZ6B 5FRMA 2KSSA 4HA8A 3GP8A 1FWZA 4PNOA 3MEAA 2RH2A 4ZN1A 5D6YA 4DOWA 3QKJA 4B9XA 4JRIA 3JRZA 3VU3C 3OW2A 3CCVT 3RIRA 2CYZB 2DTHA 1HXDA 3OBWA 4PL6A 3QSUA 4Y91A 1YJNT 1VQ5T 3GLXA 1D3BA 3OBYA 5D6XA 1FX7A 1VQNT 2DEQA 2E1HA 3HRSA 3DB4A 4N4IA 4BY6C 4NS5A 5CVIA 3S6WA 2E64A 5C0MA 4R56A 4MZTA 3OYHA 3UPUA 5KE2A 1Q86U 2B8AA 4BI3A 2QQBA 4D6WA 2K3XA 1P92A 3CBPA 2PVOB 4XTWA 3JCMg 4ZTJA 1VQPA 3UWNA 2XDDA 4IUTA 2V8IA 5CCAA 3I55A 3QHSA 4FM4B 5GAMf 2G3RA 4M75G 1EIFA 3CC7A 4JJNK 3JCMJ 5GAN3 5GAN7 2QI2A 1VQ6A 4X9DA 2FHDA 3LGFA 2FVUA 1VQ9T 4MDXA 3QBYA 2E12A 5LL6S 3L2QA 3FJPA 2ZPFB 3GNFB 2A7YA 2K3YA 2RD1A 2R5AA 3FRNA 1QVFA 3RUXA 3S3MA 4NL3A 2OTJA 3JCMP 3CMET 4M7AA 5IN1A 1MGQA 4HCZA 4JRKA 4BACA 2ZPBB 1ZHIA 2EQUA 4FT2A 5CK9A 4PJOE 2XI9A 4JRPA 2RB6A 2EKOA 4L59A 3SD4A 3OYLA 2O4XB 1W2BS 3PFSA 4XU0A 1Q82U 3JCMV 2HD0A 3CC4A 3JB9J 4XK8E 4EDUA 1U1SA 5IT9E 3A5ZB 2LC4A 5KCHA 5HK3A 1Q7YC 2LX9A 2M9UA 1I5LA 2K5FA 4ATOA 1KQSA 1BI1A 2R5MA 3G71T 2VXEA 4CI0C 4C5HA 5GMKh 3G4SA 3A8GB 2MMPA 3MO8A 4E47A 3L2UA 5GMKe 4PJOC 3RKXA 2D9TA 3CXCA 3OMCA 3X24B 3V8KA 3BDLA 1YI2T 5FLXE 1Q81U 1M90U 1K9MU 2DO3A 4M75E 3ZBDA 1B34B 3QXEB 3LW5E 5J39A 4LD9K 5HK0A 3MEVA 3C94A 3OB9A 5M9OA 3JB9I 4II1A 2WSEE 3EFSA 2QA4A 1I81A 3CCUA 2X4XA 3L1AA 2E10A 3UDCA 4M7DG 3V7SA 1QP2A 4GLKA 4DOVA 3VUZA 5D6WA 3OYFA 3C95A 4MZPA 2L89A 4C5GA 4IUQA 5A2QE 4Q5WA 2PQWA 2QXFA 3RMSA 3CMEA 2KQWA 2RJDA 2OTJT 4L5GA 3SDZA 4BY6B 1U1TA 1WJQA 1SSFA 2JNGA 2RJEA 3M58A 2ZZDA 5CKHA 3OYJA 1DJ7B 1VQ6T 3P8DA 5GAMe 5I21A 5FU6C 3MP8A 1Q7YU 1UGRB 3VUBA 1G3TA 3DLMA 4C8QA 3FC3A 1BYMA 1LNXA 1YITT 4XQ3A 4M78C 1QVFS 2XDPA 1KD1U 4BE2A 2XG8D 3NTHA 3CPWA 1O75A 2WACA 3HKSA 3TCJA 4LDXA 3CD6A 3QJYA 2LT4A 4RCCA 3S3NA 1KQSS 4QQGA 3OA6A 3X28B 3FLGA 4XU1A 5GANh 3OS1A 1VQMA 1NJIC 3OYAA 3AHUA 5GAMj 2R57A 1Y71A 2ZPHB 3SFMA 3HSBA 4M78D 4C92G 3OYNA 2X35A 3BY7A 2DXBA 2I2LA 1KQ1A 4LDUA 4M77G 3RMQA 3VYHB 3OYDA 5CKEA 4DA4A 4KULA 2CKKA 2VC8A 2F69A 3PNWC 3ASKA 2DD4A 4P5NA 4ELYC 2Y4YA 3I56A 3SWNB 3CCST 1M1KC 1OYXA 3J80E 1WGSA 1WJRA 2LVMA 1G3WA 2DJZA 4BD3A 1VQ4T 1PSEA 3HP9A 4E7LA 3HFNA 3MHXA 3OS2A 2Y90A 4C0DB 3QYGB 2E6ZA 3N5BB 3CBOA 4M78B 1VQKT 2EQKA 4C8QC 2RK1A 4XU2A 4IKFA 4VUBA 3OQ5A 1VQ4A 1G5VA 2XHCA 5GMKj 2DKGA 2H3JA 3BW1A 2X4WA 1OZ2A 4MMKA 4XTXA 3X26B 1Q81C 2EJGA 3HRUA 5J26A 3OMGA 4DQ2A 2KK4A 4M7AC 2QQRA 3CCQT 1K73U 5GAN5 1JBMA 3HL8A 3M54A 5HY6A 3J7AF 4XTYA 2LRQA 3Q1JA 4C0FA 1NJIU 5GANd 5GAN2 5IAYA 4A4GA 2WSFE 2ZCFB 5CKFA 4ZN3A 4M7AB 3L42A 4TVRA 5GMKl 3CD6T 5CIUA 2WSCE 2DTOA 3WXMB 4M75C 1VQ7A 2F5TX 5FRNA 2RHIA 3RESA 3RKYA 1NPRA 2D6FA 3GIBA 4JLGA 4XTZA 1QVGS 2CZ7B 4QQ6A 1ZQ1A 1FXXA 5GAN4 3QIIA 1AHJB 2OTLT 2DIGA 4MZMA 3QUIA 1WQ7A 2FB7A 4OGEA 3WVDB 4PJOA 4J7IA 1K8AU 2KVQG 4CRIA 1TH7A 3OY9A 1KQ2A 2X4YA 4PJOF 3M4YA 3PTAA 1Y96A 4RMOA 4NOYA 2XK0A 4A4EA 3M5AA 1Y96B 2GQVA 2ZGWA 5GANg 4X34A 4C8QE 5GAOq 4HCCA 3OYGA 1BI2A 3CC7T 3QO3A 3SWNA 3JSCA 4R55A 5I2SA 3I55T 4X9CA 3L2ZA 3M53A 4M7DF 1IREB 5GAMh 4J6WA 3VV0A 4KUIA 2A3LA 2GF7A 1HK9A 4OB0B 2LTOA 2EAYA 1VQOA 4Y28E 3HRTA 2ZPGB 4M77B 4IUVA 4V2SA 3JCMf 3PIOA 2EIFA 3M55A 4PKCC 2RI2A 4XU3A 3OYMA 4M75F 1KC8C 2KDSA 4XAXB 1UEBA 4OVAA 3ZEHA 4WF2A 3OSSC 2O01E 2VV5A 4BE1A 2DZCA 3SB2A 3FIFA 4C5IA 1H3ZA 4C8QB 3CCRT 3PGGA 1M4ZA 4JRQA 5CKDA 3NTIA 4KBMB 3G6EA 1VQLT 2LCLA 3M57A 4E7KA 3JB9F 1Y07A 2MAMA 2BUDA 4EMKA 1Q82C 1X75C 3OS0A 2RJFA 4J5YA 2VGNA 3QZ5B 3CCLT 3NFCA 5CKBA 2P0KA 4C92F 2K4YA 4F7UG 1RL2A 2MWPA 1XTDA 2IG0A 2RK2A 4A53A 3DLLA 4PJOB 2EQMA 1WQWA 1VIEA 3CCRA 2D0QB 2PUKB 3JCMc 3JCMe 4J83A 3H6ZA 4MDWA 2QQSA 1X01A 1YCYA 4J6YA 4FT4A 4M78E 1G3YA 2HQEA 2JOYA 2P0PA 3QZ9B 4OF1A 5KCOA 3RERA 3VJPA 2PUOB 4C0ZA 1YJ9A 4C92C 1JRIA 1VQMT 4J6XA 4IUPA 3T9NA 2L3RA 2CZ0B 4BB7A 1YIJT 4M78F 4C8QD 3BFMA 5C6SA 1VQOT 5GMKi 2RHYA 3VKIA 2JTFA 4BI4A 4C0DC 4JS4A 2QDYB 3FDRA 4BE0A 3P8HA 4MMLA 1VQ5A 1O9SA 2IVWA 3MEWA 1QVGA 1YITA 1VQNA 1YJ9T 4HCBA 2DXTA 2RHUA 2CGHA 3L2VA 4A4KA 4M75D 3MEUA 1M1FA 4M77D 3OYKA 1Y7XA 4QVDA 5GAOl 3JCMW 4BI8B 3LLRA 5GMKm 3CBMA 2LNVA 2RI3A 4KUDK 4HT9A 3R6OA 3UT1A 3CCJT 1N27A 3MP1A 4E7JA 4F7UE 5CQYA 1NE8A 2K2VA 2DVEA 2M0OA 1KC8U 1GXIE 2HBPA 4B9WA 4LDWA 2E5QA 2QQAA 1VQ8T 4L6V5 1JB0E 1XOVA 2CS7A 3E19A 2EWNA 3CCUT 2DPPB 3QPHA 2FYKA 2ZPEB 4OB3B 3H8ZA 1BKBA 4M7DC 5LJ5d 1XQHA 2XDBA 3GNGA 4M78G 4QQDA 1KHIA 4C92D 5CAIA 2DTIA 3FEOA 3HPWA 4BUGA 1KD1C 3CCET 4M75A 3F70A 3V8LA 5LJ3d 2PVDB 4OB1B 1YHQA 2DXCA 2BIVA 2GFUA 3V7CA 3META 2XU8A 4F7UA 3A8OB 5GANf 1ZBXA 3SWNC 3FB9A 3LWIA 3G71A 1S72A 2MI6A 5GAOm 4EMGA 1QP3A 3OYEA 5LJ3g 5AYFA 2DAQA 5HKCA 1YBYA 2DK3A 4Z02A 2XIDA 3CCEA 4QVCA 3DKMA 1XNIA 3LX7A 2JN0A 5GAMg 1R8OB 5KE3A 2Y4XA 1VQKA 3PMIA 5FU7B 2MF2A 1YJWA 4ME7A 3V7RA 2LT1A 3CPWS 3OYCA 1VQ8A 3LYIA 4C8QG 1BI3A 3QJ6A 5KH6A 4LD6A 2KY9A 4M7DD 2EFIA 2JTMA 4M77F 5FU7C 3CCJA 3VYGA 3I56T 2E65A 3CCSA 2C06A 2AHJB 4KT0E 2E6NA 4O6JA 5CR2A 4N0AA 1N9RA 4M7AF 