2LVMA

Solution structure of human 53bp1 tandem tudor domains in complex with a histone h4k20me2 peptide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
123
structure length
123
Chain Sequence
b'GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tumor suppressor p53-binding protein 1
publication title Acetylation limits 53BP1 association with damaged chromatin to promote homologous recombination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 27
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lvmA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lvmA01
3CEYA 3CC4T 4OVAA 3A5ZB 3OYNA 5KE2A 3CCSA 1VQNA 1S72A 3LX7A 2CKKA 2NLUA 2L3RA 4BE0A 3OA6A 3ME9A 2LTOA 3CCMT 5KCOA 4ZTFA 5C0MA 3G6ET 3HKSA 1YJNT 1WJQA 2RI2A 3E9GA 3PNWC 4II1A 4E7IA 3CCRT 5FRNA 3CCQA 1VQOA 3P8DA 1VQ6A 4ZN3A 3OW2A 1K73C 3J7AF 3CCST 1YBYA 1WJRA 3DLMA 4PLLA 1VQNT 1S72T 1Q86C 4A4FA 3L2UA 3FLGA 3FC3A 3MEWA 2BKDN 1K73U 2RHYA 3LLRA 2JNGA 3CMEA 3L42A 1KD1C 3MEUA 3CC7A 2RJFA 4QW2A 5IAYA 3BDLA 2RI5A 4C5EA 4BDYA 1Q86U 1NPPA 4QQGA 3OYFA 5M9OA 2X35A 3CCQT 1VQOT 1YJWA 2RI3A 3OYAA 1YIJA 1VQ7A 1H3ZA 1VQ6T 1N27A 1KD1U 1OZ2A 1YI2A 4PL6A 2X4YA 4LD6A 4A4GA 2EQKA 2VYTA 2X4XA 3ZEHA 2XK0A 1VQKA 4CRIA 4YTLA 3MP6A 4NS5A 2BUDA 2JUFA 1YJ9A 2FHDA 3C4SA 4IUTA 3OS0A 3CMET 4Z02A 2GF7A 3CC7T 3E9FA 2RJEA 1W2BS 3FDRA 3OB9A 4PLIA 2JZ2A 1YJWT 1YIJT 1VQ7T 1VQLA 4N4HA 2KDSA 4IUPA 5KE3A 1VQ9A 2OTJT 2K3YA 4A4EA 4BE1A 2EQUA 1XTDA 2O4XA 1RL2A 1NZ9A 1MHNA 2E5QA 5FRMA 4N4GA 2LDMA 3OYJA 2HQXA 1WJSA 3I55A 1VQKT 2RJDA 2BIVA 3PIOA 1YJ9T 3OY9A 2HQEA 3OMCA 3J81E 3TREA 1M1KC 2E6NA 4A4HA 5D6XA 1KHCA 1Q82C 3CCJA 2F5KA 2QEXA 4E7KA 3QJ6A 1VQ9T 3OYHA 5LL6S 1M1KU 5FROA 2GFUA 3S3OA 4IKFA 1VQPA 3L2RA 3L2QA 1Q82U 3OW2S 2EQMA 3J80E 3I55T 4FU6A 1IZ6A 3S3MA 5DM7R 1WGSA 1K9MC 3MP8A 3OYIA 3LGLA 5A2QE 3DLLA 1N8RC 5DLQE 4QVZA 3S3NA 4L59A 3OYMA 3CXCA 1KHIA 2RHZA 1KQSA 3OS1A 3LGFA 2R57A 3CCJT 3ASKA 1K9MU 1YHQA 4B9XA 2QQSA 2QEXT 5J3BA 1OYXA 4IURA 5IT9E 1N8RU 1Q7YC 4BACA 1OI1A 1VQPT 1QVFA 3MO8A 3QBYA 2LCCA 5D6WA 3M9QA 3NTIA 1Q7YU 1QVGA 3OS2A 2KVQG 1JJ2A 1G5VA 2D9TA 2K3XA 3SD4A 4BDZA 5C6SA 2P0KA 3P8HA 3MEAA 2JOYA 4GY5A 2RHUA 2E6ZA 5J26A 5CIUA 2XDPA 1KC8C 2L8DA 3CPWA 2EQJA 4IUQA 4IUUA 2MI6A 2JVVA 5J39A 1VQ4A 2EIFA 4FL6A 3OYBA 3CCUA 3CMAA 2LVMA 3I56A 5KCHA 2O4XB 3OMGA 3OYDA 1VQ8A 2R5AA 5KH6A 1RI0A 1SSFA 1EIFA 1X6OA 1KC8U 1VQ5A 3OYCA 2LRQA 2DO3A 3L2WA 1YI2T 4HCZA 4BD3A 1UEBA 4BE2A 2M1HA 3H8ZA 2GFAA 3PIPA 3DB3A 1OZ3A 2QQRA 3ER0A 3OYKA 1W2BA 3QIIA 3MEVA 4UC4A 2MWOA 3GOXA 2DIQA 1VQ4T 3CC2A 3CCUT 3CMAT 4B9WA 3I56T 3LH0A 4E7JA 2E70A 3O8VA 3OQ5A 2M16A 2QA4A 1VQ8T 2JTFA 3NTHA 3S6WA 1VQLT 1VQ5T 4ZN1A 2OTLA 2B8AA 3CPFA 2EKOA 3Q1JA 2XHCA 1YITA 3UT1A 3P8BB 2G3RA 5FLXE 3G71A 2LCLA 3CCVA 3PMTA 2RJCA 4TVRA 3CD6A 4C5HA 3KUFA 1NJIC 3CC2T 3QKJA 4E7LA 3OYLA 2DAQA 3CXCS 3CCEA 1KQSS 1VQMA 2QA4T 3PMIA 2OTLT 4N4IA 3PFSA 2DIGA 1NJIU 5HY6A 2R5MA 2RHIA 1QVFS 3EAEA 3F70A 1YITT 3CCLA 2M0OA 1M90C 4X34A 1K8AC 1QVGS 2EFIA 2RHXA 3G71T 1JJ2S 3CCVT 3UWNA 3CD6T 3H6ZA 2R58A 2WACA 3OYGA 3META 2IG0A 3L2VA 1M90U 1Q81C 3JAME 3CPWS 3CCET 2OTJA 1K8AU 1VQMT 3OYEA 1YHQT 2L89A 3G4SA 3NTKA 2YRVA 4EDUA 3CC4A 5IN1A 2X4WA 3FEOA 3DB4A 1Q81U 3CCLT 4Q5WA 4RG2A 4QQDA 3MP1A 1BKBA 2RO0A 4IUVA 3KBGA 3CCMA 4QQ6A 1XNIA 5D6YA 3G6EA 4ZTJA 4E7HA 1YJNA 2MWPA 3OYYA 3LYIA 4C5GA 3CCRA 2PQWA 1M1GA 1NPRA 2LQ8A 4C5IA 3G4ST
chains in the Genus database with same CATH superfamily
2DKGA 3C0CA 3CQTA 3EHRA 4OMOA 2XG8D 2WSEE 4ELYC 3OYNA 3VS4A 1VQNA 2QDYB 2M9UA 1OEBA 2O2OA 1X6BA 1S72A 3LX7A 3CBOA 4Y92A 5HCKA 1B3QA 1MV0B 1MMNA 2IIMA 3RNJA 3CMAQ 3CCUQ 4JLIA 2FL7A 2E3IA 5KCOA 1R77A 4ZTFA 2PU9B 3HKSA 1YJNT 1WJQA 2RI2A 3UA6A 2NUTA 2PZ1A 5FRNA 5GAOr 3JCMc 1GCPA 3CCQA 3BW1A 4J9IA 2VGMA 4C92A 1VQ6A 3SWNC 1WFWA 3QG1A 2VGNA 2DBMA 4BY6C 3OW2A 1K73C 4AG2C 3J7AF 1BK2A 1WHMA 4AT1B 1WJRA 3OS5A 1MMDA 3X26B 1TUDA 1Q86C 2KRMA 2ATCB 3FC3A 1UTIA 4CC2A 3MEWA 3QJYA 3RR6A 1K73U 3L42A 1MMGA 3CMEA 2E5KA 3GBQA 1Y0MA 3MEUA 1WZOA 4C5EA 3QZ9B 1Q86U 3EG1A 5M9OA 1YJWA 1H3HA 1SHFA 1H3ZA 3KXTA 1N27A 2RQUA 3NPFA 5IXFA 3BY7A 2CT3A 2HD0A 2J6OA 4PFOA 1T3SA 3OW2P 4XAXB 2DYBA 3CD6Q 2FPFA 2XK0A 2F2VA 3SHWA 1NYGA 4CRIA 3R6OA 1MNDA 4M78E 4NS5A 3RIRA 1UG1A 2E10A 4PJJA 4BY6B 2E12A 2ZPIB 4RTWA 2GF7A 3M0UA 4KGVB 2J6FA 5GMKh 1EZZB 3VRYA 1O9SA 2J7IA 2RA2A 1W2BS 3FDRA 1R8OB 1G3TA 1UGPB 1ZBJA 1X01A 1VQ7T 2KDSA 4OGEA 4J9DA 1GXIE 4HVUA 3CCLQ 2K2MA 2K3YA 2ROLA 4C8QB 2A0FB 3VKIA 3I35A 3JV3A 1NZ9A 1BI0A 3SB2A 2E5QA 2E3HA 3JCMX 6AT1B 4D8DA 1PWTA 1PRMC 2XIDA 3OYJA 2HQXA 5GAOp 1VQKT 2RJDA 2BIVA 3OBWA 2HAXA 2ZPEB 4AMCA 3PGGA 2K4YA 3J81E 2C0TA 2CP5A 4LDVA 1YCYA 4XK8E 3TREA 2ED0A 2E6NA 4PFZA 4J7IA 1WHHA 5CK9A 4J5YA 3CCJA 2Y90A 4J6YA 2QEXA 1M1KR 4O5VA 1ZSGA 4EMKC 1RAEB 2HKNA 3REAB 1OQKA 2QXFA 5FROA 1Q82R 4E47A 1HJDA 4C92G 2L5QA 2AHJB 2CZ6B 1X2QA 4J8OA 5KYUA 3I55T 1H641 2RPNA 5GAN4 5DM7R 1W70A 2O9SA 1WGSA 1K9MC 1YJNQ 3MP8A 3M57A 2V1RA 3CBMA 2BE7D 4PKCC 2RQWA 1QWEA 5DLQE 1OPLA 1XJWB 1QWFA 3S3NA 4FIBA 2LP5A 2RHZA 4FW1A 3LGFA 1KQ1A 1K9MU 2L3SA 3EGDB 4F04B 1V29B 2Z0WA 4OMFB 2D6FA 2M0YA 1G2BA 1VQPT 3GNFB 2FPDA 4J9GA 3V7SA 1Q7YR 5FU6B 2K6DA 4M77C 3NTIA 2CP7A 2NYSA 3G71Q 1JJ2A 1G5VA 1GCQA 2E4HA 4HVWA 3FRNA 4M75E 2JOYA 1KK7A 1RAFB 5CIUA 4ZGEB 2O01E 1SSHA 2DYIA 4PJOA 2MI6A 2EAYA 4M7AA 2ROTA 5KCHA 2W10A 2ED1A 2CUDA 1TS9A 1Q81R 2EGAA 2F5TX 2R5AA 1VQ8A 2BZ8A 1JB0E 1LNXA 1VQ5A 5CQXA 3OYCA 1IRXA 4M7AF 4HCZA 2KSSA 4MZMA 4BD3A 2DVEA 1M5Q1 2M1HA 3H8ZA 1UJ0A 3PIPA 5LJ3h 4LDXA 3ER0A 3OYKA 2XU8A 4F7UE 3V8KA 2GTOA 3SFMA 1JJ2P 3X24B 3MEVA 1VQ7Q 5IHKA 4UC4A 2MWOA 4R55A 1WPYA 4RKUE 5GJVB 1NLOC 2XICA 1QQJA 1KIKA 2RB6A 3LH0A 2D8JA 2KR3A 2M02A 4PJLA 4A4KA 2M16A 2JTFA 3HHTB 2ECZA 4FT4A 1JXOA 3A8OB 2KRNA 5I2SA 1VQKQ 1VQLT 3M56A 1IHWA 2O31A 2EQIA 4M78B 5DY9A 5LJ3d 4OF1A 2H3EB 1RABB 3TSZA 1I07A 2EPDA 1JEGA 4C0GA 4QT7A 8ATCB 4XTYA 2YUOA 2Y4XA 3G71A 3GNGA 3CCVA 2PVDB 2RJCA 4QVDA 2CDTA 2D0NA 3TU4K 2ZCFB 1D0XA 1OV3A 3VJPA 4E7LA 1YN8A 3OYLA 4OMQA 1NLPC 2VASA 2LQKA 2L0AA 4MMKA 2CSIA 3I55Q 1LPLA 1WI7A 3CCSQ 4N0AA 5KYYB 1M2OA 1PC0A 3EG9A 5GMKe 1OOTA 8AT1B 4JRIA 4M75D 2R5MA 2SRCA 2LQWA 1UFFA 3JCMQ 2V1QA 3VS6A 2HEQA 3F70A 1YITT 2VC8A 2VVKA 1CKAA 2JTMA 1K9AA 2CUBA 3EHQA 3H6ZA 3UF4A 2LMJA 2CT4A 1UUEA 1SKUB 2AKKA 1H92A 3JCMW 4M75C 3MJXA 1K8AR 1N9RA 2KXCA 1VQPQ 1W1FA 1Q81C 2DX1A 4FT2A 2FZGB 4J7FA 1QVPA 4NL3A 4PNOA 4PJOG 1HSQA 1N5ZA 3NTKA 4M7AG 4JLGA 1SRMA 1B34B 1ZBXA 4EDUA 2X4WA 3CBPA 5D7UA 4WF2A 1Q81U 3BE3A 1XQHA 1ZSZC 3OBYA 5KYNA 1WNLA 2DL5A 5FWCA 3NGPA 3SEMA 3KBGA 4RTUA 4QQ6A 3SWNA 5GAMj 1N9SA 2MIOA 1ZUYA 3CCRA 4XTUA 2KMTA 3H41A 2FZKB 2LZ6B 1NPRA 2LQ8A 3GPLA 1VIFA 2A3LA 2LNHB 3AT1B 3M53A 3G4ST 4RTYA 2JS2A 3CEYA 2HDAA 2DEUA 1BI1A 3GIBA 5GAN8 5KE2A 4M75B 1M27C 4FYYB 3CCSA 2PNIA 3WVDB 4JUVA 5L23A 5DLOA 2YLCA 1UDLA 1RUWA 2QTVA 2IVWA 2K9GA 2CKKA 4RUGA 4BE0A 3OA6A 2LTOA 1EFNA 3V7CA 3CCMT 1D3BA 3JCMJ 3EGXA 3G6ET 2MMPA 2A36A 3QXEB 1VQLQ 1W2BP 2RN8A 4II1A 3QSUA 4F14A 1FMKA 2BE9B 3M4GA 3EFOB 4F7UB 3A98A 