2LVPC

Gp78cue domain bound to the distal ubiquitin of k48-linked diubiquitin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Promiscuous Interactions of gp78 E3 Ligase CUE Domain with Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/ligase
molecule keywords Ubiquitin
total genus 13
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lvpC00
2JY8A 3FE3A 1MN3A 5DFLA 2BWBA 3LCVB 3LCUA 2B3TA 1ZMVA 1A5TA 1PGYA 1UFZA 1KYIA 1V92A 1VEGA 1ZMUA 2OO9A 3K9OA 3GLFE 3B89A 2G3QA 1TR8A 1NV8A 1WR1B 1E94E 1ZV1A 2QSFX 2EKKA 3T6PA 2KNAA 1G3IA 2LVNC 1OTRA 2LBCA 1Q02A 2ZTCA 2JY5A 1VG5A 1G4AE 2RRUA 2BWEA 1T43A 4UN2B 1VEKA 1VQ1A 2KNZA 2LVPC 1DV0A 2MROB 2K0BX 1HJPA 4G3OA 1HQYE 4HEOA 1JR3E 1DO2A 1IM2A 2L4EA 2KHHA 3IECA 1WGNA 2LVAA 2JY6B 2JP7A 2MJ5B 2JNHA 3K9PA 2DAIA 1WJ7A 1OKSA 1P3QQ 1TTEA 3E21A 1WHCA 2K9DA 2QNJA 2MR9A 4F2LA 4Q7JA 1DO0A 2HAKA 4F1IA 2DI0A 3GLGE 4WP2A 1NV9A 1YLAA 1EFUB 1HT2E 2LVQD 2R0IA 2DNAA 2QHOB 1T6OA 2DAGA 1R4GA 2WZJA 2LTUA 3MMPA 2EKFA 1OQYA 3IHPA 2DHYA 2JY7A 3GLHE 1XXHE 1F4IA 1AIPC 2L2DA 2O25A 2MGWA 1OAIA 3E46A 1GO5A 1XB2B 2EJSA 1WIVA 2L4FA 1CUKA 2H5XA 2ZTDA 2DAMA 2JUJA 2CWBA 1G41A 1SG9A 2JZ1A 2OOAA 4GEWA 5JI2E 2CP8A 3FRIA 1C7YA 2LVOC 3BBZA 3H4JA 2DENA 4R71A 3GLIE 1Y8GA 2DAEA 2HWJA 1QZEA 2KNVA 1IFYA 1ZMWA 1VDLA 2OOBA 2DZLA 4DBGB 1VEJA 2JZ0A 1HT1E 2DAKA 1IXSA 1WGLA 2DKLA 3F92A 3FRHA 1BVSA
chains in the Genus database with same CATH superfamily
2XEPA 3U6CA 3HKPA 4B7HA 1MN3A 2LHCA 2BWBA 4L8RC 3HY5A 2XLJA 2KDLA 5E6JA 4DV2M 3M6AA 2X4AA 3VDPA 3A46A 1EIJA 2G3QA 4LF6M 4DV6M 3TQSA 2X49A 5EJCA 2Y20A 5IWAM 5IZ7D 4MGHA 1WR1B 1G71A 1W5SA 2EKKA 2KZUA 4G6ZA 2D7EA 2DZOB 4S12A 1ZAEA 2O5RA 2LBCA 2V1UA 1Q02A 1OFIA 2FH0A 2DHRA 3AOGA 1NVMA 2CFOA 3GLFA 1VEKA 3HGIA 4X64M 4CIZA 2L09A 3B7ZA 1K3XA 1JB0F 3KW6A 4LF5M 4D81A 2ZBKB 3C3DA 1IXZA 1DGFA 4Y28F 3GLHB 2KHHA 3IECA 4AW4A 3R9XB 2JY6B 5ITYA 4PT5A 2VQFM 1L1TA 4ITQA 3HJQA 3GO8A 3GPUA 3K9PA 2DAIA 3HU3A 2LXEA 1JQJC 1AUAA 3U6EA 1N77A 3HU1A 2QNJA 3LQRA 2C96A 3HHXA 5LMNM 2HAKA 1JR3A 1QAOA 5EQTA 4WP2A 4LRSA 8CATA 3GLGE 2R46A 4JXJA 3DZDA 4AKIA 3ILKA 3VK7A 2LVQD 4DR1M 1IN8A 2XSZA 3I4VA 1T6OA 1R4GA 3AFHA 4GC5A 4FCWA 4P17A 4RKUF 4MGYE 4DR5M 3HZJA 3U6OA 4B3RM 4KODA 2P5TA 2LTUA 3B9PA 2XZFA 3KSJA 1MX0A 2EKFA 1OQYA 3MMPA 3KOYE 3QYBA 3SYLA 1HNZM 3IHPA 2QZ4A 2DHYA 3GQ3A 1AIPC 3SAVA 1XHBA 1Z5AA 1NY5A 2UUBM 4LY6A 1XXHA 5EP4A 4EIWA 3U6MA 1Q3BA 4RNAA 3KFUG 3VKHA 2X8AA 4DV7M 2UUCM 1WIVA 2F5PA 2H5XA 2KW0A 2JUJA 2R18A 4NL4H 4LJ8A 3D8LA 5FTNA 2EA0A 3ZCBB 1G41A 4OVZB 3UK6A 1IQPA 3ZQJA 5JI2E 2YR0A 4JI5M 1DGHB 1NJFA 4DV4M 5EP3A 5FTMA 2R44A 3B7NA 2DENA 3CTWB 3L28A 1MU5A 1TH4A 4M9XA 4JI1M 2FS1A 2F4VM 