2JZ2A 2R58A 2CZ1B 5LJ3h 4LDVA 1LOJA 1MHNA 4E7IA 2OTLA 2L5QA 4EMKC 2YRVA 3MCAB 1UGQB 3G7ZA 3INZA 3TEEA 3WVEB 1WNLA 1KHCA 3X25B 3CEYA 3MP6A 4N4HA 4C8QF 4RKUE 3E9GA 1U8RA 4ZGEB 1KG1A 1OZ3A 2JUFA 4IUUA 5I2MA 4C5EA 2NLUA 2RJCA 5LJ3j 1JJ2S 4UC4A 3ZFJA 3CC2T 4IURA 3P8BB 2ZPIB 2VXFA 3HFOA 3ER0A 1BI0A 3S3OA 1JJ2A 2RI5A 1N9SA 5LJ5j 5DLOA 1YJNA 2QTXA 2RA2A 2OAUA 3J81E 3CCVA 4ZGJB 5FROA 3HHTB 1M90C 1K9MC 3CCQA 4F7UF 1K8AC 2QEXT 3OSVA 3OYIA 4A54A 3CCMT 5A0DA 4XTUA 2M16A 2RO0A 4ZGDB 4N0AC 1I4K1 4O5VA 3JB9G 3TU4K 2YLCA 3M59A 4JS5A 1D3BB 1M1GA 2P0QA 2QQ9A 3E9FA 4RCBA 4C92B 5GANe 5LJ5g 5LJ5e 3CMAT 1UGSB 4PLIA 2PVGB 4M77A 2P4TA 4J7FA 1UB4A 2K5LA 4M78A 2MWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E T;  3TRE A;  3DB3 A;  3NTK A;  3CCM A;  3ME9 A;  2QEX A;  2RHZ A;  3OW2 S;  1S72 T;  4RG2 A;  1IZ6 A;  1OI1 A;  4N4G A;  3KBG A;  3O8V A;  3CC2 A;  1RI0 A;  3LH0 A;  2LDM A;  3CC4 T;  3CPF A;  2M1H A;  4BDY A;  4ZTF A;  3EAE A;  3GOX A;  2HQX A;  3OYY A;  5DLQ E;  4A4H A;  4YTL A;  2F5K A;  3PMT A;  4BDZ A;  1M1K U;  4GY5 A;  3CXC S;  2RHX A;  4E7H A;  2JVV A;  3C4S A;  1VQ9 A;  1NZ9 A;  3M9Q A;  2LQ8 A;  1NPP A;  3KUF A;  3OYB A;  3L2W A;  5J3B A;  1W2B A;  2EQJ A;  1YJW T;  4PLL A;  2QA4 T;  3JAM E;  1VQP T;  3L2R A;  4QVZ A;  1VQ7 T;  1N8R C;  1WJS A;  3LGL A;  1X6O A;  4QW2 A;  1YI2 A;  1YIJ A;  1K73 C;  2O4X A;  2BKD N;  3G4S T;  4A4F A;  4FL6 A;  1YHQ T;  2E70 A;  2VYT A;  3CCL A;  3CMA A;  4FU6 A;  1Q86 C;  1N8R U;  3PIP A;  2LCC A;  5DM7 R;  2DIQ A;  2GFA A;  2L8D A;  5FRM A;  3MEA A;  4ZN1 A;  5D6Y A;  3QKJ A;  4B9X A;  3OW2 A;  3CCV T;  4PL6 A;  1YJN T;  1VQ5 T;  1VQN T;  5D6X A;  3DB4 A;  4N4I A;  4NS5 A;  5C0M A;  3S6W A;  3OYH A;  5KE2 A;  1Q86 U;  2B8A A;  2K3X A;  4ZTJ A;  1VQP A;  3UWN A;  4IUT A;  3I55 A;  2G3R A;  1EIF A;  3CC7 A;  1VQ6 A;  2FHD A;  3LGF A;  1VQ9 T;  3QBY A;  5LL6 S;  3L2Q A;  2K3Y A;  2R5A A;  1QVF A;  2OTJ A;  3S3M A;  3CME T;  5IN1 A;  4HCZ A;  4BAC A;  2EQU A;  2EKO A;  4L59 A;  3SD4 A;  3OYL A;  1W2B S;  2O4X B;  3PFS A;  1Q82 U;  3CC4 A;  4EDU A;  5IT9 E;  3A5Z B;  5KCH A;  1Q7Y C;  1KQS A;  3G71 T;  2R5M A;  3G4S A;  4C5H A;  3MO8 A;  3L2U A;  2D9T A;  3CXC A;  3OMC A;  3BDL A;  1YI2 T;  1M90 U;  5FLX E;  1Q81 U;  1K9M U;  2DO3 A;  5J39 A;  3MEV A;  3OB9 A;  5M9O A;  4II1 A;  2QA4 A;  3CCU A;  2X4X A;  5D6W A;  3OYF A;  2L89 A;  4C5G A;  3CME A;  5A2Q E;  4IUQ A;  2PQW A;  4Q5W A;  2OTJ T;  2RJD A;  1WJQ A;  1SSF A;  2JNG A;  2RJE A;  3OYJ A;  1VQ6 T;  3P8D A;  3MP8 A;  1Q7Y U;  3FC3 A;  3DLM A;  1YIT T;  1QVF S;  2XDP A;  1KD1 U;  4BE2 A;  3NTH A;  3CPW A;  2WAC A;  3HKS A;  3CD6 A;  1KQS S;  3S3N A;  4QQG A;  3OA6 A;  3FLG A;  1VQM A;  1NJI C;  3OS1 A;  3OYA A;  2R57 A;  3OYN A;  2X35 A;  3OYD A;  2CKK A;  3PNW C;  3ASK A;  3I56 A;  3CCS T;  1M1K C;  3J80 E;  1OYX A;  1WGS A;  1WJR A;  2LVM A;  4BD3 A;  1VQ4 T;  4E7L A;  3OS2 A;  2E6Z A;  1VQK T;  2EQK A;  4IKF A;  3OQ5 A;  1VQ4 A;  2XHC A;  2X4W A;  1OZ2 A;  1Q81 C;  5J26 A;  3OMG A;  1K73 U;  3CCQ T;  2QQR A;  5HY6 A;  3J7A F;  2LRQ A;  3Q1J A;  1NJI U;  5IAY A;  4A4G A;  4ZN3 A;  3L42 A;  4TVR A;  3CD6 T;  5CIU A;  1VQ7 A;  5FRN A;  2RHI A;  1NPR A;  1QVG S;  4QQ6 A;  3QII A;  2OTL T;  2DIG A;  1K8A U;  2KVQ G;  4CRI A;  3OY9 A;  2X4Y A;  2XK0 A;  4A4E A;  4X34 A;  3OYG A;  3CC7 T;  3I55 T;  2GF7 A;  2LTO A;  1VQO A;  4IUV A;  3PIO A;  2EIF A;  2RI2 A;  3OYM A;  1KC8 C;  2KDS A;  1UEB A;  4OVA A;  3ZEH A;  4BE1 A;  4C5I A;  1H3Z A;  3CCR T;  3G6E A;  3NTI A;  1VQL T;  2LCL A;  4E7K A;  2BUD A;  1Q82 C;  3OS0 A;  2RJF A;  3CCL T;  2P0K A;  1RL2 A;  2MWP A;  1XTD A;  2IG0 A;  3DLL A;  2EQM A;  3CCR A;  3H6Z A;  2QQS A;  2HQE A;  2JOY A;  5KCO A;  1YJ9 A;  1VQM T;  1YIJ T;  4IUP A;  2L3R A;  5C6S A;  1VQO T;  2RHY A;  2JTF A;  4BE0 A;  3FDR A;  3P8H A;  1VQ5 A;  1VQN A;  3MEW A;  1QVG A;  1YIT A;  1YJ9 T;  2RHU A;  3L2V A;  3MEU A;  3OYK A;  3LLR A;  2RI3 A;  3CCJ T;  3UT1 A;  1N27 A;  3MP1 A;  4E7J A;  1KC8 U;  2M0O A;  4B9W A;  2E5Q A;  1VQ8 T;  3CCU T;  3H8Z A;  1BKB A;  4QQD A;  1KHI A;  3FEO A;  1KD1 C;  3CCE T;  3F70 A;  1YHQ A;  2BIV A;  2GFU A;  3MET A;  3G71 A;  1S72 A;  2MI6 A;  3OYE A;  2DAQ A;  1YBY A;  4Z02 A;  3CCE A;  1XNI A;  3LX7 A;  5KE3 A;  1VQK A;  3PMI A;  1YJW A;  3CPW S;  1VQ8 A;  3OYC A;  3LYI A;  3QJ6 A;  5KH6 A;  4LD6 A;  2EFI A;  3CCJ A;  3I56 T;  3CCS A;  2E6N A;  2JZ2 A;  2R58 A;  4E7I A;  2OTL A;  1MHN A;  2YRV A;  1KHC A;  3CEY A;  3MP6 A;  4N4H A;  3E9G A;  1OZ3 A;  2JUF A;  4IUU A;  4C5E A;  1G5V A;  1JJ2 S;  2NLU A;  2RJC A;  3CC2 T;  4UC4 A;  4IUR A;  3P8B B;  3ER0 A;  3S3O A;  1JJ2 A;  2RI5 A;  1YJN A;  3J81 E;  3CCV A;  5FRO A;  1M90 C;  1K9M C;  3CCQ A;  1K8A C;  2QEX T;  3OYI A;  3CCM T;  2M16 A;  2RO0 A;  1M1G A;  3E9F A;  3CMA T;  4PLI A;  2MWO A;  1VQL A; 