1YBYA 2A28A 2LNVA 3DLMA 4PLLA 1PM3A 3E19A 3O5ZA 2DXTA 3A1PA 1K73R 2EBPA 2DEQA 2RM4A 3RKWA 4M7DC 2JNGA 4KT0E 3L2ZA 1Q86R 2RJFA 1KFZA 5CQYA 3BDLA 2A7YA 1W6XA 5ECAA 1MUZA 2QQ9A 1VQOT 1YIJA 2LJ0A 3I5RA 1YITQ 1F1BB 1OZ2A 1HYOA 4A4GA 3EGDA 2EQKA 2DVJA 2CSQA 3PVQA 2O88A 1TU0B 1VYUA 1R0CB 3SDZA 3QUIA 5A0LA 2ZPFB 4F17A 2KROA 3M0TA 4IUTA 1GBRA 3CC7T 4EMKA 3E9FA 2RJEA 4PK4A 2KYBA 5LJ3g 3OB9A 1I4K1 4PLIA 1DJ7B 4QKUA 4JPBW 2YHTA 3M58A 1VQLA 2FB7A 4PJMA 5KE3A 1VQ9A 2AZSA 1TSFA 5A0GA 4BE1A 2BZXA 4ZNXA 2EQUA 3QZ5B 1XTDA 1QP2A 1NE8A 5FRMA 2DRKA 3TQ7P 1T0HA 1WJSA 1SRLA 2JJ9A 2DD5A 2P4TA 3JB9D 2A08A 1PHTA 4BUGA 1YJ9T 4NOYA 5CKFA 1UGSB 1ACMB 2DNUA 3G4SQ 5D6XA 5GAOq 1RI9A 1GFCA 2F5KA 3VS1A 4E7KA 3M5AA 4M77A 4RMOA 2QK0A 5KYXB 3HL8A 3OYHA 2DERA 1MMAA 4J83A 5I2MA 3MCAB 2EJFA 4A63B 3L2RA 1BIBA 2JMAA 3HFNA 4OB0B 1WLPB 2G6FX 4C8QD 2EQMA 2DRMA 3CCMQ 1IZ6A 3S3MA 1X2KA 4M77F 3G6EQ 3OYIA 5A2QE 4C92F 3JCMh 1GFDA 1NEBA 3CC2Q 2PTKA 4FSSA 4JZ3A 1KHIA 4KUDK 1K9MR 1QLYA 2K2VA 1M8MA 3FJ5A 4C8QC 5CO7A 3ASKA 3BFMA 3VYGA 5J3BA 2DTHA 4DBFA 3C12A 1BBZA 1KG1A 1VOMA 4DEXA 1HXDA 5D6WA 4HXJA 3M9QA 4MDXA 2LX7A 3HFOA 2AK5A 3JCMd 1EX4A 5IH2A 5KYYA 5GMKm 1M4ZA 4IIMA 5GAMg 2JW4A 2KVQG 4J9HA 1UGVA 4BDZA 2CP3A 5C6SA 3KFVA 1K0SA 3P8HA 3MEAA 1VQOQ 4XTXA 2H8HA 2RHUA 1B7TA 4FYXB 2XDPA 2L8DA 1SHGA 2EQJA 2NUPB 4IUUA 5J39A 4JJCA 2CP6A 2EIFA 3CCUA 3CMAA 3NFCA 3OYDA 2QTXA 2YWWA 1RI0A 1N6AA 7AT1B 4R56A 1ZA1B 2LX9A 4Z89A 3V8JA 1HK9A 1YI2T 2MK5A 1UEBA 4BE2A 2DE0X 3CC7Q 1MV3A 1BYMA 5HK0A 2QQRA 3HSBA 2DXUA 2QAZA 4LDYA 5GAN6 2FVUA 1AWOA 4J6XA 1PKTA 4DBRA 3GOXA 1X43A 1VQ4T 3CC2A 1PRLC 4RTXA 5GANj 3I56T 1NEGA 4LN2A 3OQ5A 5FU6C 2OAUA 4C0DC 5GMKj 3RUXA 4OMPA 4M77G 2J06A 1YJ9Q 1K4US 4AFSC 2W0ZA 2XHCA 3THKA 5CVIA 3UT1A 1I5LA 3M0SA 3FB9A 4M75A 3RMSA 4AFZC 2GCXA 2G3RA 3EG3A 5FLXE 1FMVA 3CD6A 2X3WD 2FRWA 2QYZA 3KUFA 1RAIB 2Y4YA 3QKJA 4XTVA 1U06A 2E64A 3M4YA 3CXCS 5KYWB 3TCJA 2F2WA 1ZSZA 1WHLA 1H8KA 2QA4T 3QDFA 4EMHA 1BU1A 2OTLT 2RK1A 1SEMA 2EKHA 1G83A 1Z9ZA 3EFOA 2V8JA 1QVFS 2QQAA 4M78D 3EAEA 3CCLA 1J3TA 4LDUA 1I8FA 2M0OA 1V76A 4C0DB 2C0OA 4DQ2A 4EIKA 4WTOB 3VUBA 1WHJA 1O75A 2R58A 1KD1R 3META 2IG0A 2V8KA 2EYWA 2P4RA 3AHUA 3CPWS 1WQWA 4M78C 3CCET 4KH1B 1XOVA 3VRZA 3A8LB 1VQMT 2D1XA 4L6V5 3ZL7C 1YHQT 5FU7B 4LNPA 3WXMB 1YWOA 2OAWA 2FO0A 3RKXA 1MGQA 1Y07A 3VV0A 4LE9A 3FEOA 3DB4A 4AG1C 3EFRA 4DEYA 4PJOF 4Q5WA 2HZYA 2LJ3A 4RG2A 1TG0A 3C95A 3GP8A 4JDSA 1M30A 3G7ZA 1U5SA 4ME7A 4ESRA 2RO0A 4IUVA 4GLKA 2GNCA 2QASA 3QPHA 5D6YA 1NG2A 3EGUA 2KK4A 4E7HA 1AZEA 1YJNA 2KQWA 3FIFA 1OU8A 3JB9H 3QHSA 1YI2Q 3LWIA 4X1VA 1M1GA 4C5IA 1JO8A 3JCMV 1ZLMA 1Y7XA 2NWMA 4MZPA 3CC4T 3M55A 2YRCA 4DBHA 2AKLA 1GL5A 2CH4W 4M7DA 1AOJA 1GRIA 3EH2A 2WSFE 1VQ4Q 2NLUA 4OP0A 2L3RA 2KI7A 4M7DF 4M75G 4XU2A 1M9SA 1ZQ1A 4BI4A 3ZFJA 3E1SA 2DL7A 2KE9A 1RAHB 4M7AE 1PSFA 1FWZA 3E9GA 3PNWC 2YUNA 2DL3A 1M2VB 4JZ4A 3JCMg 2MAMA 2DMOA 2DTIA 5GJWB 1WXBA 1BCMA 3P8DA 4ZN3A 5AT1B 2LQNA 1M3AA 2JMCA 2PVGB 2RQRA 2DM1A 2JTEA 5KYXA 2LC4A 3QDRB 1VQNT 1UHCA 1S72T 1UB4A 2EGEA 3MPUB 3L2UA 4OMMA 1WXTA 1X69A 1B07A 3A8GB 3JRZA 1QCOA 2BKDN 3VU3C 5LJ5j 1OULA 1KD1C 2QA4Q 4QW2A 3R6NA 5IAYA 2EJGA 2RI5A 1E7OA 2OTLQ 4QQGA 3OYFA 4J9FA 2CH4A 2J05A 3CCQT 5L8RE 4RTZA 1VQ7A 1D1CA 1ABQA 4J6WA 1VQ6T 1KD1U 1VYTA 1MNEA 1YI2A 4PL6A 4LD6A 4BI8B 4HT8A 4CC3A 2DZ9A 5GAMh 1TH7A 2C06A 4K11A 2K3BA 1WHKA 1WA7A 1VQKA 3LH5A 2MYSA 4YTLA 2JXBA 3MP6A 4EMGA 2JUFA 2HQHA 5CR2A 2COYA 3OS0A 2AIRB 5GANg 2VUBA 3C94A 3CMET 1K0XA 2XKOC 4Z02A 3OSVA 2EWNA 2YLBA 4QVCA 1YHQQ 1IO6A 1QCFA 2DD4A 2L3QA 3JB9J 1YJWT 5GAMd 1JQQA 3H0IA 1WHGA 2OTJT 4A4EA 5GAOn 1RL2A 4ATOA 3RMQA 2YUQA 5AYFA 5I21A 1D0YA 1KSWA 3I55A 1U1TA 5GMKi 4RCCA 3D7SB 2DFUA 4FM4B 4M7DG 1BCOA 4OMLA 4C8QA 3M54A 2CS7A 3OY9A 2HQEA 3OMCA 2ZPGB 2AT1B 5CKEA 5GAN7 1FXXA 4A4HA 3CC4Q 3A8HB 2I2LA 4JS4A 4C8QF 4L5GA 2KBTA 3ULRB 1YP5A 5LL6S 2C0IA 2GFUA 3S3OA 2B86A 1VQPA 2H3JA 2VXFA 3X20B 2P84A 3RERA 4FU6A 1RLQC 4BI3A 4HCKA 1I81A 1AWJA 2HKQB 4E2FB 4C0ZA 2V26A 2DA9A 3LGLA 3DLLA 1N8RC 1AHJB 2JN0A 1QKWA 4L59A 3OYMA 1OX9A 2P0QA 3CXCA 3JCMP 1JBMA 4XQ3A 3HRUA 1UJYA 4LUDA 3CCJT 4ZGJB 3HRSA 1YHQA 1TXQA 3QYGB 2QEXT 3UA7A 2CP2A 1N8RU 1VQNQ 2XMFA 1S72Q 2RQVA 5LJ3e 4OB3B 4MDWA 1QVFA 2EVRA 3MO8A 5LJ3f 2FZCB 2LCCA 1UGRB 3HTRA 3T9NA 4VUBA 3VYHB 1VUBA 2D9TA 4M7AB 2K3XA 3SD4A 4DA4A 1C6VX 4HT9A 5IHIA 2CGHA 2PVOB 1VQ6Q 1KC8C 2K79A 1JXMA 3CPWA 1ZX6A 2EW3A 4ANJA 1PD0A 3JB9G 2JVVA 4JRQA 2DBKA 1LOJA 3CXCP 4FL6A 2DILA 3OYBA 1D09B 2OJ2A 2LVMA 2O4XB 4JJNK 2OI3A 4KGZB 5KH6A 2ENMA 3UPUA 2K7AA 4Y91A 1KC8U 4OB2B 2EGCA 2XDDA 4X9CA 9ATCB 3L2WA 3CMEQ 1QVFP 2XD0A 2RF0A 2EYXA 1WIEA 1YWPA 5HK3A 2GFAA 2BTTA 2K57A 4EPCA 1Y96B 1W4SA 1PNJA 2YT6A 4Y28E 1YJWQ 2COWA 2EYQA 3FJPA 4C8QG 5FW9A 2E1HA 1SF9A 2OTJQ 2ZPHB 1SG5A 2DIQA 2RD1A 2HMAA 4FSXA 1I1JA 3CPWP 2ZZDA 4E7JA 3TEEA 1VQ8T 3NTHA 3S6WA 1VQ5T 1M3CA 2HSEB 4ZN1A 2E41A 3CPFA 2EKOA 3Q1JA 2KY9A 3EG0A 5LJ5g 4NL2A 4RCBA 2JM8A 4JS5A 1A0NB 1SPKA 1YITA 4WCIA 4M78A 2LCLA 3H9NA 4HKEA 3RKYA 5GAMe 4C5HA 5GAMf 1QP3A 3EG9B 2V8IA 2K5FA 1KQSS 4OB1B 4M78F 2D8HA 1ZUUA 3N5BB 3PMIA 4E6RA 4A53A 4PFPA 2QQBA 1LCKA 3ZBDA 1M2VA 2KNBB 3PFSA 2DIGA 5HY6A 2VB6A 1M3BA 3QYHB 3UATA 5GAN5 4CC4B 4LXCA 1R0BG 3REBB 1M90C 2KT1A 1G3SA 4X34A 4PJNA 2EFIA 1QVGS 2RHXA 3G71T 3CCJQ 5HKCA 3CCVT 3UWNA 2QEXQ 3BDUA 4FYWB 2WACA 3OYGA 2YXYA 3DKMA 1VIEA 2RMOA 2LT4A 1M90U 4CI0C 2K5LA 2GGRA 3VS7A 2OTJA 4M77E 2L89A 3G4SA 2YRVA 2HSPA 4C92E 3PTAA 4D8KA 1IREB 3QWXX 5IN1A 1X27A 2SEMA 2X4JA 2ZPBB 2MCNA 3LW5E 2OX7A 3E2UA 3SWNB 3H0FA 3MP1A 5GANh 1BKBA 4Z8AA 2ESWA 1B34A 3HPWA 1AZGB 4KULA 1X75C 4JRKA 3CCMA 2PUKB 1XNIA 4KGXB 3G6EA 2MWPA 3OYYA 4C5GA 2CZ1B 4GLMA 2RQTA 2MF2A 4OVAA 5GANd 3A5ZB 2X51A 1D3BB 1BIAA 3EGXB 1D1AA 1D0ZA 1JU5C 2CYZB 2AZVA 2YSQA 4R0KA 5CKBA 3PE0A 4MMLA 2BZYA 2EJ9A 1ABOA 3H0HA 3ME9A 5GMKl 2HNIA 1UGQB 1AD5A 2KT8A 2YUPA 5C0MA 2CP0A 1VQ8Q 4M78G 1NBEB 4DBQA 2XDBA 5FU7C 1GBQA 1VQ5Q 1T0JA 4E7IA 4DOWA 3CCRT 1VQOA 2DETA 2DL8A 3I9QA 4M75F 5CKHA 3MHXA 4MZTA 2A37A 2GQIA 3CCST 4KBMB 4RTVA 1RAAB 4HCCA 2DJZA 4AFUC 4LUEA 2DL4A 4FW2A 1ZA2B 2I0NA 4A4FA 3FLGA 1U1SA 1OU9A 2YDLA 5CCAA 2RHYA 3LLRA 3NHNA 4F7UA 4M77D 3CC7A 1T3LA 2CZ7B 2COZA 3VS5A 4C92D 4BDYA 5EC7A 1G3WA 1NPPA 3URGA 2X35A 2F69A 2RI3A 3OYAA 1ZUKA 4F7UF 1KQ2A 2QGFB 1E6GA 2O9VA 2X4YA 1KJWA 2XI9A 3GF5A 2VYTA 2X4XA 5CAIA 3L1AA 1S1NA 3CCVQ 2QI2A 4EMKB 1NYFA 4LDWA 1M1FA 4C92C 3ZEHA 1QW1A 2DXCA 5IXBA 1IB8A 2KEAA 2RH2A 2BUDA 3TSWA 2FHDA 3C4SA 1YJ9A 1TOVA 3INZA 2LJ1A 4GBQA 4HVVA 1HD3A 4KH0B 2JZ2A 3RDVA 1YIJT 1G8XA 4N4HA 4XU0A 3EG2A 4IUPA 3VS0A 2JM9A 5FWBA 2O4XA 1MHNA 4IIOA 4N4GA 3JCMe 1CSKA 1P92A 3JCMf 2LDMA 1UE9A 1VYVA 2EYZA 2DF6A 1WQ7A 3PIOA 1PSEA 1WXUA 5GAN2 2NUTB 4M77B 2WSCE 2RNAA 1M1KC 1PG5B 1Y96A 3I56Q 4C92B 1M8VA 2KAFA 1KHCA 2JT4A 2QGGA 4O6JA 3WVEB 1C0MA 2M51A 3LWHA 1Q82C 3EFSA 4PJOE 4XTWA 2L3PA 2ZAEA 3QJ6A 4F16A 5LJ3j 1VQ9T 1M1KU 5LJ5h 3OSSC 3U23A 2JS0A 4IKFA 5IHNA 3L2QA 1PD1A 1AT1B 4P5NA 3V7RA 3EH1A 1Q82U 4XTZA 3OW2S 3J80E 1C1AA 3JSCA 2VV5A 4KRTA 3VS2A 1X6GA 3G1JA 3X25B 