2LVPC

Gp78cue domain bound to the distal ubiquitin of k48-linked diubiquitin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin
publication title Promiscuous Interactions of gp78 E3 Ligase CUE Domain with Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/ligase
total genus 13
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lvpC00
1EFUB 1IM2A 2JY5A 1V92A 1E94E 1XXHE 2L4EA 1VQ1A 2HWJA 4R71A 4WP2A 3K9PA 1G3IA 1VDLA 2KHHA 2DKLA 2K9DA 1KYIA 1ZV1A 2CP8A 1G41A 1G4AE 3K9OA 2WZJA 1R4GA 3IECA 1TR8A 2MGWA 1IFYA 4Q7JA 1T6OA 2LBCA 1WHCA 2JNHA 2BWBA 1OAIA 1VEJA 3B89A 3LCVB 2DI0A 1C7YA 3GLFE 2CWBA 1YLAA 1DO0A 3IHPA 1JR3E 2LVNC 2MR9A 4GEWA 3FRIA 2QHOB 1CUKA 2DAGA 1PGYA 2JP7A 2LVQD 1F4IA 2DZLA 1MN3A 2L2DA 3GLIE 2L4FA 2DAMA 2OOBA 2DAEA 2OOAA 1DO2A 1HT2E 3H4JA 3GLHE 2ZTDA 2JY7A 2B3TA 3GLGE 1IXSA 4F1IA 4DBGB 2R0IA 2JZ0A 1OTRA 1DV0A 2JUJA 2BWEA 1TTEA 2LVPC 1WIVA 1QZEA 3FE3A 2EKFA 2OO9A 3MMPA 4G3OA 5DFLA 3T6PA 1GO5A 3E46A 1ZMVA 2JY6B 1VEGA 1WGLA 1SG9A 2K0BX 2MJ5B 1VG5A 2G3QA 2KNAA 2KNVA 2LVAA 5JI2E 1OQYA 3F92A 1Y8GA 1ZMUA 4HEOA 1A5TA 1OKSA 4UN2B 2EKKA 2DNAA 2ZTCA 3LCUA 2JZ1A 1HT1E 2LTUA 2QSFX 1WR1B 1AIPC 1NV9A 2O25A 3BBZA 2MROB 3FRHA 1HQYE 1BVSA 2DAIA 2DENA 2EJSA 2H5XA 2LVOC 1P3QQ 1VEKA 1Q02A 2KNZA 3E21A 1HJPA 1XB2B 2HAKA 2RRUA 1NV8A 1ZMWA 1WGNA 2JY8A 4F2LA 2QNJA 1UFZA 1WJ7A 1T43A 2DHYA 2DAKA
chains in the Genus database with same CATH superfamily
3IG8A 5E6JA 4PCZA 3ZQJA 3FTFA 1IM2A 5IT9S 4G6ZA 1L2DA 4A3VB 1E94E 2L4EA 1Q3BA 1L1TA 2YNMD 1QZMA 2D7GA 3SC3A 5KO3A 1E9RA 1N75A 1G3IA 2QPAA 3K9PA 3FYDA 3R9XB 4GHAA 1TH4A 3L29A 3QYBA 4CGYB 2AHMA 3K9OA 4LF5M 4AQYM 4NRWA 3A46A 1R4GA 2QCUA 3J27B 1VDDA 3RGSA 1TH3A 2QENA 3SYKA 1TF0B 3U6LA 1IN8A 1X37A 2JNHA 3HWSA 3KOWE 2UXBM 3ZCBB 5LMUM 2DI0A 4RKUF 5BPVA 3GLFE 