#chains in the Genus database with same CATH topology
 5LJ3 e;  3TRE A;  3A8H B;  3VS6 A;  4PJO G;  1R77 A;  1QW1 A;  1FYN A;  1IZ6 A;  3EGX A;  2AZV A;  1SHG A;  3PT9 A;  3KBG A;  1RI0 A;  5KYW B;  2DL7 A;  2M1H A;  5GAN j;  4DBF A;  4M7D B;  2GCX A;  3OYY A;  2EJF A;  2XIC A;  1KSW A;  1CKA A;  1GCP A;  4GY5 A;  4OGC A;  3CCU Q;  3CPW P;  4JDS A;  2M51 A;  1VQ9 A;  4M7D E;  2LQ8 A;  4M7A D;  4NL2 A;  2DD5 A;  2V8K A;  1VQP T;  5GJW B;  3EG3 A;  2HMA A;  1JQQ A;  2QK0 A;  2EYQ A;  1YIJ A;  3X20 B;  5GAM d;  5LJ5 h;  4ELZ C;  3KXT A;  2KMT A;  3G4S T;  2CUB A;  4F7U B;  5GAO r;  4OB2 B;  1G83 A;  2VYT A;  4C92 E;  2O88 A;  3CMA A;  3CCS Q;  2K57 A;  4HVU A;  1I1J A;  1OOT A;  1G3S A;  4M7A E;  2M0Y A;  2LCC A;  3CCL Q;  2DIQ A;  5FRM A;  4JLI A;  3SHW A;  2KSS A;  4F16 A;  1RAA B;  5D6Y A;  1U3O A;  3QKJ A;  4Z89 A;  4JRI A;  2D1X A;  3QSU A;  1VQ5 T;  5D6X A;  1VQN T;  2E1H A;  1FMV A;  2E64 A;  4R56 A;  3UPU A;  1WZO A;  2ZAE A;  2KI7 A;  2J06 A;  1Z9Q A;  1P92 A;  1OPK A;  3CBP A;  2PVO B;  4XTW A;  2BZY A;  3UWN A;  1EIF A;  3JCM J;  2FHD A;  2F2X A;  2E12 A;  1RAH B;  3L2Q A;  2BZ8 A;  2ZPF B;  2R5A A;  1QVF A;  2OTJ A;  1ZA2 B;  3CME T;  2KNB B;  2GGR A;  4OMO A;  4JRK A;  2EQU A;  4FT2 A;  2K79 A;  4E2F B;  2HQH A;  2RB6 A;  3VS7 A;  1LCK A;  2O4X B;  1WYX A;  3OYL A;  2EBP A;  4XK8 E;  4EDU A;  1AZE A;  5KCH A;  2LX9 A;  2M9U A;  5KYX A;  2R5M A;  4C5H A;  5GMK h;  3OW2 P;  2MMP A;  1AOJ A;  2RNA A;  4E47 A;  1EX4 A;  1QKX A;  1M90 U;  2EYY A;  4M75 E;  3ZBD A;  2GBQ A;  5J39 A;  1IB8 A;  3MEV A;  2L3Q A;  2OTL Q;  2WSE E;  2AIR B;  2QA4 A;  1PG5 B;  2E3H A;  2CH4 A;  3V7S A;  3VUZ A;  3C95 A;  1J3T A;  2QXF A;  4L5G A;  2JNG A;  2K2M A;  5CKH A;  1VQ6 T;  3P8D A;  5I21 A;  2OI3 A;  1Q7Y U;  3FC3 A;  1BYM A;  1YIT T;  2FZK B;  2SEM A;  3NTH A;  1AT1 B;  2WAC A;  1HSQ A;  2O2O A;  3CD6 A;  2PTK A;  4JJD A;  3UA7 A;  5GAN h;  1NJI C;  3OYA A;  3AHU A;  3M0U A;  3SFM A;  2I2L A;  3RMQ A;  2CKK A;  2VC8 A;  1QWE A;  4IIO A;  4P5N A;  3J80 E;  1D1B A;  4PJM A;  2DJZ A;  1VQ4 T;  1PSE A;  1KJW A;  3OS2 A;  3CBO A;  1VQK T;  4C8Q C;  2M02 A;  3OQ5 A;  2CP7 A;  2XHC A;  2KT8 A;  5GMK j;  1HYO A;  1OX8 A;  2E3I A;  3X26 B;  5J26 A;  4DQ2 A;  2KK4 A;  3CCQ T;  2C0O A;  4ORZ A;  1WHH A;  3A98 A;  2LRQ A;  3H9N A;  1VYT A;  2ZCF B;  4ZN3 A;  1AWW A;  5GMK l;  1Y57 A;  2WSC E;  2DTO A;  3WXM B;  3G4S Q;  2W10 A;  1X2K A;  2JXB A;  3RES A;  1NPR A;  3GIB A;  1QVG S;  5KYN A;  1WIE A;  4QQ6 A;  4E6R A;  2COW A;  2OTL T;  1ACM B;  2FEI A;  2V26 A;  3WVD B;  4PJO A;  1F1B B;  2KVQ G;  2EYW A;  1TH7 A;  3OY9 A;  4PJO F;  1RAG B;  2CDT A;  2EVR A;  5GAN g;  5FW9 A;  3RNJ A;  1BCM A;  4X34 A;  4C8Q E;  5GAO q;  4CC3 A;  3CC7 T;  3QO3 A;  4X9C A;  1QCO A;  5GAM h;  4J6W A;  4KUI A;  4OB0 B;  4Y28 E;  3HRT A;  1ZUK A;  2LQN A;  4IUV A;  4V2S A;  1IO6 A;  2D8H A;  4PFP A;  2EIF A;  4PKC C;  2NUT A;  4XAX B;  1B07 A;  2EGE A;  2O01 E;  5IXB A;  1OQK A;  3SB2 A;  4C5I A;  1H3Z A;  3CCR T;  1M4Z A;  5CKD A;  1WLP B;  4QKU A;  2DEU A;  2JS0 A;  1QLY A;  2RJF A;  4J5Y A;  2ABL A;  2E4H A;  3DLL A;  2IG0 A;  1WQW A;  2VWF A;  4FT4 A;  1G3Y A;  2HQE A;  2P0P A;  1GBQ A;  2JM9 A;  3TQ7 P;  1LVK A;  4M78 F;  1YWP A;  4C8Q D;  5C6S A;  2HL3 A;  2RHY A;  2JTF A;  4BE0 A;  3P8H A;  1HJD A;  3MEW A;  1YIT A;  2RHU A;  2MPX C;  2CP5 A;  3MEU A;  1M1F A;  3U23 A;  3OYK A;  3JCM W;  5I22 A;  4BI8 B;  5GMK m;  3CBM A;  2YRD A;  5IXF A;  3I9Q A;  3CCJ T;  3UT1 A;  1YIJ Q;  1FMW A;  1KC8 U;  1NE8 A;  5IH2 A;  2HSE B;  2M0O A;  1QVG P;  3E19 A;  3QPH A;  1BKB A;  1I07 A;  3I35 A;  4M78 G;  3EH1 A;  1KHI A;  5CAI A;  2DTI A;  1YHQ A;  2L2P A;  2BIV A;  2GFU A;  1MV3 A;  1AD5 A;  2YUQ A;  3A8O B;  2L3P A;  1S72 A;  1QP3 A;  3R6N A;  5AYF A;  5HKC A;  4Z02 A;  3DKM A;  1S1N A;  4RTW A;  1RAB B;  2X3X D;  3PMI A;  1KK7 A;  5FU7 B;  1QQJ A;  1RAC B;  1M3C A;  3LYI A;  1BI3 A;  4AMC A;  4M77 F;  3CCJ A;  3I56 T;  3CMA Q;  3CCS A;  1E7O A;  4PJJ A;  1U06 A;  2P4R A;  1X69 A;  4LDV A;  1LOJ A;  4EMK C;  2YRV A;  3MCA B;  3TEE A;  1UGQ B;  3G7Z A;  5KYW A;  3CEY A;  1NJI R;  3CCQ Q;  3E9G A;  4ZGE B;  1OZ3 A;  4IUU A;  5I2M A;  2RJC A;  4UC4 A;  3ZFJ A;  3P8B B;  1OU8 A;  3C0C A;  2FPD A;  3ER0 A;  2RI5 A;  5FRO A;  2FZC B;  2QEX T;  3CCM Q;  3OSV A;  3NHN A;  2M16 A;  4ZGD B;  4N0A C;  1I4K 1;  3JB9 G;  4DEX A;  2QQ9 A;  2PZ1 A;  1RAI B;  4LXC A;  4J7F A;  1UB4 A;  4M78 A;  3C12 A;  3NTK A;  4J8O A;  2YWW A;  3VS3 A;  3ME9 A;  2YUP A;  2QEX A;  1S72 T;  4RG2 A;  2X9H A;  2PU9 B;  1GCQ C;  1OI1 A;  4FSS A;  1QVP A;  1RAF B;  2DJQ A;  3O8V A;  3LH0 A;  3CC4 T;  4HKE A;  1D0X A;  3LWH A;  3EHR A;  4HVV A;  3JCM