2VWFA 2X3XD 3CCRQ 1FYNA 2LCSA 3PVLA 1FX7A 4QVZA 1JRIA 1TWBA 4ZGDB 2DLPA 3I5SA 3UDCA 3OS1A 1TTHB 1KQSA 4F7UG 4DOVA 5LJ5d 2R57A 1I0CA 5GANe 3M59A 1N8RR 3QWYA 4B9XA 2QQSA 5GANf 1NJIR 4IURA 1K1ZA 1OYXA 1AWWA 5IT9E 5GAN3 2F2XA 1Q7YC 4BACA 3VS3A 4X9DA 2KRSA 4XU1A 2KXDA 1OI1A 3M0QA 3RBBB 1FMWA 2E65A 4M7DE 1IHVA 3QBYA 2HL5C 4JJDA 1QKXA 2YRDA 3NMZC 2DK3A 1Q7YU 1QVGA 3OS2A 4J9EA 4HCBA 3GLXA 2VKNA 2P0KA 1BB9A 4FCYA 4GY5A 2HL3A 2E6ZA 5J26A 4A54A 3A8MB 3CCEQ 1YFNA 4J9BA 1VQMQ 3HP9A 4KUIA 4IUQA 2FRYA 1V1CA 1VQ4A 1Z9QA 2ABLA 1KQSP 3I56A 1IGUA 1QCNA 3OMGA 3RESA 2X9HA 1KC8R 3QO3A 1K76A 1SSFA 2VXEA 1EIFA 2F1LA 1X6OA 3HRTA 2HCKA 1WYXA 2LRQA 3JCMb 3JB9F 2NUPA 2DO3A 2DZCA 2KGTA 4OGCA 5I11A 2GQVA 4D6WA 1Y57A 1NM7A 4C0FA 3DB3A 1OZ3A 4RG8A 4ORZA 5GAOm 4J9CA 1W2BA 1QVGP 4PJOD 2MOXA 1LJOA 1YCSB 3QIIA 1VA7A 1TUGB 1YIJQ 4M7AD 1LVKA 2D0QB 2HBPA 5A0DA 4E7SA 4JRPA 1CKBA 1GCQC 2PUOB 3CCUT 3CMAT 4B9WA 2DTOA 2E70A 3M0PA 3O8VA 1IXDA 2QA4A 1AWXA 1UHFA 2QG9B 5KYUB 4PJOC 2OTLA 1YNZA 2B8AA 4CC7A 4M4ZA 4M7AC 2RK2A 1U3OA 2J6KA 2MPXC 4V2SA 2FYKA 1OPKA 1UECA 2QDLA 4FYVB 3MKDA 3P8BB 1ZSZB 3PMTA 3TVTA 4TVRA 1G3YA 1BI2A 1PKSA 1VQ9Q 1TUCA 4AFQC 4RTTA 5EG2A 1OX8A 1NJIC 3CC2T 1RAGB 2DAQA 4M7DD 3CCEA 3JB9I 1VQMA 4LD9K 1IGQA 1ARKA 1E6HA 4B6MA 2HBWA 4OMNA 2L2PA 4N4IA 2LT1A 1NJIU 3M0RA 1RACB 5KYWA 2RHIA 1ZHIA 2DJQA 4JJBA 3IQLA 4ELZC 1PCXA 4HA8A 4C8QE 2DPPB 1K8AC 4PJOB 1JJ2S 5GAOl 3PT9A 2NUZA 3CD6T 2EYYA 5I22A 1AVZC 1M90R 3CCQQ 1BI3A 3L2VA 3JAME 1K8AU 2K5IA 2P0PA 3OYEA 4E7ZA 2IPOB 1AEYA 5CKDA 4XU3A 3CC4A 1U8RA 4Z88A 3VUZA 2CZ0B 2KYMA 2FG0A 3CCLT 4QQDA 1D1BA 1Y71A 4N0AC 1I5OB 2DXBA 1WX6A 2ZGWA 2CREA 2FEIA 5LJ5e 5LJ5f 2GTJA 4BB7A 1RADB 4ZTJA 1WDXA 1QMCA 1RLPC 4M7DB 3LYIA 2PQWA 2GBQA 3X28B 2FPEA 3V8LA 1Q95G
chains in the Genus database with same CATH topology
3CEYA 2DKGA 4MZPA 3CC4T 4OVAA 5GANd 3A5ZB 3M55A 2XG8D 1BI1A 2WSEE 4ELYC 3GIBA 5GAN8 3OYNA 5KE2A 4M7DA 4M75B 3CCSA 1D3BB 1BIAA 3WVDB 1VQNA 2QDYB 2M9UA 4JUVA 5DLOA 2YLCA 2CYZB 1S72A 5CKBA 3LX7A 4MMLA 2IVWA 2CKKA 2WSFE 3CBOA 2EJ9A 2NLUA 4OP0A 2L3RA 4BE0A 3OA6A 3ME9A 4JLIA 5GMKl 2HNIA 2LTOA 4M7DF 2FL7A 4M75G 3V7CA 3CCMT 1D3BA 4XU2A 5KCOA 1M9SA 1UGQB 1ZQ1A 4ZTFA 4BI4A 3JCMJ 3ZFJA 5C0MA 3E1SA 2PU9B 4M78G 3G6ET 2MMPA 2XDBA 3HKSA 5FU7C 3QXEB 4M7AE 1PSFA 1YJNT 1FWZA 1WJQA 2RI2A 3E9GA 3PNWC 4II1A 4E7IA 4DOWA 3QSUA 3CCRT 5FRNA 5GAOr 3JCMc 3CCQA 3BW1A 1VQOA 3JCMg 2MAMA 2DTIA 2VGMA 4C92A 3P8DA 3M4GA 4M75F 1VQ6A 4ZN3A 3SWNC 5CKHA 3QG1A 2VGNA 4BY6C 3MHXA 4MZTA 3OW2A 2PVGB 1K73C 3J7AF 4F7UB 3CCST 1YBYA 4KBMB 1WJRA 2LNVA 3DLMA 4PLLA 2LC4A 3QDRB 1VQNT 3OS5A 3E19A 4HCCA 2DJZA 1S72T 1UB4A 3X26B 2DXTA 1Q86C 4A4FA 3L2UA 3FLGA 3FC3A 2DEQA 3A8GB 1U1SA 2RM4A 3MEWA 3JRZA 2BKDN 3QJYA 3RKWA 1K73U 5CCAA 3VU3C 4M7DC 2RHYA 3LLRA 2JNGA 3L42A 5LJ5j 4F7UA 4M77D 3CMEA 1KD1C 3MEUA 4KT0E 3L2ZA 3CC7A 2RJFA 4QW2A 5IAYA 2CZ7B 2EJGA 3BDLA 2A7YA 2RI5A 5CQYA 4C5EA 3QZ9B 4C92D 1G3WA 1NPPA 4BDYA 1Q86U 4QQGA 3OYFA 5M9OA 3URGA 2X35A 2F69A 2QQ9A 3CCQT 1VQOT 1YJWA 2RI3A 3OYAA 5L8RE 1YIJA 1VQ7A 1H3ZA 4J6WA 4F7UF 3KXTA 1N27A 1KQ2A 1VQ6T 1KD1U 1OZ2A 3BY7A 1YI2A 4PL6A 2X4YA 2XI9A 3GF5A 4LD6A 4A4GA 2EQKA 2HD0A 4BI8B 2VYTA 4HT8A 2X4XA 2DZ9A 5CAIA 5GAMh 3L1AA 1TH7A 2C06A 2QI2A 4XAXB 4EMKB 4LDWA 1M1FA 4C92C 3ZEHA 2XK0A 1QW1A 3QUIA 2DXCA 3SDZA 1VQKA 4CRIA 5A0LA 2RH2A 2ZPFB 3MP6A 3R6OA 4YTLA 4EMGA 4M78E 4NS5A 3RIRA 2BUDA 2JUFA 5CR2A 2FHDA 2E10A 3C4SA 4IUTA 1YJ9A 4BY6B 3OS0A 2E12A 5GANg 2VUBA 3C94A 3CMET 3INZA 2ZPIB 2XKOC 4Z02A 3OSVA 2OTJA 2EWNA 2GF7A 2YLBA 3CC7T 4EMKA 3E9FA 4QVCA 2RJEA 5GMKh 1O9SA 2RA2A 1W2BS 3FDRA 5LJ3g 2DD4A 1R8OB 3OB9A 1G3TA 1I4K1 1UGPB 4PLIA 2JZ2A 1DJ7B 3JB9J 1YJWT 5GAMd 1YIJT 1X01A 2YHTA 3M58A 4N4HA 2KDSA 4XU0A 4OGEA 1VQ7T 1VQLA 1GXIE 2FB7A 4IUPA 5KE3A 1VQ9A 2OTJT 2K3YA 5A0GA 4C8QB 4A4EA 4BE1A 3VKIA 5GAOn 2EQUA 3QZ5B 1XTDA 2O4XA 1RL2A 1NZ9A 1BI0A 1QP2A 1MHNA 1NE8A 3SB2A 2E5QA 4ATOA 5FRMA 4N4GA 3JCMe 3JCMX 3RMQA 1P92A 3JCMf 5AYFA 2LDMA 2XIDA 5I21A 3OYJA 2HQXA 1WJSA 5GAOp 3I55A 1U1TA 1VQKT 2RJDA 2BIVA 5GMKi 2DD5A 2P4TA 4RCCA 3OBWA 4FM4B 3JB9D 2HAXA 4M7DG 1WQ7A 2ZPEB 3PIOA 4BUGA 4C8QA 1YJ9T 1PSEA 3M54A 2CS7A 3PGGA 4NOYA 2K4YA 3OY9A 2HQEA 3OMCA 5CKFA 5GAN2 1UGSB 3J81E 2ZPGB 4M77B 5CKEA 4LDVA 1YCYA 4XK8E 3TREA 1FXXA 2WSCE 5GAN7 1M1KC 2E6NA 4J7IA 4A4HA 5CK9A 1Y96A 4C92B 1M8VA 3A8HB 4J5YA 2KAFA 5D6XA 1KHCA 2I2LA 5GAOq 4O6JA 3WVEB 3LWHA 1Q82C 4PJOE 3EFSA 3CCJA 4JS4A 4C8QF 2F5KA 2Y90A 4L5GA 4XTWA 4J6YA 2QEXA 4E7KA 3M5AA 3QJ6A 4O5VA 5LJ3j 4M77A 4EMKC 4RMOA 1VQ9T 3HL8A 3OYHA 5LL6S 1M1KU 5LJ5h 4J83A 2QXFA 3OSSC 5I2MA 5FROA 2GFUA 3S3OA 4E47A 4IKFA 3MCAB 2EJFA 1VQPA 2H3JA 2VXFA 4C92G 2L5QA 1BIBA 4P5NA 3L2QA 3L2RA 2AHJB 3V7RA 3X20B 3HFNA 4OB0B 4XTZA 1Q82U 4C8QD 2CZ6B 3OW2S 2EQMA 3J80E 3RERA 4J8OA 4FU6A 3I55T 1H641 1IZ6A 3JSCA 4BI3A 3S3MA 2VV5A 4M77F 5GAN4 1VQ8T 1I81A 5DM7R 1WGSA 1K9MC 3MP8A 3M57A 3OYIA 3X25B 3CBMA 4C0ZA 3LGLA 5A2QE 4C92F 4PKCC 3DLLA 1N8RC 1AHJB 2JN0A 3JCMh 1FX7A 4QVZA 5DLQE 1JRIA 4ZGDB 3S3NA 3CCET 4L59A 3OYMA 3CXCA 2P0QA 1KHIA 4FIBA 3JCMP 4KUDK 1JBMA 2RHZA 3UDCA 3OS1A 1KQSA 2K2VA 3LGFA 4XQ3A 3HRUA 4DOVA 1KQ1A 2R57A 4C8QC 4F7UG 5LJ5d 5CO7A 3ASKA 5GANe 3BFMA 3M59A 4ZGJB 3CCJT 1K9MU 3HRSA 4B9XA 1YHQA 2QQSA 3VYGA 5GANf 3QYGB 4IURA 1OYXA 5J3BA 2QEXT 5IT9E 5GAN3 1N8RU 1Q7YC 2DTHA 1V29B 4BACA 4OMFB 3C12A 4X9DA 4XU1A 2D6FA 5LJ3e 1OI1A 1KG1A 4OB3B 2E65A 4MDWA 1VQPT 3GNFB 1QVFA 5LJ3f 3MO8A 3QBYA 4M7DE 3V7SA 1HXDA 2LCCA 5D6WA 1UGRB 3M9QA 4MDXA 3HFOA 5FU6B 3JCMd 4M77C 3T9NA 5GMKm 1M4ZA 3NTIA 4VUBA 5GAMg 2DK3A 1Q7YU 3VYHB 3OS2A 1QVGA 1VUBA 2KVQG 1JJ2A 1G5VA 2D9TA 4M7AB 4HCBA 3GLXA 2K3XA 3FRNA 3SD4A 4BDZA 4M75E 2P0KA 5C6SA 4DA4A 4HT9A 3P8HA 2CGHA 3MEAA 2JOYA 4GY5A 2RHUA 4XTXA 2E6ZA 5J26A 2PVOB 5CIUA 4ZGEB 2O01E 4A54A 2XDPA 1KC8C 2L8DA 3A8MB 3CPWA 4PJOA 2EQJA 3HP9A 4IUQA 4IUUA 2MI6A 2EAYA 2JVVA 4KUIA 5J39A 1LOJA 4JRQA 3JB9G 1VQ4A 2EIFA 4FL6A 4M7AA 3OYBA 3CCUA 3CMAA 2LVMA 3I56A 5KCHA 2O4XB 3NFCA 3OMGA 4JJNK 3RESA 3OYDA 2QTXA 3QO3A 2F5TX 2R5AA 5KH6A 1VQ8A 1RI0A 1SSFA 2VXEA 3UPUA 1JB0E 1EIFA 1LNXA 1N6AA 1X6OA 4Y91A 4R56A 1KC8U 1VQ5A 3HRTA 4OB2B 5CQXA 3OYCA 2LRQA 3JCMb 2LX9A 3JB9F 2DO3A 2DZCA 4X9CA 2XDDA 3V8JA 3L2WA 1HK9A 4OGCA 1YI2T 2GQVA 4HCZA 4M7AF 2XD0A 2KSSA 4MZMA 1UEBA 2DVEA 4BD3A 4BE2A 1M5Q1 4D6WA 2M1HA 3H8ZA 5HK3A 2GFAA 4C0FA 3PIPA 1BYMA 5HK0A 3DB3A 1OZ3A 2K57A 4RG8A 4EPCA 2QQRA 3HSBA 2DXUA 5LJ3h 5GAOm 3ER0A 3OYKA 4LDXA 1Y96B 1W4SA 2XU8A 4LDYA 3V8KA 4F7UE 1W2BA 4PJOD 1LJOA 3QIIA 3SFMA 5GAN6 4Y28E 3X24B 2FVUA 4J6XA 3MEVA 4M7AD 2EYQA 3FJPA 4UC4A 4C8QG 2MWOA 3GOXA 2E1HA 2D0QB 4R55A 2HBPA 1WPYA 4RKUE 5A0DA 2ZPHB 2DIQA 2XICA 4JRPA 2RD1A 1VQ4T 3CC2A 4FSXA 2PUOB 3CCUT 2RB6A 4B9WA 3LH0A 3I56T 2DTOA 2ZZDA 4E7JA 2E70A 5GANj 3CMAT 3O8VA 4A4KA 3OQ5A 3TEEA 2M16A 2JTFA 5FU6C 3HHTB 2OAUA 3NTHA 4FT4A 4C0DC 3A8OB 3S6WA 5GMKj 5I2SA 1VQLT 3RUXA 3M56A 1VQ5T 4PJOC 4ZN1A 2E41A 2OTLA 4M78B 5DY9A 2B8AA 4M77G 5LJ3d 3CPFA 4M7AC 2RK2A 4OF1A 2EKOA 3Q1JA 2KY9A 5LJ5g 4NL2A 4RCBA 4JS5A 4V2SA 2XHCA 2FYKA 