1Y8GA 2OQ4A 3VDUA 3U61A 4JI6M 4REZA 4K0KM 2KEBA 2KNVA 4LGMA 1NJGA 3MHVC 3CF0A 2OOBA 4DBGB 4KT0F 1VEJA 4NSOB 2QENA 3RFWA 1T3TA 3KOZE 3JR4A 2YNMD 5ITXE 4D80A 4PDIA 1PJQA 3L27A 2DKLA 3J7AS 4OX9M 2FE8A 3PNYA 2XFSA 3K92A 4LJ6A 3FE3A 4X66M 4CISA 3SAWA 3I01M 1LTMA 3GP1A 3U6DA 2GNOA 3SASA 5ITQA 2ZAOA 3LCUA 3GQ5A 3JR5A 3K9OA 1ZMUA 2OO9A 3SMPA 4RF1A 3TWMA 4WW0A 5C1BA 4CHTB 1XMQM 2HKJA 3D8BA 3WHLA 1IY2A 1E94E 4I8OA 3A45A 2APLA 1G3IA 2R45A 3FUVA 1DGHA 2LVNC 1J09A 4LF8M 3KS8A 2ZANA 2ZTCA 4G4OA 1QUTA 1QZMA 1VG5A 1G4AE 4ANRA 3VK8A 1E9RA 2DZNB 3U6PA 3KVWA 3HHWA 2L7HA 2E5LM 2XGNA 1TH3A 1DV0A 1L8QA 2W82A 2K0BX 4MB7A 3RGSA 1GVNA 3TE6A 2R4JA 5FLXS 1IN5A 1JR3E 1IM2A 1GLNA 5FTJA 4WURA 2CV2A 3L26A 3UGJA 1HR0M 1IBMM 2UU9M 3PFIA 2K6BA 2LVAA 3DOAA 4JYAM 3AKZA 4JI3M 3T1HM 2JP7A 2JNHA 4FD2A 2OPFA 1I4WA 1OKSA 3QWLA 4LZZA 1WHCA 2K9DA 2RGOA 4Q7JA 2QQ8A 3GLFB 2CHGA 1DO0A 3U5ZB 2HCBA 3LVVA 4IBBA 1L2CA 1NV9A 1YLAA 4AQYM 1EFUB 1QAMA 3TWKA 3W0FA 4FCTA 2R0IA 1OJLA 2R65A 2G5GX 4I5SA 5DYGA 3RE8A 2DAGA 3IG5A 4NRVA 1OAOC 3KS4A 1E9SA 3HHYA 3HJ8A 4MGKE 4KHPM 5F3WA 2DWZB 2AHMA 2KZSA 3NBXX 4RF0A 3MK6A 3V76A 2Z4SA 4Z8XA 3TWLA 2VF8A 4YHHM 4DR2M 3EIEA 2HHHM 2O01F 1XXHE 5GKNA 5DYIA 4LG2A 1R6BX 4NC6A 4XGIA 4AG6A 1NHWC 4MM3B 1GJTA 3C3EA 4IBGA 1OAIA 3E46A 1XB2B 1Z59A 3HWSA 3Q8XA 1NHGC 1D2NA 1Q39A 3UJNA 3FTDA 4HL4A 2DAMA 1D0KA 3W68A 1I94M 1N33M 1NY6A 3BXWA 4II7A 3U60A 2VIIA 4IJEA 4B3SM 3Q8GA 1JR3D 3AV0A 5KQDA 1SG9A 2CE7A 3C9PA 1TDHA 2JZ1A 3GRRA 4FWHA 4MGZE 4CGYB 2QCUA 1Q3CA 1YE9A 3FRIA 1C7YA 4IBJA 4R71A 1PJTA 2L6OA 3GLIE 2Z3XA 4DR4M 2MH8A 3L29A 2HWJA 5A2QS 4QOSA 4LRTA 4QNMA 2Y0TA 3FTEA 1ZMWA 1EE8A 5FTKA 1C1KA 1PM5A 2NQ8C 2UXCM 1N78A 3FKEA 4XBOA 3VKGA 4LJ7A 2XH9A 3U60B 4IJFA 4B7FA 2QBYB 1VDDA 2EO2A 3CF6E 5EXTA 4FCVA 2CHQA 2FNAA 1G8PA 4I4LA 4G4NA 4JV5M 3HJSA 4W5WA 1QQWA 2M60A 3F92A 1BVSA 1OIZA 2JY8A 4LJ5A 1HQCA 4TUWA 3FUXA 4DV1M 4NSRA 4LFAM 1PJJA 2CV0A 3H4MA 1GL6A 4X65M 1RU3A 5FSWA 1SXJE 5KPZA 2J7NA 1X37A 1TDZA 4NOOB 2B3TA 4XK8F 1KFVA 1A5TA 1PGYA 1UFZA 1VEGA 3K2LA 4JN6A 5LMUM 1N34M 3FYDA 3SAUA 3GLFE 1XWIA 2KRUA 1GL7A 4L4UA 3B7QA 4AZFA 4L6V6 4GC9A 4IBEA 5EP1A 3J81S 2ZAMA 1TR8A 3FUUA 3KOWE 3AL0C 1NNUC 4AKGA 2KNAA 2RKOA 2VQEM 1YSYA 2R6FA 3AJIB 2JY5A 2XFTA 3GLGB 4BLCA 1IN6A 2RRUA 2BWEA 3GRUA 5BPVA 2D7GA 1T43A 4UN2B 3ZC7B 2I7NA 2KNZA 2LNHC 4QNRA 2LVPC 2QP9X 2ZM6M 3CF2A 3B74A 3KSXA 1OIPA 3NWLA 3M7GA 5EXPA 2Z8YM 3SHFA 1XMOM 1K82A 3T15A 1HQYE 4PD2A 4FW9A 1DO2A 2L4EA 1TGUA 2G8LA 2FOIC 4L16A 4PCZA 5KPTA 1IBLM 4B3MM 5ITTA 2KXEA 3KOXE 3L25A 3SBJA 3L2AA 3SARA 2J5YA 3PVSA 4DR6M 2UXBM 1J7KA 3E21A 2M5ZA 1TTEA 1Z5BA 3J2PB 3KDSE 4L78A 3GPXA 2C98A 2CEAA 4B08A 1FJGM 2CHVA 4F2LA 