X;  1V29 B;  1BIA A;  3EAE A;  2YLB A;  2HKQ B;  3GOX A;  4A4H A;  1UDL A;  5DLQ E;  4JZ4 A;  4M7D A;  3QWY A;  4M77 C;  4AG2 C;  2F5K A;  4OP0 A;  1VIF A;  2EGA A;  3PMT A;  3G71 Q;  1M1K U;  1Q7Y R;  4J9F A;  2RQR A;  2RHX A;  4M75 B;  1G2B A;  4E7H A;  2BE9 B;  3M9Q A;  2VGM A;  3M4G A;  5J3B A;  2YSQ A;  2DZ9 A;  1WFW A;  2DYB A;  1WPY A;  1M9S A;  3V8J A;  3JCM Q;  2DA9 A;  2L0A A;  2LJ0 A;  2NWM A;  1X6O A;  4QW2 A;  1SF9 A;  2E41 A;  2QG9 B;  3CXC P;  2X51 A;  2DXU A;  2X4J A;  1VQK Q;  4FYV B;  2O4X A;  5FU6 B;  1WDX A;  3EH2 A;  4FSX A;  4AFU C;  5LJ3 f;  4A4F A;  4FL6 A;  1YHQ T;  1T3L A;  3BDU A;  1X43 A;  3JB9 D;  3VS2 A;  2XD0 A;  1G8X A;  2EJ9 A;  1PWT A;  1M5Q 1;  1ZSG A;  1N8R U;  2HAX A;  2ROT A;  5GAN 8;  5GAN 6;  1PC0 A;  2V8J A;  3PIP A;  4PJL A;  3QYH B;  2L8D A;  1H92 A;  3MEA A;  2RH2 A;  4ZN1 A;  2G6F X;  3JRZ A;  1VQ5 Q;  3RIR A;  1VQN Q;  2A08 A;  2DTH A;  1HXD A;  1OV3 A;  3OBW A;  4PL6 A;  1MMG A;  3GLX A;  1D3B A;  3OBY A;  1VQ4 Q;  1FX7 A;  3HRS A;  3DB4 A;  4BY6 C;  4AFQ C;  5CVI A;  5C0M A;  2DFU A;  1RAD B;  2B8A A;  4D6W A;  3JCM g;  4IUT A;  4FM4 B;  1UHF A;  2G3R A;  3CC7 A;  1VQ6 A;  1Q81 R;  1YNZ A;  2JTE A;  2A7Y A;  2RD1 A;  3RUX A;  4NL3 A;  3JCM P;  5IN1 A;  4HCZ A;  2NYS A;  2BZX A;  3MJX A;  2EKO A;  3SD4 A;  3PFS A;  3EG2 A;  1V76 A;  3A5Z B;  2LCS A;  1B3Q A;  1KQS A;  4J9C A;  1BI1 A;  3G71 T;  1TUC A;  2VXE A;  4KRT A;  3L2U A;  3RKX A;  2D9T A;  2BTT A;  3CXC A;  3OMC A;  2JM8 A;  1Z9Z A;  3X24 B;  2LNH B;  1YI2 T;  5FLX E;  2DO3 A;  1YP5 A;  1B34 B;  3QXE B;  4LD9 K;  5HK0 A;  3PVQ A;  1YFN A;  3CCU A;  2E10 A;  3UDC A;  1ZUY A;  5D6W A;  1TTH B;  4MZP A;  2L89 A;  1WXT A;  5A2Q E;  2KQW A;  2RJD A;  4F17 A;  3SDZ A;  1WHL A;  1U1T A;  1SSF A;  3M58 A;  2ZZD A;  1SRL A;  2ESW A;  3MP8 A;  3VUB A;  1TOV A;  4M78 C;  3CPW A;  3TCJ A;  3X28 B;  4XU1 A;  3OS1 A;  5GAM j;  2R57 A;  2ZPH B;  3BY7 A;  4LDU A;  1KQ1 A;  4DA4 A;  4M77 G;  3ULR B;  4ELY C;  4BD3 A;  2OJ2 A;  3MHX A;  2W0Z A;  2J6F A;  4D8D A;  3G6E Q;  1VQ4 A;  2KGT A;  2O9S A;  1ZLM A;  4XTX A;  2EJG A;  3HRU A;  1VQ7 Q;  4M7A C;  2GQI A;  2QQR A;  1K73 U;  5I11 A;  2J05 A;  4XTY A;  5GAN d;  5IAY A;  4A4G A;  2HSP A;  3CD6 T;  3MPU B;  1VYU A;  1YJ9 Q;  5FRN A;  3RKY A;  4JLG A;  1FXX A;  1UE9 A;  5GAN 4;  2DIG A;  4J7I A;  2JS2 A;  2HZY A;  1RUW A;  4NOY A;  2HKN A;  5AT1 B;  2L3S A;  5FWB A;  2DRK A;  1WHK A;  2FG0 A;  1K9M R;  1VQL Q;  1TUD A;  2A3L A;  2GF7 A;  2AT1 B;  1HK9 A;  1S72 Q;  2HCK A;  4ESR A;  1RLQ C;  3EFO A;  2EYX A;  2RI2 A;  2X3W D;  3OYM A;  2DLP A;  4M75 F;  1C6V X;  3EG1 A;  4RTX A;  3OSS C;  2VV5 A;  4J9D A;  3TVT A;  1RI9 A;  3I55 Q;  2EW3 A;  4KBM B;  2LCL A;  2QDL A;  3M57 A;  1Y07 A;  2MAM A;  1WXU A;  2QTV A;  4F7U G;  2K4Y A;  1RL2 A;  2F2W A;  1XTD A;  2MWP A;  2RK2 A;  4A53 A;  1W70 A;  2EQM A;  1Q82 R;  1VIE A;  3JCM c;  3H6Z A;  4OF1 A;  2MYS A;  2HBW A;  1YJ9 A;  1SSH A;  4C92 C;  1VQM T;  4J6X A;  4IUP A;  1YIJ T;  2KEA A;  2CRE A;  2DE0 X;  5GMK i;  2A37 A;  1YI2 Q;  4C0D C;  4MML A;  1VQ5 A;  2IVW A;  1VQN A;  1QVG A;  1YJ9 T;  4M75 D;  1K9A A;  2SRC A;  5GAO l;  4RTV A;  1X2Q A;  1N27 A;  4JJC A;  2HBP A;  1JXO A;  4B9W A;  4LDW A;  2QQA A;  1VQ8 T;  2C0I A;  4L6V 5;  2CS7 A;  3LH5 A;  2DPP B;  1R0B G;  1QCF A;  4M7D C;  3NPF A;  3REB B;  3GNG A;  4QQD A;  4C92 D;  1QWF A;  3FEO A;  4BUG A;  1KD1 C;  4RTY A;  3CCE T;  3V8L A;  5LJ3 d;  2DXC A;  3V7C A;  5L23 A;  4LUD A;  1T0J A;  3SWN C;  2DYI A;  3OYE A;  1JU5 C;  2CT4 A;  2DK3 A;  3CCE A;  4QVC A;  3NMZ C;  2JN0 A;  5GAM g;  1R8O B;  2FZG B;  2MF2 A;  4ME7 A;  3CPW S;  3VS1 A;  3OYC A;  1T0H A;  3FJ5 A;  4LD6 A;  2KY9 A;  4M7D D;  1C0M A;  2C06 A;  2AHJ B;  3BE3 A;  2CZ1 B;  5KYU A;  2O31 A;  1YHQ Q;  1MHN A;  2GTJ A;  3A1P A;  1VYV A;  3INZ A;  3WVE B;  1KQS P;  1KHC A;  1PRM C;  3MP6 A;  4N4H A;  4DEY A;  5LJ3 j;  2VXF A;  1BI0 A;  1N9S A;  1YJN A;  2RA2 A;  2VAS A;  3CCV A;  2RMO A;  1K9M C;  2YRC A;  4F7U F;  2DRM A;  3OYI A;  1GFD A;  3M0T A;  4O5V A;  3M0P A;  3TU4 K;  4JS5 A;  1VQM Q;  1M2O A;  2QGF B;  5LJ5 e;  1UGS B;  2RF0 A;  2P4T A;  1X6B A;  2K5L A;  1VQL A;  3H0F A;  3G6E T;  2K5I A;  1N8R R;  1MMN A;  1SKU B;  3QDR B;  5L8R E;  3CCM A;  2AKK A;  2RM4 A;  1N6A A;  3OW2 S;  5A0L A;  1H64 1;  2K6D A;  4N4G A;  3CME Q;  1M8V A;  2MOX A;  2NUT B;  4PFZ A;  1X27 A;  4AFS C;  3CC2 A;  2LDM A;  3D7S B;  2YUN A;  2XKO C;  3M56 A;  2LQK A;  2OTJ Q;  1MMA A;  4ZTF A;  4X1V A;  1ZSZ B;  1Q86 R;  2HQX A;  3JCM d;  5DY9 A;  4YTL A;  1BB9 A;  1W4S A;  1IXD A;  2DL5 A;  4BDZ A;  3A8M B;  2FPF A;  3CQT A;  3EG9 B;  1ARK A;  2YHT A;  1NBE B;  3C4S A;  1YWO A;  4XTV A;  3OYB A;  3L2W A;  1VQ6 Q;  3JB9 H;  2CP6 A;  1QCN A;  3OS5 A;  