1YITA 5CVIA 4C0GA 3UT1A 1I5LA 4XTYA 3FB9A 4M75A 3RMSA 2GCXA 3P8BB 2G3RA 4M78A 5FLXE 2Y4XA 3G71A 2LCLA 3GNGA 3PMTA 3CCVA 2PVDB 2RJCA 4QVDA 4HKEA 4TVRA 1G3YA 1BI2A 3RKYA 3CD6A 5GAMe 4C5HA 5GAMf 1QP3A 3TU4K 3KUFA 5EG2A 2ZCFB 2V8IA 2Y4YA 1NJIC 3QKJA 4XTVA 2E64A 3VJPA 4E7LA 3CC2T 3M4YA 3OYLA 2DAQA 4M7DD 3CXCS 2K5FA 3CCEA 3TCJA 1KQSS 3JB9I 2LQKA 4OB1B 4M78F 1VQMA 4LD9K 4MMKA 2QA4T 3N5BB 3PMIA 4A53A 4EMHA 2QQBA 4N0AA 2OTLT 4N4IA 3ZBDA 2RK1A 3PFSA 2DIGA 2LT1A 5GMKe 1NJIU 5HY6A 4JRIA 4M75D 3QYHB 2R5MA 2RHIA 2V8JA 3JCMQ 2QQAA 1QVFS 1ZHIA 5GAN5 4M78D 3EAEA 3F70A 4ELZC 1YITT 3CCLA 4HA8A 4LDUA 1I8FA 2VC8A 2M0OA 4C8QE 2DPPB 1M90C 2QA4A 4C0DB 1G3SA 4X34A 4DQ2A 1K8AC 2EFIA 1QVGS 4PJOB 2RHXA 3G71T 2JTMA 5HKCA 1JJ2S 5GAOl 3CCVT 3VUBA 3PT9A 3UWNA 3CD6T 3BDUA 3H6ZA 1O75A 2R58A 2WACA 3OYGA 3DKMA 1VIEA 1BI3A 3META 3JCMW 4M75C 2IG0A 2V8KA 2LT4A 3L2VA 1N9RA 1M90U 4CI0C 1Q81C 2K5LA 3AHUA 4FT2A 1WQWA 4J7FA 4M78C 1QVPA 3JAME 4NL3A 3CPWS 4PNOA 4M77E 1XOVA 2K5IA 3A8LB 1VQMT 4PJOG 1K8AU 2P0PA 3OYEA 4L6V5 3NTKA 2L89A 5FU7B 3G4SA 2YRVA 1YHQT 4JLGA 5CKDA 4M7AG 1ZBXA 1B34B 4XU3A 3WXMB 4C92E 4EDUA 3PTAA 3CC4A 1IREB 5IN1A 1U8RA 3RKXA 1MGQA 2X4JA 1Y07A 2CZ0B 2X4WA 2ZPBB 3CBPA 3LW5E 4WF2A 3VUZA 3VV0A 3FEOA 3DB4A 1Q81U 1XQHA 3EFRA 4PJOF 3SWNB 3OBYA 3CCLT 1WNLA 4Q5WA 4RG2A 4QQDA 3C95A 3MP1A 5GANh 3GP8A 1BKBA 1Y71A 4JDSA 4N0AC 3G7ZA 1B34A 2DXBA 3HPWA 4ME7A 2ZGWA 2RO0A 4KULA 5LJ5e 4IUVA 4GLKA 1X75C 5LJ5f 3QPHA 3KBGA 4BB7A 4JRKA 3CCMA 2PUKB 4QQ6A 1XNIA 3SWNA 5GAMj 5D6YA 1N9SA 3G6EA 4ZTJA 2KK4A 4E7HA 1YJNA 2MWPA 3OYYA 2KQWA 4M7DB 3LYIA 4C5GA 3FIFA 2CZ1B 3CCRA 4XTUA 2KMTA 3QHSA 3JB9H 2PQWA 3LWIA 1M1GA 1NPRA 2LQ8A 4C5IA 3X28B 3GPLA 1VIFA 2A3LA 3JCMV 3M53A 3V8LA 3G4ST 1Y7XA 2MF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CEY A;  3CC4 T;  4OVA A;  3A5Z B;  3OYN A;  5KE2 A;  3CCS A;  1VQN A;  1S72 A;  3LX7 A;  2CKK A;  2NLU A;  2L3R A;  4BE0 A;  3OA6 A;  3ME9 A;  2LTO A;  3CCM T;  5KCO A;  4ZTF A;  5C0M A;  3G6E T;  3HKS A;  1YJN T;  1WJQ A;  2RI2 A;  3E9G A;  3PNW C;  4II1 A;  4E7I A;  3CCR T;  5FRN A;  3CCQ A;  1VQO A;  3P8D A;  1VQ6 A;  4ZN3 A;  3OW2 A;  1K73 C;  3J7A F;  3CCS T;  1YBY A;  1WJR A;  3DLM A;  4PLL A;  1VQN T;  1S72 T;  1Q86 C;  4A4F A;  3L2U A;  3FLG A;  3FC3 A;  3MEW A;  2BKD N;  1K73 U;  2RHY A;  3LLR A;  2JNG A;  3CME A;  3L42 A;  1KD1 C;  3MEU A;  3CC7 A;  2RJF A;  4QW2 A;  5IAY A;  3BDL A;  2RI5 A;  4C5E A;  4BDY A;  1Q86 U;  1NPP A;  4QQG A;  3OYF A;  5M9O A;  2X35 A;  3CCQ T;  1VQO T;  1YJW A;  2RI3 A;  3OYA A;  1YIJ A;  1VQ7 A;  1H3Z A;  1VQ6 T;  1N27 A;  1KD1 U;  1OZ2 A;  1YI2 A;  4PL6 A;  2X4Y A;  4LD6 A;  4A4G A;  2EQK A;  2VYT A;  2X4X A;  3ZEH A;  2XK0 A;  1VQK A;  4CRI A;  4YTL A;  3MP6 A;  4NS5 A;  2BUD A;  2JUF A;  1YJ9 A;  2FHD A;  3C4S A;  4IUT A;  3OS0 A;  3CME T;  4Z02 A;  2GF7 A;  3CC7 T;  3E9F A;  2RJE A;  1W2B S;  3FDR A;  3OB9 A;  4PLI A;  2JZ2 A;  1YJW T;  1YIJ T;  1VQ7 T;  1VQL A;  4N4H A;  2KDS A;  4IUP A;  5KE3 A;  1VQ9 A;  2OTJ T;  2K3Y A;  4A4E A;  4BE1 A;  2EQU A;  1XTD A;  2O4X A;  1RL2 A;  1NZ9 A;  1MHN A;  2E5Q A;  5FRM A;  4N4G A;  2LDM A;  3OYJ A;  2HQX A;  1WJS A;  3I55 A;  1VQK T;  2RJD A;  2BIV A;  3PIO A;  1YJ9 T;  3OY9 A;  2HQE A;  3OMC A;  3J81 E;  3TRE A;  1M1K C;  2E6N A;  4A4H A;  5D6X A;  1KHC A;  1Q82 C;  3CCJ A;  2F5K A;  2QEX A;  4E7K A;  3QJ6 A;  1VQ9 T;  3OYH A;  5LL6 S;  1M1K U;  5FRO A;  2GFU A;  3S3O A;  4IKF A;  1VQP A;  3L2R A;  3L2Q A;  1Q82 U;  3OW2 S;  2EQM A;  3J80 E;  3I55 T;  4FU6 A;  1IZ6 A;  3S3M A;  5DM7 R;  1WGS A;  1K9M C;  3MP8 A;  3OYI A;  3LGL A;  5A2Q E;  3DLL A;  1N8R C;  5DLQ E;  4QVZ A;  3S3N A;  4L59 A;  3OYM A;  3CXC A;  1KHI A;  2RHZ A;  1KQS A;  3OS1 A;  3LGF A;  2R57 A;  3CCJ T;  3ASK A;  1K9M U;  1YHQ A;  4B9X A;  2QQS A;  2QEX T;  5J3B A;  1OYX A;  4IUR A;  5IT9 E;  1N8R U;  1Q7Y C;  4BAC A;  1OI1 A;  1VQP T;  1QVF A;  3MO8 A;  3QBY A;  2LCC A;  5D6W A;  3M9Q A;  3NTI A;  1Q7Y U;  1QVG A;  3OS2 A;  2KVQ G;  1JJ2 A;  1G5V A;  2D9T A;  2K3X A;  3SD4 A;  4BDZ A;  5C6S A;  2P0K A;  3P8H A;  3MEA A;  2JOY A;  4GY5 A;  2RHU A;  2E6Z A;  5J26 A;  5CIU A;  2XDP A;  1KC8 C;  2L8D A;  3CPW A;  2EQJ A;  4IUQ A;  4IUU A;  2MI6 A;  2JVV A;  5J39 A;  1VQ4 A;  2EIF A;  4FL6 A;  3OYB A;  3CCU A;  3CMA A;  2LVM A;  3I56 A;  5KCH A;  2O4X B;  3OMG A;  3OYD A;  1VQ8 A;  2R5A A;  5KH6 A;  1RI0 A;  1SSF A;  1EIF A;  1X6O A;  1KC8 U;  1VQ5 A;  3OYC A;  2LRQ A;  2DO3 A;  3L2W A;  1YI2 T;  4HCZ A;  4BD3 A;  1UEB A;  4BE2 A;  2M1H A;  3H8Z A;  2GFA A;  3PIP A;  3DB3 A;  1OZ3 A;  2QQR A;  3ER0 A;  3OYK A;  1W2B A;  3QII A;  3MEV A;  4UC4 A;  2MWO A;  3GOX A;  2DIQ A;  1VQ4 T;  3CC2 A;  3CCU T;  3CMA T;  4B9W A;  3I56 T;  3LH0 A;  4E7J A;  2E70 A;  3O8V A;  3OQ5 A;  2M16 A;  2QA4 A;  1VQ8 T;  2JTF A;  3NTH A;  3S6W A;  1VQL T;  1VQ5 T;  4ZN1 A;  2OTL A;  2B8A A;  3CPF A;  2EKO A;  3Q1J A;  2XHC A;  1YIT A;  3UT1 A;  3P8B B;  2G3R A;  5FLX E;  3G71 A;  2LCL A;  3CCV A;  3PMT A;  2RJC A;  4TVR A;  3CD6 A;  4C5H A;  3KUF A;  1NJI C;  3CC2 T;  3QKJ A;  4E7L A;  3OYL A;  2DAQ A;  3CXC S;  3CCE A;  1KQS S;  1VQM A;  2QA4 T;  3PMI A;  2OTL T;  4N4I A;  3PFS A;  2DIG A;  1NJI U;  5HY6 A;  2R5M A;  2RHI A;  1QVF S;  3EAE A;  3F70 A;  1YIT T;  3CCL A;  2M0O A;  1M90 C;  4X34 A;  1K8A C;  1QVG S;  2EFI A;  2RHX A;  3G71 T;  1JJ2 S;  3CCV T;  3UWN A;  3CD6 T;  3H6Z A;  2R58 A;  2WAC A;  3OYG A;  3MET A;  2IG0 A;  3L2V A;  1M90 U;  1Q81 C;  3JAM E;  3CPW S;  3CCE T;  2OTJ A;  1K8A U;  1VQM T;  3OYE A;  1YHQ T;  2L89 A;  3G4S A;  3NTK A;  2YRV A;  4EDU A;  3CC4 A;  5IN1 A;  2X4W A;  3FEO A;  3DB4 A;  1Q81 U;  3CCL T;  4Q5W A;  4RG2 A;  4QQD A;  3MP1 A;  1BKB A;  2RO0 A;  4IUV A;  3KBG A;  3CCM A;  4QQ6 A;  1XNI A;  5D6Y A;  3G6E A;  4ZTJ A;  4E7H A;  1YJN A;  2MWP A;  3OYY A;  3LYI A;  4C5G A;  3CCR A;  2PQW A;  1M1G A;  1NPR A;  2LQ8 A;  4C5I A;  3G4S T; 
#chains in the Genus database with same CATH topology