3QAUA 4F1IA 2C9OA 5H37D 3LMMA 1HT2E 1S3SA 1L2DA 2LHGA 2DNAA 2R4EA 3AOEA 3TPZA 4BBAA 3SC3A 3U6SA 2WZJA 4JI0M 2FFJA 2LWXA 1OFHA 5ITUA 5BR8M 4OVZA 1GABA 3HU2A 2GQFA 1UM8A 4LF4M 3W67A 3GQ4A 3DA1A 1K3WA 4NRWA 2JY7A 3GLHE 5DNYA 3I51A 2CRUA 2F5NA 4LZJA 2BJWA 4B3TM 2F5QA 1F4IA 4D82A 4LCBA 4G4QA 2O25A 2WSEF 1XC8A 3DFZA 3U5ZA 3GLIA 1IN7A 4QHTA 4AKHA 1H6UA 3QYEA 5KO3A 1DGGA 2L4FA 3C58A 1CUKA 1YUBA 3SATA 3BOSA 1QVRA 1IY0A 4GEWA 3LQQA 4IBDA 2CP8A 2LVOC 2XF3A 2Z7JA 3H4JA 2DXIA 3HHZA 4R3DA 4KLNA 1R2ZA 2R62A 4DV0M 3WHKA 1QZEA 3JAMS 3LW5F 5ITRA 5ITXA 3K1JA 1E32A 1XXHB 1V33A 3A42A 3J80S 3TL4X 4LF7M 1IFYA 2JXNA 2BNKA 2HL7A 1VDLA 4MGIE 2K47A 1N36M 4FWDA 4FVMA 1PRBA 3CGWA 2A5YB 4DUYM 3HX3A 4MH0E 5EXXA 2CV1A 3FTCA 3GRVA 1Z6TA 1IXSA 1IBKM 1SXJC 3KXEC 2I7PA 3LVWA 1QDTA 3FRHA 2CUZA 3FUTA 3U6QA 3UMMA 2EUCA 1QDRA 2UUAM 5C18A 1FNNA 4GH9A 5DFLA 4GHLA 3PNVA 1R5LA 3LCVB 4DV3M 1XNRM 2N35A 2YQZA 5E26A 2XSZD 4B7GA 4R7GA 1ZMVA 1V92A 3U6LA 1KYIA 2LH0A 1N32M 4LJAA 3SHGB 3B89A 4ZPXA 3GLIB 1SXJD 1J5EM 4IBKA 4DR7M 3IG8A 4GHAA 4LGYA 1NV8A 4QHSA 1ZV1A 2QSFX 3ZH9B 3T6PA 3E4RA 3GLHA 4L15A 1PJIA 1LV7A 1OTRA 1QYRA 2XZUA 3K8ZA 4AG5A 1V34A 4IBFA 4GITA 2QPAA 1NNJA 4LF9M 3A98B 3T1YM 1VQ1A 3R8FA 4GKKM 4HLQA 4LFCM 2Y21A 2MROB 2RGHA 3SYKA 2BJVA 1SXJA 5IREB 3I4YA 1SXJB 4NXMM 1HJPA 4G3OA 4GRIA 4HEOA 4CJ6A 4DV5M 3M0EA 4AI6A 4LJ9A 1QUSA 1WGNA 4FWGA 4M9ZA 1D0MA 2VDBB 3FTFA 1GJSA 2JA2A 4BB9A 2MJ5B 1ZQ9A 4GMQA 4I81A 4LJ4A 1TF0B 1WJ7A 1P3QQ 4IIWA 2KA6B 2MR9A 1NO1A 3W0LB 1GKIA 2J7OA 2V1CA 4M9SA 3FD9A 3GPPA 3U61B 1PJSA 2DI0A 4M0DA 3AOEC 4NXNM 4LFBM 2F5OA 4IBCA 3UZUA 3FUWA 5KPRA 5EXSA 2WSCF 3SMSA 2DVWB 2QHOB 5FTLA 2UXDM 1XNQM 3KP0E 3MJ5A 1D0LA 4A3VB 7CATA 3NBIA 3GPYA 2H1RA 2L7IA 4PDGA 1IXRC 1WXQA 2WSFF 3E9SA 3GLGA 4IBIA 1G59A 1DGBA 4GIPA 3J7BA 2L2DA 3I04M 4JI8M 1IN4A 2JWSA 2Q2EB 3THGA 2MGWA 4Z6YA 2D7HA 2C99A 2VF7A 1GO5A 1N75A 2DWLA 4OU7A 2EJSA 4X62M 4P16A 5KQ8A 2ZTDA 1L1ZA 1Z5CA 1TH2A 1IY1A 2CWBA 4KO8A 1IXSB 2KRKA 1HNXM 4DR3M 4M0WA 2DWMA 2C5RA 1KSFX 2OOAA 3VLFB 2Y0QA 3KP1E 2F5SA 1W5TA 3BBZA 2ERCA 5EP2A 4DUZM 4GKJM 4QOZC 4JI7M 3RGPA 3EIHA 2Z4RA 1NSFA 2DAEA 5IT9S 2DWNA 2YFQA 1R7RA 1ORYB 3SFZA 5JI3E 1QANA 1L2BA 2QBYA 2DZLA 1QAQA 4JI4M 1HNWM 3PXGA 3VFDA 4G4RA 3FYCA 2JZ0A 3T38A 2C9CA 1HT1E 2DAKA 3GRYA 3OTOM 2V6ZM 1WGLA 4OW0A 4YY3M 1MJGM 1R2YA 4JI2M 3J27B 5L8RF
chains in the Genus database with same CATH topology