1W2B A;  2EQJ A;  4QT7 A;  5EG2 A;  3JCM b;  1GCQ A;  4QVZ A;  1VQ7 T;  1WJS A;  3E2U A;  1YI2 A;  1V1C A;  3EFR A;  4JUV A;  1MNE A;  2DER A;  2AZS A;  1EZZ B;  4C92 A;  4FIB A;  2KRS A;  3EGX B;  9ATC B;  2XMF A;  1PM3 A;  2E70 A;  3GF5 A;  3RKW A;  4EMK B;  4LUE A;  1ZX6 A;  4FU6 A;  1Q86 C;  4M77 E;  2HNI A;  1UGP B;  4EMH A;  2VUB A;  5KYY B;  1MV0 B;  5GAO n;  2A0F B;  4LE9 A;  1BBZ A;  3GPL A;  4FW2 A;  2FL7 A;  1LPL A;  2F1L A;  3GBQ A;  2CZ6 B;  4HA8 A;  2CSI A;  3RDV A;  1CSK A;  2NUP B;  3VU3 C;  3CCV Q;  1TS9 A;  2DEQ A;  1E6H A;  1UJY A;  5KE2 A;  3REA B;  1Q86 U;  1ABQ A;  4KH0 B;  4ZTJ A;  5GJV B;  2XDD A;  2V8I A;  5CCA A;  5GAM f;  1K73 R;  5GAN 7;  2QI2 A;  4X9D A;  3LGF A;  2J6K A;  3GNF B;  2K3Y A;  3FRN A;  1NLP C;  4BAC A;  2ZPB B;  4OMP A;  1AWO A;  2A36 A;  1JXM A;  3EG9 A;  2XI9 A;  3M0R A;  4L59 A;  1Q82 U;  2KR3 A;  5KYY A;  3CC4 A;  3JB9 J;  5D7U A;  5IT9 E;  1X6G A;  2LC4 A;  5IHI A;  3VRY A;  1Q7Y C;  4ATO A;  3MO8 A;  5GMK e;  1UHC A;  4PJO C;  2OX7 A;  2V1Q A;  3H0H A;  3BDL A;  1K9M U;  1Q81 U;  2CH4 W;  1TXQ A;  4EIK A;  2QA4 Q;  2KT1 A;  3OB9 A;  3JB9 I;  3EFS A;  1VQ9 Q;  2A28 A;  4K11 A;  2JT4 A;  4GLK A;  3OYF A;  2QGG A;  1QKW A;  3RMS A;  1WJQ A;  3OYJ A;  2RJE A;  1DJ7 B;  3UA6 A;  5FU6 C;  1UGR B;  3DLM A;  2RPN A;  4HXJ A;  4XQ3 A;  1QVF S;  2XDP A;  1IHW A;  4BE2 A;  2C0T A;  1O75 A;  1UGV A;  1KQS S;  3S3N A;  1GBR A;  4QQG A;  3OA6 A;  1K0S A;  1TU0 B;  4F14 A;  4AG1 C;  1OU9 A;  4ZNX A;  1Y71 A;  1GFC A;  3HSB A;  4M78 D;  3OYN A;  3VYH B;  3OYD A;  3CCR Q;  5CKE A;  4KUL A;  1UUE A;  2F69 A;  3PNW C;  3I56 A;  3CCS T;  3SWN B;  1RAE B;  2LVM A;  1G3W A;  4E7L A;  3HFN A;  4C0D B;  1AZG B;  2HL5 C;  4CC2 A;  2E6Z A;  5IHN A;  4IKF A;  1KFZ A;  1MMD A;  3BW1 A;  1NEG A;  4GLM A;  2F2V A;  1D1A A;  1UTI A;  2CP3 A;  1YIT Q;  1W6X A;  3O5Z A;  4A63 B;  5GAN 5;  1JBM A;  3HL8 A;  2B86 A;  3M54 A;  5HY6 A;  3J7A F;  4C0F A;  1BK2 A;  1NJI U;  2WSF E;  3CD6 Q;  3L42 A;  4TVR A;  3JV3 A;  2RHI A;  4KGZ B;  2GNC A;  4XTZ A;  2KBT A;  1ZQ1 A;  2JMA A;  3QII A;  1AHJ B;  2DM1 A;  5HCK A;  2RQW A;  2FB7 A;  2K3B A;  1BU1 A;  1K8A U;  4CRI A;  2DNU A;  1KQ2 A;  2X4Y A;  3M4Y A;  3PTA A;  1SEM A;  3ZL7 C;  4A4E A;  3M5A A;  1UG1 A;  1Y96 B;  2GQV A;  4HCC A;  3I55 T;  3L2Z A;  2CUD A;  3M53 A;  4FYX B;  1IRE B;  4M7D F;  2CT3 A;  5KYX B;  3VV0 A;  2MCN A;  2LTO A;  2EGC A;  3THK A;  2RQU A;  3JCM f;  2DBK A;  4WF2 A;  4BE1 A;  3CC7 Q;  2DZC A;  4C8Q B;  3PGG A;  4E7K A;  4DBH A;  4EMK A;  1Q82 C;  6AT1 B;  3OS0 A;  2RQV A;  4JPB W;  3QZ5 B;  2YDL A;  3CCL T;  3NFC A;  4C92 F;  1WA7 A;  4PJO B;  1YN8 A;  2PNI A;  3CCR A;  4KH1 B;  2D0Q B;  1M8M A;  1NYG A;  4J83 A;  1ZA1 B;  3JCM e;  3VS0 A;  4MDW A;  1X01 A;  1YCY A;  3QZ9 B;  3RER A;  4AT1 B;  4C0Z A;  2L3R A;  2CZ0 B;  1U5S A;  2VKN A;  3I5R A;  1TG0 A;  3IQL A;  3FDR A;  1K8A R;  3EHQ A;  1E6G A;  3L2V A;  2LP5 A;  4A4K A;  1Y7X A;  4QVD A;  1JEG A;  3LLR A;  1Q95 G;  2DL8 A;  2LNV A;  3MP1 A;  4E7J A;  4F7U E;  5CQY A;  2DVE A;  2MIO A;  1ZSZ A;  1K76 A;  4Y92 A;  1JB0 E;  3CCU T;  2FYK A;  2ZPE B;  4HVW A;  4WTO B;  1XQH A;  1M1K R;  2BE7 D;  3HPW A;  1K4U S;  4M75 A;  3F70 A;  1UEC A;  2COY A;  2JMC A;  4J9I A;  5GAN f;  4HCK A;  1EFN A;  3G71 A;  5GAO m;  4EMG A;  2AKL A;  8ATC B;  3CC4 Q;  2V1R A;  2DAQ A;  1YBY A;  2XID A;  1SHF A;  1XNI A;  2FRY A;  2Y4X A;  1VQK A;  1YJW A;  2KRN A;  3QJ6 A;  2EFI A;  5FU7 C;  2E65 A;  2E6N A;  5IHK A;  1N9R A;  4M7A F;  1Y0M A;  3EGD B;  5LJ3 h;  1M3A A;  3AT1 B;  1MUZ A;  2OTL A;  2L5Q A;  4KGX B;  4LN2 A;  1WNL A;  2P84 A;  5FWC A;  2AK5 A;  2NUP A;  1HD3 A;  3RBB B;  1NM7 A;  1KG1 A;  3PE0 A;  1G5V A;  1WHJ A;  4IUR A;  4FCY A;  4DBR A;  3S3O A;  1JJ2 A;  5DLO A;  2QTX A;  1YJW Q;  2OAU A;  4RTU A;  1M2V B;  4ZGJ B;  2DET A;  4IIM A;  3RR6 A;  3CCQ A;  1I5O B;  1K8A C;  4RUG A;  2RN8 A;  4E7Z A;  2YUO A;  4A54 A;  4XTU A;  1KIK A;  2RO0 A;  3EG0 A;  2ROL A;  2YLC A;  1D3B B;  1M1G A;  1PD0 A;  4RCB A;  4C92 B;  5LJ5 g;  2PVG B;  3M0Q A;  1CKB A;  4F7U A;  1ZUU A;  3DB3 A;  1LJO A;  3QG1 A;  4PJO D;  3EFO B;  3A8L B;  2RHZ A;  2O9V A;  3UF4 A;  4HT8 A;  2COZ A;  1OPL A;  2ECZ A;  2EQI A;  3UAT A;  2ENM A;  4PK4 A;  1I8F A;  1PKT A;  3CPF A;  4BDY A;  5GAO p;  3TSW A;  2DIL A;  3VS4 A;  1VUB A;  4FYW B;  1PSF A;  1W2B P;  1B7T A;  4C0G A;  4EPC A;  3QWX X;  5CQX A;  1JO8 A;  4OMF B;  4J9G A;  5A0G A;  3CXC S;  2MK5 A;  2LZ6 B;  3NGP A;  1BIB A;  2JVV A;  2K9G A;  4M7A G;  1NZ9 A;  1R0C B;  3URG A;  1NPP A;  3EGU A;  3KUF A;  1YJW T;  4PLL A;  2QA4 T;  3JAM E;  3L2R A;  3CCJ Q;  2DVJ A;  4B6M A;  1N8R C;  4J9H A;  5ECA A;  3LGL A;  3CC2 Q;  1B34 A;  1AWX A;  1K73 C;  5LJ5 f;  2KAF A;  4LDY A;  