 2DKG A;  3C0C A;  3CQT A;  3EHR A;  4OMO A;  2XG8 D;  2WSE E;  4ELY C;  3OYN A;  3VS4 A;  1VQN A;  2QDY B;  2M9U A;  1OEB A;  2O2O A;  1X6B A;  1S72 A;  3LX7 A;  3CBO A;  4Y92 A;  5HCK A;  1B3Q A;  1MV0 B;  1MMN A;  2IIM A;  3RNJ A;  3CMA Q;  3CCU Q;  4JLI A;  2FL7 A;  2E3I A;  5KCO A;  1R77 A;  4ZTF A;  2PU9 B;  3HKS A;  1YJN T;  1WJQ A;  2RI2 A;  3UA6 A;  2NUT A;  2PZ1 A;  5FRN A;  5GAO r;  3JCM c;  1GCP A;  3CCQ A;  3BW1 A;  4J9I A;  2VGM A;  4C92 A;  1VQ6 A;  3SWN C;  1WFW A;  3QG1 A;  2VGN A;  2DBM A;  4BY6 C;  3OW2 A;  1K73 C;  4AG2 C;  3J7A F;  1BK2 A;  1WHM A;  4AT1 B;  1WJR A;  3OS5 A;  1MMD A;  3X26 B;  1TUD A;  1Q86 C;  2KRM A;  2ATC B;  3FC3 A;  1UTI A;  4CC2 A;  3MEW A;  3QJY A;  3RR6 A;  1K73 U;  3L42 A;  1MMG A;  3CME A;  2E5K A;  3GBQ A;  1Y0M A;  3MEU A;  1WZO A;  4C5E A;  3QZ9 B;  1Q86 U;  3EG1 A;  5M9O A;  1YJW A;  1H3H A;  1SHF A;  1H3Z A;  3KXT A;  1N27 A;  2RQU A;  3NPF A;  5IXF A;  3BY7 A;  2CT3 A;  2HD0 A;  2J6O A;  4PFO A;  1T3S A;  3OW2 P;  4XAX B;  2DYB A;  3CD6 Q;  2FPF A;  2XK0 A;  2F2V A;  3SHW A;  1NYG A;  4CRI A;  3R6O A;  1MND A;  4M78 E;  4NS5 A;  3RIR A;  1UG1 A;  2E10 A;  4PJJ A;  4BY6 B;  2E12 A;  2ZPI B;  4RTW A;  2GF7 A;  3M0U A;  4KGV B;  2J6F A;  5GMK h;  1EZZ B;  3VRY A;  1O9S A;  2J7I A;  2RA2 A;  1W2B S;  3FDR A;  1R8O B;  1G3T A;  1UGP B;  1ZBJ A;  1X01 A;  1VQ7 T;  2KDS A;  4OGE A;  4J9D A;  1GXI E;  4HVU A;  3CCL Q;  2K2M A;  2K3Y A;  2ROL A;  4C8Q B;  2A0F B;  3VKI A;  3I35 A;  3JV3 A;  1NZ9 A;  1BI0 A;  3SB2 A;  2E5Q A;  2E3H A;  3JCM X;  6AT1 B;  4D8D A;  1PWT A;  1PRM C;  2XID A;  3OYJ A;  2HQX A;  5GAO p;  1VQK T;  2RJD A;  2BIV A;  3OBW A;  2HAX A;  2ZPE B;  4AMC A;  3PGG A;  2K4Y A;  3J81 E;  2C0T A;  2CP5 A;  4LDV A;  1YCY A;  4XK8 E;  3TRE A;  2ED0 A;  2E6N A;  4PFZ A;  4J7I A;  1WHH A;  5CK9 A;  4J5Y A;  3CCJ A;  2Y90 A;  4J6Y A;  2QEX A;  1M1K R;  4O5V A;  1ZSG A;  4EMK C;  1RAE B;  2HKN A;  3REA B;  1OQK A;  2QXF A;  5FRO A;  1Q82 R;  4E47 A;  1HJD A;  4C92 G;  2L5Q A;  2AHJ B;  2CZ6 B;  1X2Q A;  4J8O A;  5KYU A;  3I55 T;  1H64 1;  2RPN A;  5GAN 4;  5DM7 R;  1W70 A;  2O9S A;  1WGS A;  1K9M C;  1YJN Q;  3MP8 A;  3M57 A;  2V1R A;  3CBM A;  2BE7 D;  4PKC C;  2RQW A;  1QWE A;  5DLQ E;  1OPL A;  1XJW B;  1QWF A;  3S3N A;  4FIB A;  2LP5 A;  2RHZ A;  4FW1 A;  3LGF A;  1KQ1 A;  1K9M U;  2L3S A;  3EGD B;  4F04 B;  1V29 B;  2Z0W A;  4OMF B;  2D6F A;  2M0Y A;  1G2B A;  1VQP T;  3GNF B;  2FPD A;  4J9G A;  3V7S A;  1Q7Y R;  5FU6 B;  2K6D A;  4M77 C;  3NTI A;  2CP7 A;  2NYS A;  3G71 Q;  1JJ2 A;  1G5V A;  1GCQ A;  2E4H A;  4HVW A;  3FRN A;  4M75 E;  2JOY A;  1KK7 A;  1RAF B;  5CIU A;  4ZGE B;  2O01 E;  1SSH A;  2DYI A;  4PJO A;  2MI6 A;  2EAY A;  4M7A A;  2ROT A;  5KCH A;  2W10 A;  2ED1 A;  2CUD A;  1TS9 A;  1Q81 R;  2EGA A;  2F5T X;  2R5A A;  1VQ8 A;  2BZ8 A;  1JB0 E;  1LNX A;  1VQ5 A;  5CQX A;  3OYC A;  1IRX A;  4M7A F;  4HCZ A;  2KSS A;  4MZM A;  4BD3 A;  2DVE A;  1M5Q 1;  2M1H A;  3H8Z A;  1UJ0 A;  3PIP A;  5LJ3 h;  4LDX A;  3ER0 A;  3OYK A;  2XU8 A;  4F7U E;  3V8K A;  2GTO A;  3SFM A;  1JJ2 P;  3X24 B;  3MEV A;  1VQ7 Q;  5IHK A;  4UC4 A;  2MWO A;  4R55 A;  1WPY A;  4RKU E;  5GJV B;  1NLO C;  2XIC A;  1QQJ A;  1KIK A;  2RB6 A;  3LH0 A;  2D8J A;  2KR3 A;  2M02 A;  4PJL A;  4A4K A;  2M16 A;  2JTF A;  3HHT B;  2ECZ A;  4FT4 A;  1JXO A;  3A8O B;  2KRN A;  5I2S A;  1VQK Q;  1VQL T;  3M56 A;  1IHW A;  2O31 A;  2EQI A;  4M78 B;  5DY9 A;  5LJ3 d;  4OF1 A;  2H3E B;  1RAB B;  3TSZ A;  1I07 A;  2EPD A;  1JEG A;  4C0G A;  4QT7 A;  8ATC B;  4XTY A;  2YUO A;  2Y4X A;  3G71 A;  3GNG A;  3CCV A;  2PVD B;  2RJC A;  4QVD A;  2CDT A;  2D0N A;  3TU4 K;  2ZCF B;  1D0X A;  1OV3 A;  3VJP A;  4E7L A;  1YN8 A;  3OYL A;  4OMQ A;  1NLP C;  2VAS A;  2LQK A;  2L0A A;  4MMK A;  2CSI A;  3I55 Q;  1LPL A;  1WI7 A;  3CCS Q;  4N0A A;  5KYY B;  1M2O A;  1PC0 A;  3EG9 A;  5GMK e;  1OOT A;  8AT1 B;  4JRI A;  4M75 D;  2R5M A;  2SRC A;  2LQW A;  1UFF A;  3JCM Q;  2V1Q A;  3VS6 A;  2HEQ A;  3F70 A;  1YIT T;  2VC8 A;  2VVK A;  1CKA A;  2JTM A;  1K9A A;  2CUB A;  3EHQ A;  3H6Z A;  3UF4 A;  2LMJ A;  2CT4 A;  1UUE A;  1SKU B;  2AKK A;  1H92 A;  3JCM W;  4M75 C;  3MJX A;  1K8A R;  1N9R A;  2KXC A;  1VQP Q;  1W1F A;  1Q81 C;  2DX1 A;  4FT2 A;  2FZG B;  4J7F A;  1QVP A;  4NL3 A;  4PNO A;  4PJO G;  1HSQ A;  1N5Z A;  3NTK A;  4M7A G;  4JLG A;  1SRM A;  1B34 B;  1ZBX A;  4EDU A;  2X4W A;  3CBP A;  5D7U A;  4WF2 A;  1Q81 U;  3BE3 A;  1XQH A;  1ZSZ C;  3OBY A;  5KYN A;  1WNL A;  2DL5 A;  5FWC A;  3NGP A;  3SEM A;  3KBG A;  4RTU A;  4QQ6 A;  3SWN A;  5GAM j;  1N9S A;  2MIO A;  1ZUY A;  3CCR A;  4XTU A;  2KMT A;  3H41 A;  2FZK B;  2LZ6 B;  1NPR A;  2LQ8 A;  3GPL A;  1VIF A;  2A3L A;  2LNH B;  3AT1 B;  3M53 A;  3G4S T;  4RTY A;  2JS2 A;  3CEY A;  2HDA A;  2DEU A;  1BI1 A;  3GIB A;  5GAN 8;  5KE2 A;  4M75 B;  1M27 C;  4FYY B;  3CCS A;  2PNI A;  3WVD B;  4JUV A;  5L23 A;  5DLO A;  2YLC A;  1UDL A;  1RUW A;  2QTV A;  2IVW A;  2K9G A;  2CKK A;  4RUG A;  4BE0 A;  3OA6 A;  2LTO A;  1EFN A;  3V7C A;  3CCM T;  1D3B A;  3JCM J;  3EGX A;  3G6E T;  2MMP A;  2A36 A;  3QXE B;  1VQL Q;  1W2B P;  2RN8 A;  4II1 A;  3QSU A;  4F14 A;  1FMK A;  2BE9 B;  3M4G A;  3EFO B;  4F7U B;  3A98 A;  1YBY A;  2A28 A;  2LNV A;  3DLM A;  4PLL A;  1PM3 A;  3E19 A;  3O5Z A;  2DXT A;  3A1P A;  1K73 R;  2EBP A;  2DEQ A;  2RM4 A;  3RKW A;  4M7D C;  2JNG A;  4KT0 E;  3L2Z A;  1Q86 R;  2RJF A;  1KFZ A;  5CQY A;  3BDL A;  2A7Y A;  1W6X A;  5ECA A;  1MUZ A;  2QQ9 A;  1VQO T;  1YIJ A;  2LJ0 A;  3I5R A;  1YIT Q;  1F1B B;  1OZ2 A;  1HYO A;  4A4G A;  3EGD A;  2EQK A;  2DVJ A;  2CSQ A;  3PVQ A;  2O88 A;  1TU0 B;  1VYU A;  1R0C B;  3SDZ A;  3QUI A;  5A0L A;  2ZPF B;  4F17 A;  2KRO A;  3M0T A;  4IUT A;  1GBR A;  3CC7 T;  4EMK A;  3E9F A;  2RJE A;  4PK4 A;  2KYB A;  5LJ3 g;  3OB9 A;  1I4K 1;  4PLI A;  1DJ7 B;  4QKU A;  4JPB W;  2YHT A;  3M58 A;  1VQL A;  2FB7 A;  4PJM A;  5KE3 A;  1VQ9 A;  2AZS A;  1TSF A;  5A0G A;  4BE1 A;  2BZX A;  4ZNX A;  2EQU A;  3QZ5 B;  1XTD A;  1QP2 A;  1NE8 A;  5FRM A;  2DRK A;  3TQ7 P;  1T0H A;  1WJS A;  1SRL A;  2JJ9 A;  2DD5 A;  2P4T A;  3JB9 D;  2A08 A;  1PHT A;  4BUG A;  1YJ9 T;  4NOY A;  5CKF A;  1UGS B;  1ACM B;  2DNU A;  3G4S Q;  5D6X A;  5GAO q;  1RI9 A;  1GFC A;  2F5K A;  3VS1 A;  4E7K A;  3M5A A;  4M77 A;  4RMO A;  2QK0 A;  5KYX B;  3HL8 A;  3OYH A;  2DER A;  1MMA A;  4J83 A;  5I2M A;  3MCA B;  2EJF A;  4A63 B;  3L2R A;  1BIB A;  2JMA A;  3HFN A;  4OB0 B;  1WLP B;  2G6F X;  4C8Q D;  2EQM A;  2DRM A;  3CCM Q;  1IZ6 A;  3S3M A;  1X2K A;  4M77 F;  3G6E Q;  3OYI A;  5A2Q E;  4C92 F;  3JCM h;  1GFD A;  1NEB A;  3CC2 Q;  2PTK A;  4FSS A;  4JZ3 A;  1KHI A;  4KUD K;  1K9M R;  1QLY A;  2K2V A;  1M8M A;  3FJ5 A;  4C8Q C;  5CO7 A;  3ASK A;  3BFM A;  3VYG A;  5J3B A;  2DTH A;  4DBF A;  3C12 A;  1BBZ A;  1KG1 A;  1VOM A;  4DEX A;  1HXD A;  5D6W A;  4HXJ A;  3M9Q A;  4MDX A;  2LX7 A;  3HFO A;  2AK5 A;  3JCM d;  1EX4 A;  5IH2 A;  5KYY A;  5GMK m;  1M4Z A;  4IIM A;  5GAM g;  2JW4 A;  2KVQ G;  4J9H A;  1UGV A;  4BDZ A;  2CP3 A;  5C6S A;  3KFV A;  1K0S A;  3P8H A;  3MEA A;  1VQO Q;  4XTX A;  2H8H A;  2RHU A;  1B7T A;  4FYX B;  2XDP A;  2L8D A;  1SHG A;  2EQJ A;  2NUP B;  4IUU A;  5J39 A;  4JJC A;  2CP6 A;  2EIF A;  3CCU A;  3CMA A;  3NFC A;  3OYD A;  2QTX A;  2YWW A;  1RI0 A;  1N6A A;  7AT1 B;  4R56 A;  1ZA1 B;  2LX9 A;  4Z89 A;  3V8J A;  1HK9 A;  1YI2 T;  2MK5 A;  1UEB A;  4BE2 A;  2DE0 X;  3CC7 Q;  1MV3 A;  1BYM A;  5HK0 A;  2QQR A;  3HSB A;  2DXU A;  2QAZ A;  4LDY A;  5GAN 6;  2FVU A;  1AWO A;  4J6X A;  1PKT A;  4DBR A;  3GOX A;  1X43 A;  1VQ4 T;  3CC2 A;  1PRL C;  4RTX A;  5GAN j;  3I56 T;  1NEG A;  4LN2 A;  3OQ5 A;  5FU6 C;  2OAU A;  4C0D C;  5GMK j;  3RUX A;  4OMP A;  4M77 G;  2J06 A;  1YJ9 Q;  1K4U S;  4AFS C;  2W0Z A;  2XHC A;  3THK A;  5CVI A;  3UT1 A;  1I5L A;  