2JY8A 3FE3A 1MN3A 5DFLA 2BWBA 3LCVB 3LCUA 2B3TA 1ZMVA 1A5TA 1PGYA 1UFZA 1KYIA 1V92A 1VEGA 1ZMUA 2OO9A 3K9OA 3GLFE 3B89A 2G3QA 1TR8A 1NV8A 1WR1B 1E94E 1ZV1A 2QSFX 2EKKA 3T6PA 2KNAA 1G3IA 2LVNC 1OTRA 2LBCA 1Q02A 2ZTCA 2JY5A 1VG5A 1G4AE 2RRUA 2BWEA 1T43A 4UN2B 1VEKA 1VQ1A 2KNZA 2LVPC 1DV0A 2MROB 2K0BX 1HJPA 4G3OA 1HQYE 4HEOA 1JR3E 1DO2A 1IM2A 2L4EA 2KHHA 3IECA 1WGNA 2LVAA 2JY6B 2JP7A 2MJ5B 2JNHA 3K9PA 2DAIA 1WJ7A 1OKSA 1P3QQ 1TTEA 3E21A 1WHCA 2K9DA 2QNJA 2MR9A 4F2LA 4Q7JA 1DO0A 2HAKA 4F1IA 2DI0A 3GLGE 4WP2A 1NV9A 1YLAA 1EFUB 1HT2E 2LVQD 2R0IA 2DNAA 2QHOB 1T6OA 2DAGA 1R4GA 2WZJA 2LTUA 3MMPA 2EKFA 1OQYA 3IHPA 2DHYA 2JY7A 3GLHE 1XXHE 1F4IA 1AIPC 2L2DA 2O25A 2MGWA 1OAIA 3E46A 1GO5A 1XB2B 2EJSA 1WIVA 2L4FA 1CUKA 2H5XA 2ZTDA 2DAMA 2JUJA 2CWBA 1G41A 1SG9A 2JZ1A 2OOAA 4GEWA 5JI2E 2CP8A 3FRIA 1C7YA 2LVOC 3BBZA 3H4JA 2DENA 4R71A 3GLIE 1Y8GA 2DAEA 2HWJA 1QZEA 2KNVA 1IFYA 1ZMWA 1VDLA 2OOBA 2DZLA 4DBGB 1VEJA 2JZ0A 1HT1E 2DAKA 1IXSA 1WGLA 2DKLA 3F92A 3FRHA 1BVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JY8 A;  3FE3 A;  1MN3 A;  5DFL A;  2BWB A;  3LCV B;  3LCU A;  2B3T A;  1ZMV A;  1A5T A;  1PGY A;  1UFZ A;  1KYI A;  1V92 A;  1VEG A;  1ZMU A;  2OO9 A;  3K9O A;  3GLF E;  3B89 A;  2G3Q A;  1TR8 A;  1NV8 A;  1WR1 B;  1E94 E;  1ZV1 A;  2QSF X;  2EKK A;  3T6P A;  2KNA A;  1G3I A;  2LVN C;  1OTR A;  2LBC A;  1Q02 A;  2ZTC A;  2JY5 A;  1VG5 A;  1G4A E;  2RRU A;  2BWE A;  1T43 A;  4UN2 B;  1VEK A;  1VQ1 A;  2KNZ A;  2LVP C;  1DV0 A;  2MRO B;  2K0B X;  1HJP A;  4G3O A;  1HQY E;  4HEO A;  1JR3 E;  1DO2 A;  1IM2 A;  2L4E A;  2KHH A;  3IEC A;  1WGN A;  2LVA A;  2JY6 B;  2JP7 A;  2MJ5 B;  2JNH A;  3K9P A;  2DAI A;  1WJ7 A;  1OKS A;  1P3Q Q;  1TTE A;  3E21 A;  1WHC A;  2K9D A;  2QNJ A;  2MR9 A;  4F2L A;  4Q7J A;  1DO0 A;  2HAK A;  4F1I A;  2DI0 A;  3GLG E;  4WP2 A;  1NV9 A;  1YLA A;  1EFU B;  1HT2 E;  2LVQ D;  2R0I A;  2DNA A;  2QHO B;  1T6O A;  2DAG A;  1R4G A;  2WZJ A;  2LTU A;  3MMP A;  2EKF A;  1OQY A;  3IHP A;  2DHY A;  2JY7 A;  3GLH E;  1XXH E;  1F4I A;  1AIP C;  2L2D A;  2O25 A;  2MGW A;  1OAI A;  3E46 A;  1GO5 A;  1XB2 B;  2EJS A;  1WIV A;  2L4F A;  1CUK A;  2H5X A;  2ZTD A;  2DAM A;  2JUJ A;  2CWB A;  1G41 A;  1SG9 A;  2JZ1 A;  2OOA A;  4GEW A;  5JI2 E;  2CP8 A;  3FRI A;  1C7Y A;  2LVO C;  3BBZ A;  3H4J A;  2DEN A;  4R71 A;  3GLI E;  1Y8G A;  2DAE A;  2HWJ A;  1QZE A;  2KNV A;  1IFY A;  1ZMW A;  1VDL A;  2OOB A;  2DZL A;  4DBG B;  1VEJ A;  2JZ0 A;  1HT1 E;  2DAK A;  1IXS A;  1WGL A;  2DKL A;  3F92 A;  3FRH A;  1BVS A; 
#chains in the Genus database with same CATH topology