2BKD N;  3E1S A;  1W1F A;  3JCM h;  4JZ3 A;  1WX6 A;  2DX1 A;  3CCL A;  4J9E A;  1AWJ A;  2DMO A;  4RG8 A;  2HEQ A;  1TWB A;  1K0X A;  1D09 B;  5DM7 R;  2GFA A;  5CO7 A;  3GP8 A;  1NLO C;  1FWZ A;  1ZBJ A;  4PNO A;  1KC8 R;  2ED1 A;  4DOW A;  4B9X A;  2ED0 A;  4Z8A A;  3OW2 A;  3CCV T;  2CYZ B;  4DBQ A;  1SRM A;  4Y91 A;  1YJN T;  2J6O A;  4N4I A;  1YJN Q;  4NS5 A;  2LMJ A;  3S6W A;  3OYH A;  4MZT A;  4BI3 A;  2QQB A;  1PKS A;  2K3X A;  4PFO A;  1VQP A;  3VRZ A;  3I55 A;  3QHS A;  2QEX Q;  2IPO B;  4M75 G;  4JJN K;  4FW1 A;  2FPE A;  5GAN 3;  1M27 C;  2H8H A;  2FVU A;  1VQ9 T;  4MDX A;  3QBY A;  2EYZ A;  5LL6 S;  3FJP A;  2DL4 A;  3S3M A;  3EGD A;  4M7A A;  1MGQ A;  1PD1 A;  1ZHI A;  5CK9 A;  4PJO E;  4RTT A;  2EPD A;  4JRP A;  1W2B S;  1SG5 A;  4XU0 A;  3JCM V;  2HD0 A;  1QVF P;  1GL5 A;  1U1S A;  1D0Z A;  5HK3 A;  1I5L A;  2K5F A;  4CI0 C;  3G4S A;  3A8G B;  4KGV B;  1KD1 R;  1WI7 A;  3V8K A;  2DL3 A;  3H41 A;  3LW5 E;  3SEM A;  2CP2 A;  3C94 A;  5M9O A;  4II1 A;  1NG2 A;  2RQT A;  1I81 A;  2X4X A;  3L1A A;  5EC7 A;  4M7D G;  1BCO A;  1QP2 A;  4DOV A;  1VQO Q;  8AT1 B;  4C5G A;  4IUQ A;  3CME A;  4Q5W A;  2PQW A;  2OTJ T;  2QAS A;  2I0N A;  4BY6 B;  4ANJ A;  1N5Z A;  5GAM e;  1UJ0 A;  1G3T A;  4C8Q A;  1LNX A;  1KD1 U;  2XG8 D;  4CC7 A;  2JW4 A;  3HKS A;  4LDX A;  1VA7 A;  2LT4 A;  3QJY A;  4RCC A;  1OUL A;  3FLG A;  3KFV A;  1VQM A;  4OML A;  4C92 G;  2X35 A;  2DXB A;  1D0Y A;  3ASK A;  2DD4 A;  2Y4Y A;  1M1K C;  1IGU A;  1OYX A;  1WGS A;  1WJR A;  1PRL C;  2J7I A;  4F04 B;  3HP9 A;  1NYF A;  2Y90 A;  3QYG B;  1VQ8 Q;  2ATC B;  2EKH A;  3N5B B;  4M78 B;  2EQK A;  2RK1 A;  4XU2 A;  4VUB A;  2DKG A;  2H3J A;  1C1A A;  2KE9 A;  2X4W A;  1OZ2 A;  4MMK A;  1Q81 C;  3OMG A;  1ZSZ C;  4D8K A;  1YCS B;  2KXC A;  3Q1J A;  1JJ2 P;  1WXB A;  5GAN 2;  5CKF A;  4M7A B;  2LJ3 A;  4J9B A;  5CIU A;  4M75 C;  1IHV A;  1VQ7 A;  2F5T X;  2D6F A;  3I5S A;  2CZ7 B;  2HDA A;  4Z88 A;  4MZM A;  3QUI A;  1WQ7 A;  4OGE A;  1GRI A;  4FYY B;  1Y96 A;  4RMO A;  2XK0 A;  2ZGW A;  4OMM A;  3OYG A;  1BI2 A;  3SWN A;  3JSC A;  4R55 A;  5I2S A;  1M90 R;  2IIM A;  1TSF A;  3H0I A;  2EAY A;  4JJB A;  1VQO A;  2ZPG B;  4M77 B;  3VS5 A;  3PIO A;  3M55 A;  2KRO A;  4XU3 A;  4OMQ A;  2D0N A;  1XJW B;  1KC8 C;  2H3E B;  2KDS A;  1UEB A;  4OVA A;  3ZEH A;  1SPK A;  4RTZ A;  3FIF A;  4JRQ A;  3NTI A;  1PHT A;  3G6E A;  1VQL T;  2D8J A;  1H8K A;  2KXD A;  3JB9 F;  3M0S A;  2BUD A;  1T3S A;  1X75 C;  1AVZ C;  2QAZ A;  2VGN A;  2LJ1 A;  5CKB A;  2P0K A;  5KYU B;  2PUK B;  1M2V A;  4WCI A;  2QQS A;  4J6Y A;  2QYZ A;  1D1C A;  2DBM A;  4M78 E;  2JOY A;  5KCO A;  3VJP A;  2PUO B;  1JRI A;  3T9N A;  1ABO A;  4BB7 A;  3BFM A;  1VQO T;  3VKI A;  4BI4 A;  2KYB A;  4GBQ A;  1K1Z A;  4JS4 A;  2QDY B;  1I0C A;  1WHM A;  2LQW A;  1O9S A;  3MKD A;  4HCB A;  2DXT A;  1VQP Q;  2CGH A;  1PNJ A;  2VB6 A;  4M77 D;  3G1J A;  1AEY A;  1MND A;  1VOM A;  2RI3 A;  4KUD K;  3R6O A;  4HT9 A;  2JJ9 A;  4M4Z A;  2K2V A;  2YT6 A;  1GXI E;  1QMC A;  2E5Q A;  1XOV A;  2EWN A;  4OB3 B;  3H8Z A;  5LJ5 d;  2XDB A;  2PVD B;  1M3B A;  4OB1 B;  4E7S A;  2DF6 A;  3MET A;  2XU8 A;  2YXY A;  2KYM A;  1OX9 A;  1ZBX A;  3LWI A;  3FB9 A;  2CSQ A;  2MI6 A;  4OMN A;  5LJ3 g;  1H3H A;  4CC4 B;  3LX7 A;  3TSZ A;  5KE3 A;  1OEB A;  3CCE Q;  2FRW A;  1IGQ A;  1NEB A;  3V7R A;  2LT1 A;  1VQ8 A;  4C8Q G;  5KH6 A;  1IRX A;  2OAW A;  4AFZ C;  2JTM A;  3QDF A;  3VYG A;  4KT0 E;  1A0N B;  4O6J A;  5CR2 A;  4N0A A;  1RLP C;  2JZ2 A;  2R58 A;  1TUG B;  4E7I A;  2GTO A;  3X25 B;  1WHG A;  4C8Q F;  4RKU E;  1U8R A;  2NUZ A;  2FO0 A;  2JUF A;  4LNP A;  4C5E A;  2NLU A;  1JJ2 S;  3CC2 T;  2KRM A;  2ZPI B;  3PVL A;  1PCX A;  3HFO A;  5LJ5 j;  4R0K A;  2VVK A;  3J81 E;  3HHT B;  1M90 C;  1UFF A;  2LX7 A;  1M30 A;  3HTR A;  2K7A A;  3CCM T;  1FMK A;  5A0D A;  3M59 A;  3E9F A;  2P0Q A;  2E5K A;  5GAN e;  2Z0W A;  3I56 Q;  4PJN A;  3CMA T;  4PLI A;  4M77 A;  7AT1 B;  2CP0 A;  2MWO A; 
#chains in the Genus database with same CATH homology
 3G6E T;  2K5I A;  5LJ3 e;  3C12 A;  3TRE A;  3DB3 A;  1LJO A;  3NTK A;  3QG1 A;  4PJO D;  3A8H B;  3QDR B;  4J8O A;  5L8R E;  3CCM A;  3ME9 A;  4PJO G;  2RM4 A;  1N6A A;  2RHZ A;  1QW1 A;  3A8L B;  2QEX A;  3OW2 S;  4HT8 A;  5A0L A;  1S72 T;  4RG2 A;  1IZ6 A;  2PU9 B;  1OI1 A;  1H64 1;  1QVP A;  4N4G A;  1M8V A;  3PT9 A;  3KBG A;  3O8V A;  3CC2 A;  1RI0 A;  3LH0 A;  2LDM A;  1I8F A;  3CC4 T;  2M1H A;  3CPF A;  4HKE A;  3LWH A;  2XKO C;  3M56 A;  2LQK A;  4BDY A;  3JCM X;  1V29 B;  5GAO p;  5GAN j;  4ZTF A;  1BIA A;  1VQL A;  3EAE A;  2YLB A;  4M7D B;  1VUB A;  3GOX A;  2GCX A;  2HQX A;  3JCM d;  3OYY A;  5DLQ E;  4A4H A;  1PSF A;  2EJF A;  5DY9 A;  4M7D A;  4YTL A;  4C0G A;  4EPC A;  2XIC A;  