3M0S A;  3FB9 A;  4M75 A;  3RMS A;  4AFZ C;  2GCX A;  2G3R A;  3EG3 A;  5FLX E;  1FMV A;  3CD6 A;  2X3W D;  2FRW A;  2QYZ A;  3KUF A;  1RAI B;  2Y4Y A;  3QKJ A;  4XTV A;  1U06 A;  2E64 A;  3M4Y A;  3CXC S;  5KYW B;  3TCJ A;  2F2W A;  1ZSZ A;  1WHL A;  1H8K A;  2QA4 T;  3QDF A;  4EMH A;  1BU1 A;  2OTL T;  2RK1 A;  1SEM A;  2EKH A;  1G83 A;  1Z9Z A;  3EFO A;  2V8J A;  1QVF S;  2QQA A;  4M78 D;  3EAE A;  3CCL A;  1J3T A;  4LDU A;  1I8F A;  2M0O A;  1V76 A;  4C0D B;  2C0O A;  4DQ2 A;  4EIK A;  4WTO B;  3VUB A;  1WHJ A;  1O75 A;  2R58 A;  1KD1 R;  3MET A;  2IG0 A;  2V8K A;  2EYW A;  2P4R A;  3AHU A;  3CPW S;  1WQW A;  4M78 C;  3CCE T;  4KH1 B;  1XOV A;  3VRZ A;  3A8L B;  1VQM T;  2D1X A;  4L6V 5;  3ZL7 C;  1YHQ T;  5FU7 B;  4LNP A;  3WXM B;  1YWO A;  2OAW A;  2FO0 A;  3RKX A;  1MGQ A;  1Y07 A;  3VV0 A;  4LE9 A;  3FEO A;  3DB4 A;  4AG1 C;  3EFR A;  4DEY A;  4PJO F;  4Q5W A;  2HZY A;  2LJ3 A;  4RG2 A;  1TG0 A;  3C95 A;  3GP8 A;  4JDS A;  1M30 A;  3G7Z A;  1U5S A;  4ME7 A;  4ESR A;  2RO0 A;  4IUV A;  4GLK A;  2GNC A;  2QAS A;  3QPH A;  5D6Y A;  1NG2 A;  3EGU A;  2KK4 A;  4E7H A;  1AZE A;  1YJN A;  2KQW A;  3FIF A;  1OU8 A;  3JB9 H;  3QHS A;  1YI2 Q;  3LWI A;  4X1V A;  1M1G A;  4C5I A;  1JO8 A;  3JCM V;  1ZLM A;  1Y7X A;  2NWM A;  4MZP A;  3CC4 T;  3M55 A;  2YRC A;  4DBH A;  2AKL A;  1GL5 A;  2CH4 W;  4M7D A;  1AOJ A;  1GRI A;  3EH2 A;  2WSF E;  1VQ4 Q;  2NLU A;  4OP0 A;  2L3R A;  2KI7 A;  4M7D F;  4M75 G;  4XU2 A;  1M9S A;  1ZQ1 A;  4BI4 A;  3ZFJ A;  3E1S A;  2DL7 A;  2KE9 A;  1RAH B;  4M7A E;  1PSF A;  1FWZ A;  3E9G A;  3PNW C;  2YUN A;  2DL3 A;  1M2V B;  4JZ4 A;  3JCM g;  2MAM A;  2DMO A;  2DTI A;  5GJW B;  1WXB A;  1BCM A;  3P8D A;  4ZN3 A;  5AT1 B;  2LQN A;  1M3A A;  2JMC A;  2PVG B;  2RQR A;  2DM1 A;  2JTE A;  5KYX A;  2LC4 A;  3QDR B;  1VQN T;  1UHC A;  1S72 T;  1UB4 A;  2EGE A;  3MPU B;  3L2U A;  4OMM A;  1WXT A;  1X69 A;  1B07 A;  3A8G B;  3JRZ A;  1QCO A;  2BKD N;  3VU3 C;  5LJ5 j;  1OUL A;  1KD1 C;  2QA4 Q;  4QW2 A;  3R6N A;  5IAY A;  2EJG A;  2RI5 A;  1E7O A;  2OTL Q;  4QQG A;  3OYF A;  4J9F A;  2CH4 A;  2J05 A;  3CCQ T;  5L8R E;  4RTZ A;  1VQ7 A;  1D1C A;  1ABQ A;  4J6W A;  1VQ6 T;  1KD1 U;  1VYT A;  1MNE A;  1YI2 A;  4PL6 A;  4LD6 A;  4BI8 B;  4HT8 A;  4CC3 A;  2DZ9 A;  5GAM h;  1TH7 A;  2C06 A;  4K11 A;  2K3B A;  1WHK A;  1WA7 A;  1VQK A;  3LH5 A;  2MYS A;  4YTL A;  2JXB A;  3MP6 A;  4EMG A;  2JUF A;  2HQH A;  5CR2 A;  2COY A;  3OS0 A;  2AIR B;  5GAN g;  2VUB A;  3C94 A;  3CME T;  1K0X A;  2XKO C;  4Z02 A;  3OSV A;  2EWN A;  2YLB A;  4QVC A;  1YHQ Q;  1IO6 A;  1QCF A;  2DD4 A;  2L3Q A;  3JB9 J;  1YJW T;  5GAM d;  1JQQ A;  3H0I A;  1WHG A;  2OTJ T;  4A4E A;  5GAO n;  1RL2 A;  4ATO A;  3RMQ A;  2YUQ A;  5AYF A;  5I21 A;  1D0Y A;  1KSW A;  3I55 A;  1U1T A;  5GMK i;  4RCC A;  3D7S B;  2DFU A;  4FM4 B;  4M7D G;  1BCO A;  4OML A;  4C8Q A;  3M54 A;  2CS7 A;  3OY9 A;  2HQE A;  3OMC A;  2ZPG B;  2AT1 B;  5CKE A;  5GAN 7;  1FXX A;  4A4H A;  3CC4 Q;  3A8H B;  2I2L A;  4JS4 A;  4C8Q F;  4L5G A;  2KBT A;  3ULR B;  1YP5 A;  5LL6 S;  2C0I A;  2GFU A;  3S3O A;  2B86 A;  1VQP A;  2H3J A;  2VXF A;  3X20 B;  2P84 A;  3RER A;  4FU6 A;  1RLQ C;  4BI3 A;  4HCK A;  1I81 A;  1AWJ A;  2HKQ B;  4E2F B;  4C0Z A;  2V26 A;  2DA9 A;  3LGL A;  3DLL A;  1N8R C;  1AHJ B;  2JN0 A;  1QKW A;  4L59 A;  3OYM A;  1OX9 A;  2P0Q A;  3CXC A;  3JCM P;  1JBM A;  4XQ3 A;  3HRU A;  1UJY A;  4LUD A;  3CCJ T;  4ZGJ B;  3HRS A;  1YHQ A;  1TXQ A;  3QYG B;  2QEX T;  3UA7 A;  2CP2 A;  1N8R U;  1VQN Q;  2XMF A;  1S72 Q;  2RQV A;  5LJ3 e;  4OB3 B;  4MDW A;  1QVF A;  2EVR A;  3MO8 A;  5LJ3 f;  2FZC B;  2LCC A;  1UGR B;  3HTR A;  3T9N A;  4VUB A;  3VYH B;  1VUB A;  2D9T A;  4M7A B;  2K3X A;  3SD4 A;  4DA4 A;  1C6V X;  4HT9 A;  5IHI A;  2CGH A;  2PVO B;  1VQ6 Q;  1KC8 C;  2K79 A;  1JXM A;  3CPW A;  1ZX6 A;  2EW3 A;  4ANJ A;  1PD0 A;  3JB9 G;  2JVV A;  4JRQ A;  2DBK A;  1LOJ A;  3CXC P;  4FL6 A;  2DIL A;  3OYB A;  1D09 B;  2OJ2 A;  2LVM A;  2O4X B;  4JJN K;  2OI3 A;  4KGZ B;  5KH6 A;  2ENM A;  3UPU A;  2K7A A;  4Y91 A;  1KC8 U;  4OB2 B;  2EGC A;  2XDD A;  4X9C A;  9ATC B;  3L2W A;  3CME Q;  1QVF P;  2XD0 A;  2RF0 A;  2EYX A;  1WIE A;  1YWP A;  5HK3 A;  2GFA A;  2BTT A;  2K57 A;  4EPC A;  1Y96 B;  1W4S A;  1PNJ A;  2YT6 A;  4Y28 E;  1YJW Q;  2COW A;  2EYQ A;  3FJP A;  4C8Q G;  5FW9 A;  2E1H A;  1SF9 A;  2OTJ Q;  2ZPH B;  1SG5 A;  2DIQ A;  2RD1 A;  2HMA A;  4FSX A;  1I1J A;  3CPW P;  2ZZD A;  4E7J A;  3TEE A;  1VQ8 T;  3NTH A;  3S6W A;  1VQ5 T;  1M3C A;  2HSE B;  4ZN1 A;  2E41 A;  3CPF A;  2EKO A;  3Q1J A;  2KY9 A;  3EG0 A;  5LJ5 g;  4NL2 A;  4RCB A;  2JM8 A;  4JS5 A;  1A0N B;  1SPK A;  1YIT A;  4WCI A;  4M78 A;  2LCL A;  3H9N A;  4HKE A;  3RKY A;  5GAM e;  4C5H A;  5GAM f;  1QP3 A;  3EG9 B;  2V8I A;  2K5F A;  1KQS S;  4OB1 B;  4M78 F;  2D8H A;  1ZUU A;  3N5B B;  3PMI A;  4E6R A;  4A53 A;  4PFP A;  2QQB A;  1LCK A;  3ZBD A;  1M2V A;  2KNB B;  3PFS A;  2DIG A;  5HY6 A;  2VB6 A;  1M3B A;  3QYH B;  3UAT A;  5GAN 5;  4CC4 B;  4LXC A;  1R0B G;  3REB B;  1M90 C;  2KT1 A;  1G3S A;  4X34 A;  4PJN A;  2EFI A;  1QVG S;  2RHX A;  3G71 T;  3CCJ Q;  5HKC A;  3CCV T;  3UWN A;  2QEX Q;  3BDU A;  4FYW B;  2WAC A;  3OYG A;  2YXY A;  3DKM A;  1VIE A;  2RMO A;  2LT4 A;  1M90 U;  4CI0 C;  2K5L A;  2GGR A;  3VS7 A;  2OTJ A;  4M77 E;  2L89 A;  3G4S A;  2YRV A;  2HSP A;  4C92 E;  3PTA A;  4D8K A;  1IRE B;  3QWX X;  5IN1 A;  1X27 A;  2SEM A;  2X4J A;  2ZPB B;  2MCN A;  3LW5 E;  2OX7 A;  3E2U A;  3SWN B;  3H0F A;  3MP1 A;  5GAN h;  1BKB A;  4Z8A A;  2ESW A;  1B34 A;  3HPW A;  1AZG B;  4KUL A;  1X75 C;  4JRK A;  3CCM A;  2PUK B;  1XNI A;  4KGX B;  3G6E A;  2MWP A;  3OYY A;  4C5G A;  2CZ1 B;  4GLM A;  2RQT A;  2MF2 A;  4OVA A;  5GAN d;  3A5Z B;  2X51 A;  1D3B B;  1BIA A;  3EGX B;  1D1A A;  1D0Z A;  1JU5 C;  2CYZ B;  2AZV A;  2YSQ A;  4R0K A;  5CKB A;  3PE0 A;  4MML A;  2BZY A;  2EJ9 A;  1ABO A;  3H0H A;  3ME9 A;  5GMK l;  2HNI A;  1UGQ B;  1AD5 A;  2KT8 A;  2YUP A;  5C0M A;  2CP0 A;  1VQ8 Q;  4M78 G;  1NBE B;  4DBQ A;  2XDB A;  5FU7 C;  1GBQ A;  1VQ5 Q;  1T0J A;  4E7I A;  4DOW A;  3CCR T;  1VQO A;  2DET A;  2DL8 A;  3I9Q A;  4M75 F;  5CKH A;  3MHX A;  4MZT A;  2A37 A;  2GQI A;  3CCS T;  4KBM B;  4RTV A;  1RAA B;  4HCC A;  2DJZ A;  4AFU C;  4LUE A;  2DL4 A;  4FW2 A;  1ZA2 B;  2I0N A;  4A4F A;  3FLG A;  1U1S A;  1OU9 A;  2YDL A;  5CCA A;  2RHY A;  3LLR A;  3NHN A;  4F7U A;  4M77 D;  3CC7 A;  1T3L A;  2CZ7 B;  2COZ A;  3VS5 A;  4C92 D;  4BDY A;  5EC7 A;  1G3W A;  1NPP A;  3URG A;  2X35 A;  2F69 A;  2RI3 A;  3OYA A;  1ZUK A;  4F7U F;  1KQ2 A;  2QGF B;  1E6G A;  2O9V A;  2X4Y A;  1KJW A;  2XI9 A;  3GF5 A;  2VYT A;  2X4X A;  5CAI A;  3L1A A;  1S1N A;  3CCV Q;  2QI2 A;  4EMK B;  1NYF A;  4LDW A;  1M1F A;  4C92 C;  3ZEH A;  1QW1 A;  2DXC A;  5IXB A;  1IB8 A;  2KEA A;  2RH2 A;  2BUD A;  3TSW A;  2FHD A;  3C4S A;  1YJ9 