 2XEP A;  3U6C A;  3HKP A;  4B7H A;  1MN3 A;  2LHC A;  2BWB A;  4L8R C;  3HY5 A;  2XLJ A;  2KDL A;  5E6J A;  4DV2 M;  3M6A A;  2X4A A;  3VDP A;  3A46 A;  1EIJ A;  2G3Q A;  4LF6 M;  4DV6 M;  3TQS A;  2X49 A;  5EJC A;  2Y20 A;  5IWA M;  5IZ7 D;  4MGH A;  1WR1 B;  1G71 A;  1W5S A;  2EKK A;  2KZU A;  4G6Z A;  2D7E A;  2DZO B;  4S12 A;  1ZAE A;  2O5R A;  2LBC A;  2V1U A;  1Q02 A;  1OFI A;  2FH0 A;  2DHR A;  3AOG A;  1NVM A;  2CFO A;  3GLF A;  1VEK A;  3HGI A;  4X64 M;  4CIZ A;  2L09 A;  3B7Z A;  1K3X A;  1JB0 F;  3KW6 A;  4LF5 M;  4D81 A;  2ZBK B;  3C3D A;  1IXZ A;  1DGF A;  4Y28 F;  3GLH B;  2KHH A;  3IEC A;  4AW4 A;  3R9X B;  2JY6 B;  5ITY A;  4PT5 A;  2VQF M;  1L1T A;  4ITQ A;  3HJQ A;  3GO8 A;  3GPU A;  3K9P A;  2DAI A;  3HU3 A;  2LXE A;  1JQJ C;  1AUA A;  3U6E A;  1N77 A;  3HU1 A;  2QNJ A;  3LQR A;  2C96 A;  3HHX A;  5LMN M;  2HAK A;  1JR3 A;  1QAO A;  5EQT A;  4WP2 A;  4LRS A;  8CAT A;  3GLG E;  2R46 A;  4JXJ A;  3DZD A;  4AKI A;  3ILK A;  3VK7 A;  2LVQ D;  4DR1 M;  1IN8 A;  2XSZ A;  3I4V A;  1T6O A;  1R4G A;  3AFH A;  4GC5 A;  4FCW A;  4P17 A;  4RKU F;  4MGY E;  4DR5 M;  3HZJ A;  3U6O A;  4B3R M;  4KOD A;  2P5T A;  2LTU A;  3B9P A;  2XZF A;  3KSJ A;  1MX0 A;  2EKF A;  1OQY A;  3MMP A;  3KOY E;  3QYB A;  3SYL A;  1HNZ M;  3IHP A;  2QZ4 A;  2DHY A;  3GQ3 A;  1AIP C;  3SAV A;  1XHB A;  1Z5A A;  1NY5 A;  2UUB M;  4LY6 A;  1XXH A;  5EP4 A;  4EIW A;  3U6M A;  1Q3B A;  4RNA A;  3KFU G;  3VKH A;  2X8A A;  4DV7 M;  2UUC M;  1WIV A;  2F5P A;  2H5X A;  2KW0 A;  2JUJ A;  2R18 A;  4NL4 H;  4LJ8 A;  3D8L A;  5FTN A;  2EA0 A;  3ZCB B;  1G41 A;  4OVZ B;  3UK6 A;  1IQP A;  3ZQJ A;  5JI2 E;  2YR0 A;  4JI5 M;  1DGH B;  1NJF A;  4DV4 M;  5EP3 A;  5FTM A;  2R44 A;  3B7N A;  2DEN A;  3CTW B;  3L28 A;  1MU5 A;  1TH4 A;  4M9X A;  4JI1 M;  2FS1 A;  2F4V M;  1Y8G A;  2OQ4 A;  3VDU A;  3U61 A;  4JI6 M;  4REZ A;  4K0K M;  2KEB A;  2KNV A;  4LGM A;  1NJG A;  3MHV C;  3CF0 A;  2OOB A;  4DBG B;  4KT0 F;  1VEJ A;  4NSO B;  2QEN A;  3RFW A;  1T3T A;  3KOZ E;  3JR4 A;  2YNM D;  5ITX E;  4D80 A;  4PDI A;  1PJQ A;  3L27 A;  2DKL A;  3J7A S;  4OX9 M;  2FE8 A;  3PNY A;  2XFS A;  3K92 A;  4LJ6 A;  3FE3 A;  4X66 M;  4CIS A;  3SAW A;  3I01 M;  1LTM A;  3GP1 A;  3U6D A;  2GNO A;  3SAS A;  5ITQ A;  2ZAO A;  3LCU A;  3GQ5 A;  3JR5 A;  3K9O A;  1ZMU A;  2OO9 A;  3SMP A;  4RF1 A;  3TWM A;  4WW0 A;  5C1B A;  4CHT B;  1XMQ M;  2HKJ A;  3D8B A;  3WHL A;  1IY2 A;  1E94 E;  4I8O A;  3A45 A;  2APL A;  1G3I A;  2R45 A;  3FUV A;  1DGH A;  2LVN C;  1J09 A;  4LF8 M;  3KS8 A;  2ZAN A;  2ZTC A;  4G4O A;  1QUT A;  1QZM A;  1VG5 A;  1G4A E;  4ANR A;  3VK8 A;  1E9R A;  2DZN B;  3U6P A;  3KVW A;  3HHW A;  2L7H A;  2E5L M;  2XGN A;  1TH3 A;  1DV0 A;  1L8Q A;  2W82 A;  2K0B X;  4MB7 A;  3RGS A;  1GVN A;  3TE6 A;  2R4J A;  5FLX S;  1IN5 A;  1JR3 E;  1IM2 A;  1GLN A;  5FTJ A;  4WUR A;  2CV2 A;  3L26 A;  3UGJ A;  1HR0 M;  1IBM M;  2UU9 M;  3PFI A;  2K6B A;  