4M77 C;  1W4S A;  5CQX A;  2F5K A;  4OMF B;  1VIF A;  3PMT A;  4OP0 A;  4BDZ A;  1M1K U;  3A8M B;  5A0G A;  4GY5 A;  3CXC S;  4OGC A;  2YHT A;  1BIB A;  2RHX A;  4M75 B;  4JDS A;  4E7H A;  2JVV A;  3C4S A;  1VQ9 A;  4M7A G;  1NZ9 A;  4XTV A;  3M9Q A;  4M7D E;  2LQ8 A;  3URG A;  1NPP A;  3KUF A;  2VGM A;  3M4G A;  4NL2 A;  3OYB A;  3L2W A;  5J3B A;  4M7A D;  3JB9 H;  2DD5 A;  3OS5 A;  1W2B A;  2EQJ A;  2V8K A;  1YJW T;  4PLL A;  2DZ9 A;  5EG2 A;  3JCM b;  3JAM E;  3L2R A;  2QA4 T;  1VQP T;  4QVZ A;  1VQ7 T;  1WPY A;  1M9S A;  3V8J A;  3JCM Q;  1WJS A;  1N8R C;  3LGL A;  1X6O A;  4QW2 A;  2E41 A;  2EYQ A;  1YI2 A;  1YIJ A;  2DXU A;  3EFR A;  2X4J A;  4JUV A;  1B34 A;  3X20 B;  5GAM d;  5LJ5 h;  1K73 C;  5LJ5 f;  2KAF A;  4LDY A;  2O4X A;  2BKD N;  4C92 A;  2KMT A;  4ELZ C;  3E1S A;  3KXT A;  5FU6 B;  3G4S T;  4FIB A;  3JCM h;  4FSX A;  5LJ3 f;  4F7U B;  5GAO r;  4A4F A;  4FL6 A;  1YHQ T;  2E70 A;  3BDU A;  4OB2 B;  3GF5 A;  3RKW A;  3JB9 D;  4EMK B;  2VYT A;  3CCL A;  2XD0 A;  4C92 E;  2EJ9 A;  3CMA A;  4FU6 A;  1Q86 C;  1M5Q 1;  2HNI A;  1UGP B;  4M77 E;  2K57 A;  2VUB A;  4RG8 A;  4EMH A;  5GAO n;  1N8R U;  2HAX A;  5GAN 8;  4M7A E;  5GAN 6;  1G3S A;  2V8J A;  3PIP A;  2LCC A;  3QYH B;  3GPL A;  2L8D A;  2DIQ A;  2FL7 A;  2GFA A;  5CO7 A;  5DM7 R;  4JLI A;  2CZ6 B;  5FRM A;  2KSS A;  4HA8 A;  3GP8 A;  1FWZ A;  4PNO A;  3MEA A;  2RH2 A;  4ZN1 A;  5D6Y A;  4DOW A;  3QKJ A;  4B9X A;  4JRI A;  3JRZ A;  3VU3 C;  3OW2 A;  3CCV T;  3RIR A;  2CYZ B;  2DTH A;  1HXD A;  3OBW A;  4PL6 A;  3QSU A;  4Y91 A;  1YJN T;  1VQ5 T;  3GLX A;  1D3B A;  3OBY A;  5D6X A;  1FX7 A;  1VQN T;  2DEQ A;  2E1H A;  3HRS A;  3DB4 A;  4N4I A;  4BY6 C;  4NS5 A;  5CVI A;  3S6W A;  2E64 A;  5C0M A;  4R56 A;  4MZT A;  3OYH A;  3UPU A;  5KE2 A;  1Q86 U;  2B8A A;  4BI3 A;  2QQB A;  4D6W A;  2K3X A;  1P92 A;  3CBP A;  2PVO B;  4XTW A;  3JCM g;  4ZTJ A;  1VQP A;  3UWN A;  2XDD A;  4IUT A;  2V8I A;  5CCA A;  3I55 A;  3QHS A;  4FM4 B;  5GAM f;  2G3R A;  4M75 G;  1EIF A;  3CC7 A;  4JJN K;  3JCM J;  5GAN 3;  5GAN 7;  2QI2 A;  1VQ6 A;  4X9D A;  2FHD A;  3LGF A;  2FVU A;  1VQ9 T;  4MDX A;  3QBY A;  2E12 A;  5LL6 S;  3L2Q A;  3FJP A;  2ZPF B;  3GNF B;  2A7Y A;  2K3Y A;  2RD1 A;  2R5A A;  3FRN A;  1QVF A;  3RUX A;  3S3M A;  4NL3 A;  2OTJ A;  3JCM P;  3CME T;  4M7A A;  5IN1 A;  1MGQ A;  4HCZ A;  4JRK A;  4BAC A;  2ZPB B;  1ZHI A;  2EQU A;  4FT2 A;  5CK9 A;  4PJO E;  2XI9 A;  4JRP A;  2RB6 A;  2EKO A;  4L59 A;  3SD4 A;  3OYL A;  2O4X B;  1W2B S;  3PFS A;  4XU0 A;  1Q82 U;  3JCM V;  2HD0 A;  3CC4 A;  3JB9 J;  4XK8 E;  4EDU A;  1U1S A;  5IT9 E;  3A5Z B;  2LC4 A;  5KCH A;  5HK3 A;  1Q7Y C;  2LX9 A;  2M9U A;  1I5L A;  2K5F A;  4ATO A;  1KQS A;  1BI1 A;  2R5M A;  3G71 T;  2VXE A;  4CI0 C;  4C5H A;  5GMK h;  3G4S A;  3A8G B;  2MMP A;  3MO8 A;  4E47 A;  3L2U A;  5GMK e;  4PJO C;  3RKX A;  2D9T A;  3CXC A;  3OMC A;  3X24 B;  3V8K A;  3BDL A;  1YI2 T;  5FLX E;  1Q81 U;  1M90 U;  1K9M U;  2DO3 A;  4M75 E;  3ZBD A;  1B34 B;  3QXE B;  3LW5 E;  5J39 A;  4LD9 K;  5HK0 A;  3MEV A;  3C94 A;  3OB9 A;  5M9O A;  3JB9 I;  4II1 A;  2WSE E;  3EFS A;  2QA4 A;  1I81 A;  3CCU A;  2X4X A;  3L1A A;  2E10 A;  3UDC A;  4M7D G;  3V7S A;  1QP2 A;  4GLK A;  4DOV A;  3VUZ A;  5D6W A;  3OYF A;  3C95 A;  4MZP A;  2L89 A;  4C5G A;  4IUQ A;  5A2Q E;  4Q5W A;  2PQW A;  2QXF A;  3RMS A;  3CME A;  2KQW A;  2RJD A;  2OTJ T;  4L5G A;  3SDZ A;  4BY6 B;  1U1T A;  1WJQ A;  1SSF A;  2JNG A;  2RJE A;  3M58 A;  2ZZD A;  5CKH A;  3OYJ A;  1DJ7 B;  1VQ6 T;  3P8D A;  5GAM e;  5I21 A;  5FU6 C;  3MP8 A;  1Q7Y U;  1UGR B;  3VUB A;  1G3T A;  3DLM A;  4C8Q A;  3FC3 A;  1BYM A;  1LNX A;  1YIT T;  4XQ3 A;  4M78 C;  1QVF S;  2XDP A;  1KD1 U;  4BE2 A;  2XG8 D;  3NTH A;  3CPW A;  1O75 A;  2WAC A;  3HKS A;  3TCJ A;  4LDX A;  3CD6 A;  3QJY A;  2LT4 A;  4RCC A;  3S3N A;  1KQS S;  4QQG A;  3OA6 A;  3X28 B;  3FLG A;  4XU1 A;  5GAN h;  3OS1 A;  1VQM A;  1NJI C;  3OYA A;  3AHU A;  5GAM j;  2R57 A;  1Y71 A;  2ZPH B;  3SFM A;  3HSB A;  4M78 D;  4C92 G;  3OYN A;  2X35 A;  3BY7 A;  2DXB A;  2I2L A;  1KQ1 A;  4LDU A;  4M77 G;  3RMQ A;  3VYH B;  3OYD A;  5CKE A;  4DA4 A;  4KUL A;  2CKK A;  2VC8 A;  2F69 A;  3PNW C;  3ASK A;  2DD4 A;  4P5N A;  4ELY C;  2Y4Y A;  3I56 A;  3SWN B;  3CCS T;  1M1K C;  1OYX A;  3J80 E;  1WGS A;  1WJR A;  2LVM A;  1G3W A;  2DJZ A;  4BD3 A;  1VQ4 T;  1PSE A;  3HP9 A;  4E7L A;  3HFN A;  3MHX A;  3OS2 A;  2Y90 A;  4C0D B;  3QYG B;  2E6Z A;  3N5B B;  3CBO A;  4M78 B;  1VQK T;  2EQK A;  4C8Q C;  2RK1 A;  4XU2 A;  4IKF A;  4VUB A;  3OQ5 A;  1VQ4 A;  1G5V A;  2XHC A;  5GMK j;  2DKG A;  2H3J A;  3BW1 A;  2X4W A;  1OZ2 A;  4MMK A;  4XTX A;  3X26 B;  1Q81 C;  2EJG A;  3HRU A;  5J26 A;  3OMG A;  4DQ2 A;  2KK4 A;  4M7A C;  2QQR A;  3CCQ T;  1K73 U;  5GAN 5;  1JBM A;  3HL8 A;  3M54 A;  5HY6 A;  3J7A F;  4XTY A;  2LRQ A;  3Q1J A;  4C0F A;  1NJI U;  5GAN d;  5GAN 2;  5IAY A;  4A4G A;  2WSF E;  2ZCF B;  5CKF A;  4ZN3 A;  4M7A B;  3L42 A;  4TVR A;  5GMK l;  3CD6 T;  5CIU A;  2WSC E;  2DTO A;  3WXM B;  4M75 C;  1VQ7 A;  2F5T X;  5FRN A;  2RHI A;  3RES A;  3RKY A;  1NPR A;  2D6F A;  3GIB A;  4JLG A;  4XTZ A;  1QVG S;  2CZ7 B;  4QQ6 A;  1ZQ1 A;  1FXX A;  5GAN 4;  3QII A;  1AHJ B;  2OTL T;  2DIG A;  4MZM A;  3QUI A;  1WQ7 A;  2FB7 A;  4OGE A;  3WVD B;  4PJO A;  4J7I A;  1K8A U;  2KVQ G;  4CRI A;  1TH7 A;  3OY9 A;  1KQ2 A;  2X4Y A;  4PJO F;  3M4Y A;  3PTA A;  1Y96 A;  4RMO A;  4NOY A;  2XK0 A;  4A4E A;  3M5A A;  1Y96 B;  2GQV A;  2ZGW A;  5GAN g;  4X34 A;  4C8Q E;  5GAO q;  4HCC A;  3OYG A;  1BI2 A;  3CC7 T;  3QO3 A;  3SWN A;  3JSC A;  4R55 A;  5I2S A;  3I55 T;  4X9C A;  3L2Z A;  3M53 A;  4M7D F;  1IRE B;  5GAM h;  4J6W A;  3VV0 A;  4KUI A;  2A3L A;  2GF7 A;  1HK9 A;  4OB0 B;  2LTO A;  2EAY A;  1VQO A;  4Y28 E;  3HRT A;  2ZPG B;  4M77 B;  4IUV A;  4V2S A;  3JCM f;  3PIO A;  2EIF A;  3M55 A;  4PKC C;  2RI2 A;  4XU3 A;  3OYM A;  4M75 F;  1KC8 C;  2KDS A;  4XAX B;  1UEB A;  4OVA A;  3ZEH A;  4WF2 A;  3OSS C;  2O01 E;  2VV5 A;  4BE1 A;  2DZC A;  3SB2 A;  3FIF A;  4C5I A;  1H3Z A;  4C8Q B;  3CCR T;  3PGG A;  1M4Z A;  4JRQ A;  5CKD A;  3NTI A;  4KBM B;  3G6E A;  1VQL T;  2LCL A;  3M57 A;  4E7K A;  3JB9 F;  1Y07 A;  2MAM A;  2BUD A;  4EMK A;  1Q82 C;  1X75 C;  3OS0 A;  2RJF A;  4J5Y A;  2VGN A;  3QZ5 B;  3CCL T;  3NFC A;  5CKB A;  2P0K A;  4C92 F;  2K4Y A;  4F7U G;  1RL2 A;  2MWP A;  1XTD A;  2IG0 A;  2RK2 A;  4A53 A;  3DLL A;  4PJO B;  2EQM A;  1WQW A;  1VIE A;  3CCR A;  2D0Q B;  2PUK B;  3JCM c;  3JCM e;  4J83 A;  3H6Z A;  4MDW A;  2QQS A;  1X01 A;  1YCY A;  4J6Y A;  4FT4 A;  4M78 E;  1G3Y A;  2HQE A;  2JOY A;  2P0P A;  3QZ9 B;  4OF1 A;  5KCO A;  3RER A;  3VJP A;  2PUO B;  4C0Z A;  1YJ9 A;  4C92 C;  1JRI A;  1VQM T;  4J6X A;  4IUP A;  3T9N A;  2L3R A;  2CZ0 B;  4BB7 A;  1YIJ T;  4M78 F;  4C8Q D;  3BFM A;  5C6S A;  1VQO T;  5GMK i;  2RHY A;  3VKI A;  2JTF A;  4BI4 A;  4C0D C;  4JS4 A;  2QDY B;  3FDR A;  4BE0 A;  3P8H A;  4MML A;  1VQ5 A;  1O9S A;  2IVW A;  3MEW A;  1QVG A;  1YIT A;  1VQN A;  1YJ9 T;  4HCB A;  2DXT A;  2RHU A;  2CGH A;  3L2V A;  4A4K A;  4M75 D;  3MEU A;  1M1F A;  4M77 D;  3OYK A;  1Y7X A;  4QVD A;  5GAO l;  3JCM W;  4BI8 B;  3LLR A;  5GMK m;  3CBM A;  2LNV A;  2RI3 A;  4KUD K;  4HT9 A;  3R6O A;  3UT1 A;  3CCJ T;  1N27 A;  3MP1 A;  4E7J A;  4F7U E;  5CQY A;  1NE8 A;  2K2V A;  2DVE A;  2M0O A;  1KC8 U;  1GXI E;  2HBP A;  4B9W A;  4LDW A;  2E5Q A;  2QQA A;  1VQ8 T;  4L6V 5;  1JB0 E;  1XOV A;  2CS7 A;  3E19 A;  2EWN A;  3CCU T;  2DPP B;  3QPH A;  2FYK A;  2ZPE B;  4OB3 B;  3H8Z A;  1BKB A;  4M7D C;  5LJ5 d;  1XQH A;  2XDB A;  3GNG A;  4M78 G;  4QQD A;  1KHI A;  4C92 D;  5CAI A;  2DTI A;  3FEO A;  3HPW A;  4BUG A;  1KD1 C;  3CCE T;  4M75 A;  3F70 A;  3V8L A;  5LJ3 d;  2PVD B;  4OB1 B;  1YHQ A;  2DXC A;  2BIV A;  2GFU A;  3V7C A;  3MET A;  2XU8 A;  4F7U A;  3A8O B;  5GAN f;  1ZBX A;  3SWN C;  3FB9 A;  3LWI A;  3G71 A;  1S72 A;  2MI6 A;  5GAO m;  4EMG A;  1QP3 A;  3OYE A;  5LJ3 g;  5AYF A;  2DAQ A;  5HKC A;  1YBY A;  2DK3 A;  4Z02 A;  2XID A;  3CCE A;  4QVC A;  3DKM A;  1XNI A;  3LX7 A;  2JN0 A;  5GAM g;  1R8O B;  5KE3 A;  2Y4X A;  1VQK A;  3PMI A;  5FU7 B;  2MF2 A;  1YJW A;  4ME7 A;  3V7R A;  2LT1 A;  3CPW S;  3OYC A;  1VQ8 A;  3LYI A;  4C8Q G;  1BI3 A;  3QJ6 A;  5KH6 A;  4LD6 A;  2KY9 A;  4M7D D;  2EFI A;  2JTM A;  4M77 F;  5FU7 C;  3CCJ A;  3VYG A;  3I56 T;  2E65 A;  3CCS A;  2C06 A;  2AHJ B;  4KT0 E;  2E6N A;  4O6J A;  5CR2 A;  4N0A A;  1N9R A;  4M7A F;  2JZ2 A;  2R58 A;  2CZ1 B;  5LJ3 h;  4LDV A;  1LOJ A;  1MHN A;  4E7I A;  2OTL A;  2L5Q A;  4EMK C;  2YRV A;  3MCA B;  1UGQ B;  3G7Z A;  3INZ A;  3TEE A;  3WVE B;  1WNL A;  1KHC A;  3X25 B;  3CEY A;  3MP6 A;  4N4H A;  4C8Q F;  4RKU E;  3E9G A;  1U8R A;  4ZGE B;  1KG1 A;  1OZ3 A;  2JUF A;  4IUU A;  5I2M A;  4C5E A;  2NLU A;  2RJC A;  5LJ3 j;  1JJ2 S;  4UC4 A;  3ZFJ A;  3CC2 T;  4IUR A;  3P8B B;  2ZPI B;  2VXF A;  3HFO A;  3ER0 A;  1BI0 A;  3S3O A;  1JJ2 A;  2RI5 A;  1N9S A;  5LJ5 j;  5DLO A;  1YJN A;  2QTX A;  2RA2 A;  2OAU A;  3J81 E;  3CCV A;  4ZGJ B;  5FRO A;  3HHT B;  1M90 C;  1K9M C;  3CCQ A;  4F7U F;  1K8A C;  2QEX T;  3OSV A;  3OYI A;  4A54 A;  3CCM T;  5A0D A;  4XTU A;  2M16 A;  2RO0 A;  4ZGD B;  4N0A C;  1I4K 1;  4O5V A;  3JB9 G;  3TU4 K;  2YLC A;  3M59 A;  4JS5 A;  1D3B B;  1M1G A;  2P0Q A;  2QQ9 A;  3E9F A;  4RCB A;  4C92 B;  5GAN e;  5LJ5 g;  5LJ5 e;  3CMA T;  1UGS B;  4PLI A;  2PVG B;  4M77 A;  2P4T A;  4J7F A;  1UB4 A;  2K5L A;  4M78 A;  2MWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...