A;  1TOV A;  3INZ A;  2LJ1 A;  4GBQ A;  4HVV A;  1HD3 A;  4KH0 B;  2JZ2 A;  3RDV A;  1YIJ T;  1G8X A;  4N4H A;  4XU0 A;  3EG2 A;  4IUP A;  3VS0 A;  2JM9 A;  5FWB A;  2O4X A;  1MHN A;  4IIO A;  4N4G A;  3JCM e;  1CSK A;  1P92 A;  3JCM f;  2LDM A;  1UE9 A;  1VYV A;  2EYZ A;  2DF6 A;  1WQ7 A;  3PIO A;  1PSE A;  1WXU A;  5GAN 2;  2NUT B;  4M77 B;  2WSC E;  2RNA A;  1M1K C;  1PG5 B;  1Y96 A;  3I56 Q;  4C92 B;  1M8V A;  2KAF A;  1KHC A;  2JT4 A;  2QGG A;  4O6J A;  3WVE B;  1C0M A;  2M51 A;  3LWH A;  1Q82 C;  3EFS A;  4PJO E;  4XTW A;  2L3P A;  2ZAE A;  3QJ6 A;  4F16 A;  5LJ3 j;  1VQ9 T;  1M1K U;  5LJ5 h;  3OSS C;  3U23 A;  2JS0 A;  4IKF A;  5IHN A;  3L2Q A;  1PD1 A;  1AT1 B;  4P5N A;  3V7R A;  3EH1 A;  1Q82 U;  4XTZ A;  3OW2 S;  3J80 E;  1C1A A;  3JSC A;  2VV5 A;  4KRT A;  3VS2 A;  1X6G A;  3G1J A;  3X25 B;  2VWF A;  2X3X D;  3CCR Q;  1FYN A;  2LCS A;  3PVL A;  1FX7 A;  4QVZ A;  1JRI A;  1TWB A;  4ZGD B;  2DLP A;  3I5S A;  3UDC A;  3OS1 A;  1TTH B;  1KQS A;  4F7U G;  4DOV A;  5LJ5 d;  2R57 A;  1I0C A;  5GAN e;  3M59 A;  1N8R R;  3QWY A;  4B9X A;  2QQS A;  5GAN f;  1NJI R;  4IUR A;  1K1Z A;  1OYX A;  1AWW A;  5IT9 E;  5GAN 3;  2F2X A;  1Q7Y C;  4BAC A;  3VS3 A;  4X9D A;  2KRS A;  4XU1 A;  2KXD A;  1OI1 A;  3M0Q A;  3RBB B;  1FMW A;  2E65 A;  4M7D E;  1IHV A;  3QBY A;  2HL5 C;  4JJD A;  1QKX A;  2YRD A;  3NMZ C;  2DK3 A;  1Q7Y U;  1QVG A;  3OS2 A;  4J9E A;  4HCB A;  3GLX A;  2VKN A;  2P0K A;  1BB9 A;  4FCY A;  4GY5 A;  2HL3 A;  2E6Z A;  5J26 A;  4A54 A;  3A8M B;  3CCE Q;  1YFN A;  4J9B A;  1VQM Q;  3HP9 A;  4KUI A;  4IUQ A;  2FRY A;  1V1C A;  1VQ4 A;  1Z9Q A;  2ABL A;  1KQS P;  3I56 A;  1IGU A;  1QCN A;  3OMG A;  3RES A;  2X9H A;  1KC8 R;  3QO3 A;  1K76 A;  1SSF A;  2VXE A;  1EIF A;  2F1L A;  1X6O A;  3HRT A;  2HCK A;  1WYX A;  2LRQ A;  3JCM b;  3JB9 F;  2NUP A;  2DO3 A;  2DZC A;  2KGT A;  4OGC A;  5I11 A;  2GQV A;  4D6W A;  1Y57 A;  1NM7 A;  4C0F A;  3DB3 A;  1OZ3 A;  4RG8 A;  4ORZ A;  5GAO m;  4J9C A;  1W2B A;  1QVG P;  4PJO D;  2MOX A;  1LJO A;  1YCS B;  3QII A;  1VA7 A;  1TUG B;  1YIJ Q;  4M7A D;  1LVK A;  2D0Q B;  2HBP A;  5A0D A;  4E7S A;  4JRP A;  1CKB A;  1GCQ C;  2PUO B;  3CCU T;  3CMA T;  4B9W A;  2DTO A;  2E70 A;  3M0P A;  3O8V A;  1IXD A;  2QA4 A;  1AWX A;  1UHF A;  2QG9 B;  5KYU B;  4PJO C;  2OTL A;  1YNZ A;  2B8A A;  4CC7 A;  4M4Z A;  4M7A C;  2RK2 A;  1U3O A;  2J6K A;  2MPX C;  4V2S A;  2FYK A;  1OPK A;  1UEC A;  2QDL A;  4FYV B;  3MKD A;  3P8B B;  1ZSZ B;  3PMT A;  3TVT A;  4TVR A;  1G3Y A;  1BI2 A;  1PKS A;  1VQ9 Q;  1TUC A;  4AFQ C;  4RTT A;  5EG2 A;  1OX8 A;  1NJI C;  3CC2 T;  1RAG B;  2DAQ A;  4M7D D;  3CCE A;  3JB9 I;  1VQM A;  4LD9 K;  1IGQ A;  1ARK A;  1E6H A;  4B6M A;  2HBW A;  4OMN A;  2L2P A;  4N4I A;  2LT1 A;  1NJI U;  3M0R A;  1RAC B;  5KYW A;  2RHI A;  1ZHI A;  2DJQ A;  4JJB A;  3IQL A;  4ELZ C;  1PCX A;  4HA8 A;  4C8Q E;  2DPP B;  1K8A C;  4PJO B;  1JJ2 S;  5GAO l;  3PT9 A;  2NUZ A;  3CD6 T;  2EYY A;  5I22 A;  1AVZ C;  1M90 R;  3CCQ Q;  1BI3 A;  3L2V A;  3JAM E;  1K8A U;  2K5I A;  2P0P A;  3OYE A;  4E7Z A;  2IPO B;  1AEY A;  5CKD A;  4XU3 A;  3CC4 A;  1U8R A;  4Z88 A;  3VUZ A;  2CZ0 B;  2KYM A;  2FG0 A;  3CCL T;  4QQD A;  1D1B A;  1Y71 A;  4N0A C;  1I5O B;  2DXB A;  1WX6 A;  2ZGW A;  2CRE A;  2FEI A;  5LJ5 e;  5LJ5 f;  2GTJ A;  4BB7 A;  1RAD B;  4ZTJ A;  1WDX A;  1QMC A;  1RLP C;  4M7D B;  3LYI A;  2PQW A;  2GBQ A;  3X28 B;  2FPE A;  3V8L A;  1Q95 G; 
#chains in the Genus database with same CATH homology
 3CEY A;  2DKG A;  4MZP A;  3CC4 T;  4OVA A;  5GAN d;  3A5Z B;  3M55 A;  2XG8 D;  1BI1 A;  2WSE E;  4ELY C;  3GIB A;  5GAN 8;  3OYN A;  5KE2 A;  4M7D A;  4M75 B;  3CCS A;  1D3B B;  1BIA A;  3WVD B;  1VQN A;  2QDY B;  2M9U A;  4JUV A;  5DLO A;  2YLC A;  2CYZ B;  1S72 A;  5CKB A;  3LX7 A;  4MML A;  2IVW A;  2CKK A;  2WSF E;  3CBO A;  2EJ9 A;  2NLU A;  4OP0 A;  2L3R A;  4BE0 A;  3OA6 A;  3ME9 A;  4JLI A;  5GMK l;  2HNI A;  2LTO A;  4M7D F;  2FL7 A;  4M75 G;  3V7C A;  3CCM T;  1D3B A;  4XU2 A;  5KCO A;  1M9S A;  1UGQ B;  1ZQ1 A;  4ZTF A;  4BI4 A;  3JCM J;  3ZFJ A;  5C0M A;  3E1S A;  2PU9 B;  4M78 G;  3G6E T;  2MMP A;  2XDB A;  3HKS A;  5FU7 C;  3QXE B;  4M7A E;  1PSF A;  1YJN T;  1FWZ A;  1WJQ A;  2RI2 A;  3E9G A;  3PNW C;  4II1 A;  4E7I A;  4DOW A;  3QSU A;  3CCR T;  5FRN A;  5GAO r;  3JCM c;  3CCQ A;  3BW1 A;  1VQO A;  3JCM g;  2MAM A;  2DTI A;  2VGM A;  4C92 A;  3P8D A;  3M4G A;  4M75 F;  1VQ6 A;  4ZN3 A;  3SWN C;  5CKH A;  3QG1 A;  2VGN A;  4BY6 C;  3MHX A;  4MZT A;  3OW2 A;  2PVG B;  1K73 C;  3J7A F;  4F7U B;  3CCS T;  1YBY A;  4KBM B;  1WJR A;  2LNV A;  3DLM A;  4PLL A;  2LC4 A;  3QDR B;  1VQN T;  3OS5 A;  3E19 A;  4HCC A;  2DJZ A;  1S72 T;  1UB4 A;  3X26 B;  2DXT A;  1Q86 C;  4A4F A;  3L2U A;  3FLG A;  3FC3 A;  2DEQ A;  3A8G B;  1U1S A;  2RM4 A;  3MEW A;  3JRZ A;  2BKD N;  3QJY A;  3RKW A;  1K73 U;  5CCA A;  3VU3 C;  4M7D C;  2RHY A;  3LLR A;  2JNG A;  3L42 A;  5LJ5 j;  4F7U A;  4M77 D;  3CME A;  1KD1 C;  3MEU A;  4KT0 E;  3L2Z A;  3CC7 A;  2RJF A;  4QW2 A;  5IAY A;  2CZ7 B;  2EJG A;  3BDL A;  2A7Y A;  2RI5 A;  5CQY A;  4C5E A;  3QZ9 B;  4C92 D;  1G3W A;  1NPP A;  4BDY A;  1Q86 U;  4QQG A;  3OYF A;  5M9O A;  3URG A;  2X35 A;  2F69 A;  2QQ9 A;  3CCQ T;  1VQO T;  1YJW A;  2RI3 A;  3OYA A;  5L8R E;  1YIJ A;  1VQ7 A;  1H3Z A;  4J6W A;  4F7U F;  3KXT A;  1N27 A;  1KQ2 A;  1VQ6 T;  1KD1 U;  1OZ2 A;  3BY7 A;  1YI2 A;  4PL6 A;  2X4Y A;  2XI9 A;  3GF5 A;  4LD6 A;  4A4G A;  2EQK A;  2HD0 A;  4BI8 B;  2VYT A;  4HT8 A;  2X4X A;  2DZ9 A;  5CAI A;  5GAM h;  3L1A A;  1TH7 A;  2C06 A;  2QI2 A;  4XAX B;  4EMK B;  4LDW A;  1M1F A;  4C92 C;  3ZEH A;  2XK0 A;  1QW1 A;  3QUI A;  2DXC A;  3SDZ A;  1VQK A;  4CRI A;  5A0L A;  2RH2 A;  2ZPF B;  3MP6 A;  3R6O A;  4YTL A;  4EMG A;  4M78 E;  4NS5 A;  3RIR A;  2BUD A;  2JUF A;  5CR2 A;  2FHD A;  2E10 A;  3C4S A;  4IUT A;  1YJ9 A;  4BY6 B;  3OS0 A;  2E12 A;  5GAN g;  2VUB A;  3C94 A;  3CME T;  3INZ A;  2ZPI B;  2XKO C;  4Z02 A;  3OSV A;  2OTJ A;  2EWN A;  2GF7 A;  2YLB A;  3CC7 T;  4EMK A;  3E9F A;  4QVC A;  2RJE A;  5GMK h;  1O9S A;  2RA2 A;  1W2B S;  3FDR A;  5LJ3 g;  2DD4 A;  1R8O B;  3OB9 A;  1G3T A;  1I4K 1;  1UGP B;  4PLI A;  2JZ2 A;  1DJ7 B;  3JB9 J;  1YJW T;  5GAM d;  1YIJ T;  1X01 A;  2YHT A;  3M58 A;  4N4H A;  2KDS A;  4XU0 A;  4OGE A;  1VQ7 T;  1VQL A;  1GXI E;  2FB7 A;  4IUP A;  5KE3 A;  1VQ9 A;  2OTJ T;  2K3Y A;  5A0G A;  4C8Q B;  4A4E A;  4BE1 A;  3VKI A;  5GAO n;  2EQU A;  3QZ5 B;  1XTD A;  2O4X A;  1RL2 A;  1NZ9 A;  1BI0 A;  1QP2 A;  1MHN A;  1NE8 A;  3SB2 A;  2E5Q A;  4ATO A;  5FRM A;  4N4G A;  3JCM e;  3JCM X;  3RMQ A;  1P92 A;  3JCM f;  5AYF A;  2LDM A;  2XID A;  5I21 A;  3OYJ A;  2HQX A;  1WJS A;  5GAO p;  3I55 A;  1U1T A;  1VQK T;  2RJD A;  2BIV A;  5GMK i;  2DD5 A;  2P4T A;  4RCC A;  3OBW A;  4FM4 B;  3JB9 D;  2HAX A;  4M7D G;  1WQ7 A;  2ZPE B;  3PIO A;  4BUG A;  