2LVA A;  3DOA A;  4JYA M;  3AKZ A;  4JI3 M;  3T1H M;  2JP7 A;  2JNH A;  4FD2 A;  2OPF A;  1I4W A;  1OKS A;  3QWL A;  4LZZ A;  1WHC A;  2K9D A;  2RGO A;  4Q7J A;  2QQ8 A;  3GLF B;  2CHG A;  1DO0 A;  3U5Z B;  2HCB A;  3LVV A;  4IBB A;  1L2C A;  1NV9 A;  1YLA A;  4AQY M;  1EFU B;  1QAM A;  3TWK A;  3W0F A;  4FCT A;  2R0I A;  1OJL A;  2R65 A;  2G5G X;  4I5S A;  5DYG A;  3RE8 A;  2DAG A;  3IG5 A;  4NRV A;  1OAO C;  3KS4 A;  1E9S A;  3HHY A;  3HJ8 A;  4MGK E;  4KHP M;  5F3W A;  2DWZ B;  2AHM A;  2KZS A;  3NBX X;  4RF0 A;  3MK6 A;  3V76 A;  2Z4S A;  4Z8X A;  3TWL A;  2VF8 A;  4YHH M;  4DR2 M;  3EIE A;  2HHH M;  2O01 F;  1XXH E;  5GKN A;  5DYI A;  4LG2 A;  1R6B X;  4NC6 A;  4XGI A;  4AG6 A;  1NHW C;  4MM3 B;  1GJT A;  3C3E A;  4IBG A;  1OAI A;  3E46 A;  1XB2 B;  1Z59 A;  3HWS A;  3Q8X A;  1NHG C;  1D2N A;  1Q39 A;  3UJN A;  3FTD A;  4HL4 A;  2DAM A;  1D0K A;  3W68 A;  1I94 M;  1N33 M;  1NY6 A;  3BXW A;  4II7 A;  3U60 A;  2VII A;  4IJE A;  4B3S M;  3Q8G A;  1JR3 D;  3AV0 A;  5KQD A;  1SG9 A;  2CE7 A;  3C9P A;  1TDH A;  2JZ1 A;  3GRR A;  4FWH A;  4MGZ E;  4CGY B;  2QCU A;  1Q3C A;  1YE9 A;  3FRI A;  1C7Y A;  4IBJ A;  4R71 A;  1PJT A;  2L6O A;  3GLI E;  2Z3X A;  4DR4 M;  2MH8 A;  3L29 A;  2HWJ A;  5A2Q S;  4QOS A;  4LRT A;  4QNM A;  2Y0T A;  3FTE A;  1ZMW A;  1EE8 A;  5FTK A;  1C1K A;  1PM5 A;  2NQ8 C;  2UXC M;  1N78 A;  3FKE A;  4XBO A;  3VKG A;  4LJ7 A;  2XH9 A;  3U60 B;  4IJF A;  4B7F A;  2QBY B;  1VDD A;  2EO2 A;  3CF6 E;  5EXT A;  4FCV A;  2CHQ A;  2FNA A;  1G8P A;  4I4L A;  4G4N A;  4JV5 M;  3HJS A;  4W5W A;  1QQW A;  2M60 A;  3F92 A;  1BVS A;  1OIZ A;  2JY8 A;  4LJ5 A;  1HQC A;  4TUW A;  3FUX A;  4DV1 M;  4NSR A;  4LFA M;  1PJJ A;  2CV0 A;  3H4M A;  1GL6 A;  4X65 M;  1RU3 A;  5FSW A;  1SXJ E;  5KPZ A;  2J7N A;  1X37 A;  1TDZ A;  4NOO B;  2B3T A;  4XK8 F;  1KFV A;  1A5T A;  1PGY A;  1UFZ A;  1VEG A;  3K2L A;  4JN6 A;  5LMU M;  1N34 M;  3FYD A;  3SAU A;  3GLF E;  1XWI A;  2KRU A;  1GL7 A;  4L4U A;  3B7Q A;  4AZF A;  4L6V 6;  4GC9 A;  4IBE A;  5EP1 A;  3J81 S;  2ZAM A;  1TR8 A;  3FUU A;  3KOW E;  3AL0 C;  1NNU C;  4AKG A;  2KNA A;  2RKO A;  2VQE M;  1YSY A;  2R6F A;  3AJI B;  2JY5 A;  2XFT A;  3GLG B;  4BLC A;  1IN6 A;  2RRU A;  2BWE A;  3GRU A;  5BPV A;  2D7G A;  1T43 A;  4UN2 B;  3ZC7 B;  2I7N A;  2KNZ A;  2LNH C;  4QNR A;  2LVP C;  2QP9 X;  2ZM6 M;  3CF2 A;  3B74 A;  3KSX A;  1OIP A;  3NWL A;  3M7G A;  5EXP A;  2Z8Y M;  3SHF A;  1XMO M;  1K82 A;  3T15 A;  1HQY E;  4PD2 A;  4FW9 A;  1DO2 A;  2L4E A;  1TGU A;  2G8L A;  2FOI C;  4L16 A;  4PCZ A;  5KPT A;  1IBL M;  4B3M M;  5ITT A;  2KXE A;  3KOX E;  3L25 A;  3SBJ A;  3L2A A;  3SAR A;  2J5Y A;  3PVS A;  4DR6 M;  2UXB M;  1J7K A;  3E21 A;  2M5Z A;  1TTE A;  1Z5B A;  3J2P B;  3KDS E;  4L78 A;  3GPX A;  2C98 A;  2CEA A;  4B08 A;  1FJG M;  2CHV A;  4F2L A;  3QAU A;  4F1I A;  2C9O A;  5H37 D;  3LMM A;  1HT2 E;  1S3S A;  1L2D A;  2LHG A;  2DNA A;  2R4E A;  3AOE A;  3TPZ A;  4BBA A;  3SC3 A;  3U6S A;  2WZJ A;  4JI0 M;  2FFJ A;  2LWX A;  1OFH A;  5ITU A;  5BR8 M;  4OVZ A;  1GAB A;  3HU2 A;  2GQF A;  1UM8 A;  4LF4 M;  3W67 A;  3GQ4 A;  3DA1 A;  1K3W A;  4NRW A;  2JY7 A;  3GLH E;  5DNY A;  3I51 A;  2CRU A;  2F5N A;  4LZJ A;  2BJW A;  4B3T M;  2F5Q A;  1F4I A;  4D82 A;  4LCB A;  4G4Q A;  2O25 A;  2WSE F;  1XC8 A;  3DFZ A;  3U5Z A;  3GLI A;  1IN7 A;  4QHT A;  4AKH A;  1H6U A;  3QYE A;  5KO3 A;  1DGG A;  2L4F A;  3C58 A;  1CUK A;  1YUB A;  3SAT A;  3BOS A;  1QVR A;  1IY0 A;  4GEW A;  3LQQ A;  4IBD A;  2CP8 A;  2LVO C;  2XF3 A;  2Z7J A;  3H4J A;  2DXI A;  3HHZ A;  4R3D A;  4KLN A;  1R2Z A;  2R62 A;  4DV0 M;  3WHK A;  1QZE A;  3JAM S;  3LW5 F;  5ITR A;  5ITX A;  3K1J A;  1E32 A;  1XXH B;  1V33 A;  3A42 A;  3J80 S;  3TL4 X;  4LF7 M;  1IFY A;  2JXN A;  2BNK A;  2HL7 A;  1VDL A;  4MGI E;  2K47 A;  1N36 M;  4FWD A;  4FVM A;  1PRB A;  3CGW A;  2A5Y B;  4DUY M;  3HX3 A;  4MH0 E;  5EXX A;  2CV1 A;  3FTC A;  3GRV A;  1Z6T A;  1IXS A;  1IBK M;  1SXJ C;  3KXE C;  2I7P A;  3LVW A;  1QDT A;  3FRH A;  2CUZ A;  3FUT A;  3U6Q A;  3UMM A;  2EUC A;  1QDR A;  2UUA M;  5C18 A;  1FNN A;  4GH9 A;  5DFL A;  4GHL A;  3PNV A;  1R5L A;  3LCV B;  4DV3 M;  1XNR M;  2N35 A;  2YQZ A;  5E26 A;  2XSZ D;  4B7G A;  4R7G A;  1ZMV A;  1V92 A;  3U6L A;  1KYI A;  2LH0 A;  1N32 M;  4LJA A;  3SHG B;  3B89 A;  4ZPX A;  3GLI B;  1SXJ D;  1J5E M;  4IBK A;  4DR7 M;  3IG8 A;  4GHA A;  4LGY A;  1NV8 A;  4QHS A;  1ZV1 A;  2QSF X;  3ZH9 B;  3T6P A;  3E4R A;  3GLH A;  4L15 A;  1PJI A;  1LV7 A;  1OTR A;  1QYR A;  2XZU A;  3K8Z A;  4AG5 A;  1V34 A;  4IBF A;  4GIT A;  2QPA A;  1NNJ A;  4LF9 M;  3A98 B;  3T1Y M;  1VQ1 A;  3R8F A;  4GKK M;  4HLQ A;  4LFC M;  2Y21 A;  2MRO B;  2RGH A;  3SYK A;  2BJV A;  1SXJ A;  5IRE B;  3I4Y A;  1SXJ B;  4NXM M;  1HJP A;  4G3O A;  4GRI A;  4HEO A;  4CJ6 A;  4DV5 M;  3M0E A;  4AI6 A;  4LJ9 A;  1QUS A;  1WGN A;  4FWG A;  4M9Z A;  1D0M A;  2VDB B;  3FTF A;  1GJS A;  2JA2 A;  4BB9 A;  2MJ5 B;  1ZQ9 A;  4GMQ A;  4I81 A;  4LJ4 A;  1TF0 B;  1WJ7 A;  1P3Q Q;  4IIW A;  2KA6 B;  2MR9 A;  1NO1 A;  3W0L B;  1GKI A;  2J7O A;  2V1C A;  4M9S A;  3FD9 A;  3GPP A;  3U61 B;  1PJS A;  2DI0 A;  4M0D A;  3AOE C;  4NXN M;  4LFB M;  2F5O A;  4IBC A;  3UZU A;  3FUW A;  5KPR A;  5EXS A;  2WSC F;  3SMS A;  2DVW B;  2QHO B;  5FTL A;  2UXD M;  1XNQ M;  3KP0 E;  3MJ5 A;  1D0L A;  4A3V B;  7CAT A;  3NBI A;  3GPY A;  2H1R A;  2L7I A;  4PDG A;  1IXR C;  1WXQ A;  2WSF F;  3E9S A;  3GLG A;  4IBI A;  1G59 A;  1DGB A;  4GIP A;  3J7B A;  2L2D A;  3I04 M;  4JI8 M;  1IN4 A;  2JWS A;  2Q2E B;  3THG A;  2MGW A;  4Z6Y A;  2D7H A;  2C99 A;  2VF7 A;  1GO5 A;  1N75 A;  2DWL A;  4OU7 A;  2EJS A;  4X62 M;  4P16 A;  5KQ8 A;  2ZTD A;  1L1Z A;  1Z5C A;  1TH2 A;  1IY1 A;  2CWB A;  4KO8 A;  1IXS B;  2KRK A;  1HNX M;  4DR3 M;  4M0W A;  2DWM A;  2C5R A;  1KSF X;  2OOA A;  3VLF B;  2Y0Q A;  3KP1 E;  2F5S A;  1W5T A;  3BBZ A;  2ERC A;  5EP2 A;  4DUZ M;  4GKJ M;  4QOZ C;  4JI7 M;  3RGP A;  3EIH A;  2Z4R A;  1NSF A;  2DAE A;  5IT9 S;  2DWN A;  2YFQ A;  1R7R A;  1ORY B;  3SFZ A;  5JI3 E;  1QAN A;  1L2B A;  2QBY A;  2DZL A;  1QAQ A;  4JI4 M;  1HNW M;  3PXG A;  3VFD A;  4G4R A;  3FYC A;  2JZ0 A;  3T38 A;  2C9C A;  1HT1 E;  2DAK A;  3GRY A;  3OTO M;  2V6Z M;  1WGL A;  4OW0 A;  4YY3 M;  1MJG M;  1R2Y A;  4JI2 M;  3J27 B;  5L8R F; 
#chains in the Genus database with same CATH homology
 2JY8 A;  3FE3 A;  1MN3 A;  5DFL A;  2BWB A;  3LCV B;  3LCU A;  2B3T A;  1ZMV A;  1A5T A;  1PGY A;  1UFZ A;  1KYI A;  1V92 A;  1VEG A;  1ZMU A;  2OO9 A;  3K9O A;  3GLF E;  3B89 A;  2G3Q A;  1TR8 A;  1NV8 A;  1WR1 B;  1E94 E;  1ZV1 A;  2QSF X;  2EKK A;  3T6P A;  2KNA A;  1G3I A;  2LVN C;  1OTR A;  2LBC A;  1Q02 A;  2ZTC A;  2JY5 A;  1VG5 A;  1G4A E;  2RRU A;  2BWE A;  1T43 A;  4UN2 B;  1VEK A;  1VQ1 A;  2KNZ A;  2LVP C;  1DV0 A;  2MRO B;  2K0B X;  1HJP A;  4G3O A;  1HQY E;  4HEO A;  1JR3 E;  1DO2 A;  1IM2 A;  2L4E A;  2KHH A;  3IEC A;  1WGN A;  2LVA A;  2JY6 B;  2JP7 A;  2MJ5 B;  2JNH A;  3K9P A;  2DAI A;  1WJ7 A;  1OKS A;  1P3Q Q;  1TTE A;  3E21 A;  1WHC A;  2K9D A;  2QNJ A;  2MR9 A;  4F2L A;  4Q7J A;  1DO0 A;  2HAK A;  4F1I A;  2DI0 A;  3GLG E;  4WP2 A;  1NV9 A;  1YLA A;  1EFU B;  1HT2 E;  2LVQ D;  2R0I A;  2DNA A;  2QHO B;  1T6O A;  2DAG A;  1R4G A;  2WZJ A;  2LTU A;  3MMP A;  2EKF A;  1OQY A;  3IHP A;  2DHY A;  2JY7 A;  3GLH E;  1XXH E;  1F4I A;  1AIP C;  2L2D A;  2O25 A;  2MGW A;  1OAI A;  3E46 A;  1GO5 A;  1XB2 B;  2EJS A;  1WIV A;  2L4F A;  1CUK A;  2H5X A;  2ZTD A;  2DAM A;  2JUJ A;  2CWB A;  1G41 A;  1SG9 A;  2JZ1 A;  2OOA A;  4GEW A;  5JI2 E;  2CP8 A;  3FRI A;  1C7Y A;  2LVO C;  3BBZ A;  3H4J A;  2DEN A;  4R71 A;  3GLI E;  1Y8G A;  2DAE A;  2HWJ A;  1QZE A;  2KNV A;  1IFY A;  1ZMW A;  1VDL A;  2OOB A;  2DZL A;  4DBG B;  1VEJ A;  2JZ0 A;  1HT1 E;  2DAK A;  1IXS A;  1WGL A;  2DKL A;  3F92 A;  3FRH A;  1BVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...