4C8Q A;  1YJ9 T;  1PSE A;  3M54 A;  2CS7 A;  3PGG A;  4NOY A;  2K4Y A;  3OY9 A;  2HQE A;  3OMC A;  5CKF A;  5GAN 2;  1UGS B;  3J81 E;  2ZPG B;  4M77 B;  5CKE A;  4LDV A;  1YCY A;  4XK8 E;  3TRE A;  1FXX A;  2WSC E;  5GAN 7;  1M1K C;  2E6N A;  4J7I A;  4A4H A;  5CK9 A;  1Y96 A;  4C92 B;  1M8V A;  3A8H B;  4J5Y A;  2KAF A;  5D6X A;  1KHC A;  2I2L A;  5GAO q;  4O6J A;  3WVE B;  3LWH A;  1Q82 C;  4PJO E;  3EFS A;  3CCJ A;  4JS4 A;  4C8Q F;  2F5K A;  2Y90 A;  4L5G A;  4XTW A;  4J6Y A;  2QEX A;  4E7K A;  3M5A A;  3QJ6 A;  4O5V A;  5LJ3 j;  4M77 A;  4EMK C;  4RMO A;  1VQ9 T;  3HL8 A;  3OYH A;  5LL6 S;  1M1K U;  5LJ5 h;  4J83 A;  2QXF A;  3OSS C;  5I2M A;  5FRO A;  2GFU A;  3S3O A;  4E47 A;  4IKF A;  3MCA B;  2EJF A;  1VQP A;  2H3J A;  2VXF A;  4C92 G;  2L5Q A;  1BIB A;  4P5N A;  3L2Q A;  3L2R A;  2AHJ B;  3V7R A;  3X20 B;  3HFN A;  4OB0 B;  4XTZ A;  1Q82 U;  4C8Q D;  2CZ6 B;  3OW2 S;  2EQM A;  3J80 E;  3RER A;  4J8O A;  4FU6 A;  3I55 T;  1H64 1;  1IZ6 A;  3JSC A;  4BI3 A;  3S3M A;  2VV5 A;  4M77 F;  5GAN 4;  1VQ8 T;  1I81 A;  5DM7 R;  1WGS A;  1K9M C;  3MP8 A;  3M57 A;  3OYI A;  3X25 B;  3CBM A;  4C0Z A;  3LGL A;  5A2Q E;  4C92 F;  4PKC C;  3DLL A;  1N8R C;  1AHJ B;  2JN0 A;  3JCM h;  1FX7 A;  4QVZ A;  5DLQ E;  1JRI A;  4ZGD B;  3S3N A;  3CCE T;  4L59 A;  3OYM A;  3CXC A;  2P0Q A;  1KHI A;  4FIB A;  3JCM P;  4KUD K;  1JBM A;  2RHZ A;  3UDC A;  3OS1 A;  1KQS A;  2K2V A;  3LGF A;  4XQ3 A;  3HRU A;  4DOV A;  1KQ1 A;  2R57 A;  4C8Q C;  4F7U G;  5LJ5 d;  5CO7 A;  3ASK A;  5GAN e;  3BFM A;  3M59 A;  4ZGJ B;  3CCJ T;  1K9M U;  3HRS A;  4B9X A;  1YHQ A;  2QQS A;  3VYG A;  5GAN f;  3QYG B;  4IUR A;  1OYX A;  5J3B A;  2QEX T;  5IT9 E;  5GAN 3;  1N8R U;  1Q7Y C;  2DTH A;  1V29 B;  4BAC A;  4OMF B;  3C12 A;  4X9D A;  4XU1 A;  2D6F A;  5LJ3 e;  1OI1 A;  1KG1 A;  4OB3 B;  2E65 A;  4MDW A;  1VQP T;  3GNF B;  1QVF A;  5LJ3 f;  3MO8 A;  3QBY A;  4M7D E;  3V7S A;  1HXD A;  2LCC A;  5D6W A;  1UGR B;  3M9Q A;  4MDX A;  3HFO A;  5FU6 B;  3JCM d;  4M77 C;  3T9N A;  5GMK m;  1M4Z A;  3NTI A;  4VUB A;  5GAM g;  2DK3 A;  1Q7Y U;  3VYH B;  3OS2 A;  1QVG A;  1VUB A;  2KVQ G;  1JJ2 A;  1G5V A;  2D9T A;  4M7A B;  4HCB A;  3GLX A;  2K3X A;  3FRN A;  3SD4 A;  4BDZ A;  4M75 E;  2P0K A;  5C6S A;  4DA4 A;  4HT9 A;  3P8H A;  2CGH A;  3MEA A;  2JOY A;  4GY5 A;  2RHU A;  4XTX A;  2E6Z A;  5J26 A;  2PVO B;  5CIU A;  4ZGE B;  2O01 E;  4A54 A;  2XDP A;  1KC8 C;  2L8D A;  3A8M B;  3CPW A;  4PJO A;  2EQJ A;  3HP9 A;  4IUQ A;  4IUU A;  2MI6 A;  2EAY A;  2JVV A;  4KUI A;  5J39 A;  1LOJ A;  4JRQ A;  3JB9 G;  1VQ4 A;  2EIF A;  4FL6 A;  4M7A A;  3OYB A;  3CCU A;  3CMA A;  2LVM A;  3I56 A;  5KCH A;  2O4X B;  3NFC A;  3OMG A;  4JJN K;  3RES A;  3OYD A;  2QTX A;  3QO3 A;  2F5T X;  2R5A A;  5KH6 A;  1VQ8 A;  1RI0 A;  1SSF A;  2VXE A;  3UPU A;  1JB0 E;  1EIF A;  1LNX A;  1N6A A;  1X6O A;  4Y91 A;  4R56 A;  1KC8 U;  1VQ5 A;  3HRT A;  4OB2 B;  5CQX A;  3OYC A;  2LRQ A;  3JCM b;  2LX9 A;  3JB9 F;  2DO3 A;  2DZC A;  4X9C A;  2XDD A;  3V8J A;  3L2W A;  1HK9 A;  4OGC A;  1YI2 T;  2GQV A;  4HCZ A;  4M7A F;  2XD0 A;  2KSS A;  4MZM A;  1UEB A;  2DVE A;  4BD3 A;  4BE2 A;  1M5Q 1;  4D6W A;  2M1H A;  3H8Z A;  5HK3 A;  2GFA A;  4C0F A;  3PIP A;  1BYM A;  5HK0 A;  3DB3 A;  1OZ3 A;  2K57 A;  4RG8 A;  4EPC A;  2QQR A;  3HSB A;  2DXU A;  5LJ3 h;  5GAO m;  3ER0 A;  3OYK A;  4LDX A;  1Y96 B;  1W4S A;  2XU8 A;  4LDY A;  3V8K A;  4F7U E;  1W2B A;  4PJO D;  1LJO A;  3QII A;  3SFM A;  5GAN 6;  4Y28 E;  3X24 B;  2FVU A;  4J6X A;  3MEV A;  4M7A D;  2EYQ A;  3FJP A;  4UC4 A;  4C8Q G;  2MWO A;  3GOX A;  2E1H A;  2D0Q B;  4R55 A;  2HBP A;  1WPY A;  4RKU E;  5A0D A;  2ZPH B;  2DIQ A;  2XIC A;  4JRP A;  2RD1 A;  1VQ4 T;  3CC2 A;  4FSX A;  2PUO B;  3CCU T;  2RB6 A;  4B9W A;  3LH0 A;  3I56 T;  2DTO A;  2ZZD A;  4E7J A;  2E70 A;  5GAN j;  3CMA T;  3O8V A;  4A4K A;  3OQ5 A;  3TEE A;  2M16 A;  2JTF A;  5FU6 C;  3HHT B;  2OAU A;  3NTH A;  4FT4 A;  4C0D C;  3A8O B;  3S6W A;  5GMK j;  5I2S A;  1VQL T;  3RUX A;  3M56 A;  1VQ5 T;  4PJO C;  4ZN1 A;  2E41 A;  2OTL A;  4M78 B;  5DY9 A;  2B8A A;  4M77 G;  5LJ3 d;  3CPF A;  4M7A C;  2RK2 A;  4OF1 A;  2EKO A;  3Q1J A;  2KY9 A;  5LJ5 g;  4NL2 A;  4RCB A;  4JS5 A;  4V2S A;  2XHC A;  2FYK A;  1YIT A;  5CVI A;  4C0G A;  3UT1 A;  1I5L A;  4XTY A;  3FB9 A;  4M75 A;  3RMS A;  2GCX A;  3P8B B;  2G3R A;  4M78 A;  5FLX E;  2Y4X A;  3G71 A;  2LCL A;  3GNG A;  3PMT A;  3CCV A;  2PVD B;  2RJC A;  4QVD A;  4HKE A;  4TVR A;  1G3Y A;  1BI2 A;  3RKY A;  3CD6 A;  5GAM e;  4C5H A;  5GAM f;  1QP3 A;  3TU4 K;  3KUF A;  5EG2 A;  2ZCF B;  2V8I A;  2Y4Y A;  1NJI C;  3QKJ A;  4XTV A;  2E64 A;  3VJP A;  4E7L A;  3CC2 T;  3M4Y A;  3OYL A;  2DAQ A;  4M7D D;  3CXC S;  2K5F A;  3CCE A;  3TCJ A;  1KQS S;  3JB9 I;  2LQK A;  4OB1 B;  4M78 F;  1VQM A;  4LD9 K;  4MMK A;  2QA4 T;  3N5B B;  3PMI A;  4A53 A;  4EMH A;  2QQB A;  4N0A A;  2OTL T;  4N4I A;  3ZBD A;  2RK1 A;  3PFS A;  2DIG A;  2LT1 A;  5GMK e;  1NJI U;  5HY6 A;  4JRI A;  4M75 D;  3QYH B;  2R5M A;  2RHI A;  2V8J A;  3JCM Q;  2QQA A;  1QVF S;  1ZHI A;  5GAN 5;  4M78 D;  3EAE A;  3F70 A;  4ELZ C;  1YIT T;  3CCL A;  4HA8 A;  4LDU A;  1I8F A;  2VC8 A;  2M0O A;  4C8Q E;  2DPP B;  1M90 C;  2QA4 A;  4C0D B;  1G3S A;  4X34 A;  4DQ2 A;  1K8A C;  2EFI A;  1QVG S;  4PJO B;  2RHX A;  3G71 T;  2JTM A;  5HKC A;  1JJ2 S;  5GAO l;  3CCV T;  3VUB A;  3PT9 A;  3UWN A;  3CD6 T;  3BDU A;  3H6Z A;  1O75 A;  2R58 A;  2WAC A;  3OYG A;  3DKM A;  1VIE A;  1BI3 A;  3MET A;  3JCM W;  4M75 C;  2IG0 A;  2V8K A;  2LT4 A;  3L2V A;  1N9R A;  1M90 U;  4CI0 C;  1Q81 C;  2K5L A;  3AHU A;  4FT2 A;  1WQW A;  4J7F A;  4M78 C;  1QVP A;  3JAM E;  4NL3 A;  3CPW S;  4PNO A;  4M77 E;  1XOV A;  2K5I A;  3A8L B;  1VQM T;  4PJO G;  1K8A U;  2P0P A;  3OYE A;  4L6V 5;  3NTK A;  2L89 A;  5FU7 B;  3G4S A;  2YRV A;  1YHQ T;  4JLG A;  5CKD A;  4M7A G;  1ZBX A;  1B34 B;  4XU3 A;  3WXM B;  4C92 E;  4EDU A;  3PTA A;  3CC4 A;  1IRE B;  5IN1 A;  1U8R A;  3RKX A;  1MGQ A;  2X4J A;  1Y07 A;  2CZ0 B;  2X4W A;  2ZPB B;  3CBP A;  3LW5 E;  4WF2 A;  3VUZ A;  3VV0 A;  3FEO A;  3DB4 A;  1Q81 U;  1XQH A;  3EFR A;  4PJO F;  3SWN B;  3OBY A;  3CCL T;  1WNL A;  4Q5W A;  4RG2 A;  4QQD A;  3C95 A;  3MP1 A;  5GAN h;  3GP8 A;  1BKB A;  1Y71 A;  4JDS A;  4N0A C;  3G7Z A;  1B34 A;  2DXB A;  3HPW A;  4ME7 A;  2ZGW A;  2RO0 A;  4KUL A;  5LJ5 e;  4IUV A;  4GLK A;  1X75 C;  5LJ5 f;  3QPH A;  3KBG A;  4BB7 A;  4JRK A;  3CCM A;  2PUK B;  4QQ6 A;  1XNI A;  3SWN A;  5GAM j;  5D6Y A;  1N9S A;  3G6E A;  4ZTJ A;  2KK4 A;  4E7H A;  1YJN A;  2MWP A;  3OYY A;  2KQW A;  4M7D B;  3LYI A;  4C5G A;  3FIF A;  2CZ1 B;  3CCR A;  4XTU A;  2KMT A;  3QHS A;  3JB9 H;  2PQW A;  3LWI A;  1M1G A;  1NPR A;  2LQ8 A;  4C5I A;  3X28 B;  3GPL A;  1VIF A;  2A3L A;  3JCM V;  3M53 A;  3V8L A;  3G4S T;  1Y7X A;  2MF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...