2R46A 4MM3B 1YLAA 4FD2A 3IHPA 4DR4M 2LVNC 4LZJA 4ZPXA 1IN6A 1ZQ9A 4GC5A 2LXEA 1H6UA 4ANRA 3GPYA 3UZUA 3U6MA 4GEWA 4X65M 3RFWA 3OTOM 1CUKA 2DAGA 4CJ6A 2LVQD 4DV6M 1F4IA 2L7IA 2VF7A 3QAUA 1Z5AA 3U60B 2DAEA 2RGHA 3KSJA 4GIPA 2JY7A 5EP1A 4IBCA 3GLGE 1QQWA 1MU5A 3U5ZB 4B08A 2FH0A 4CHTB 4LJ8A 3GP1A 3SATA 1QAQA 3PXGA 4LJ7A 1NHGC 3U60A 1DGGA 2FNAA 3AOEC 3FUTA 3GO8A 2XEPA 3HHWA 3J80S 3GPPA 4I5SA 2Z8YM 4MGKE 3V76A 4FWHA 1OFHA 1XHBA 3U5ZA 4OX9M 1QZEA 2Y0TA 3R8FA 4LF4M 3T1YM 4FWDA 1IY0A 1GJTA 1G71A 2DVWB 3SHGB 2HCBA 5DFLA 3TL4X 4LJ5A 5FSWA 2ZM6M 4AKHA 4JI7M 3GLIB 1WGLA 1OIPA 4I81A 3GRVA 4PDIA 1Q3CA 2KNVA 1QAOA 2KZSA 3F92A 1Y8GA 4L16A 1W5TA 3LVVA 4FCTA 4HEOA 1QYRA 4NOOB 4UN2B 2EKKA 4L4UA 5KPRA 5ITRA 1N32M 2Y0QA 4IBGA 1HT1E 2QSFX 3H4MA 2F5QA 2I7PA 2F4VM 1IBKM 4GMQA 3GLIA 1AIPC 3J81S 2O25A 3BBZA 3FUXA 3FRHA 2KW0A 4LZZA 1J5EM 2A5YB 2C96A 4M9SA 2LNHC 1BVSA 2DAIA 3SHFA 4P16A 4AG6A 5EP3A 1NVMA 2O5RA 2D7EA 3W67A 4D82A 3JR4A 3KS8A 1Q02A 2GQFA 4AG5A 3DFZA 3LQQA 3KDSE 1IBMM 2ZAMA 3U6DA 2G8LA 4AKGA 3KOYE 2JY8A 4IJEA 4F2LA 3VDUA 2QNJA 4B3RM 3VK7A 4LJ9A 1GKIA 2DHYA 4LG2A 4JI1M 5FTNA 2GNOA 4LJAA 3ILKA 4OU7A 1DGBA 2JY5A 3B74A 2C99A 1XXHE 5A2QS 4FWGA 1HNWM 4XBOA 4DR2M 1L2CA 3SASA 3GRUA 4L15A 1QDTA 4IBJA 1QAMA 1HR0M 4R71A 3AFHA 3HJQA 3GPXA 3T15A 2DKLA 5KPTA 2K9DA 2J7OA 4FW9A 1FNNA 2CP8A 3HY5A 1G41A 4MGIE 2VIIA 3KS4A 4NXMM 3NBIA 5FTMA 3TE6A 3TQSA 5C1BA 5ITQA 4DR3M 2X49A 1TR8A 4LRSA 2QZ4A 3AKZA 1IFYA 4B3SM 3FUVA 3THGA 4KODA 4DV0M 1Q39A 4W5WA 3ZC7B 1VEJA 4RF0A 1GABA 1RU3A 1C7YA 3U6CA 1XMOM 1IY2A 2MH8A 1Z5CA 3CF0A 3CF2A 1DO0A 3LW5F 3CF6E 4DV3M 3K2LA 3KVWA 4M0WA 3Q8XA 4MGHA 1XC8A 1L1ZA 3HKPA 1EE8A 2EA0A 1G8PA 1TDZA 2JP7A 1IXSB 5ITXA 3KFUG 2DZLA 1MN3A 2L2DA 4TUWA 2L4FA 4IBKA 2OOBA 1YE9A 4R7GA 5IREB 4NXNM 1PJIA 4K0KM 1DO2A 2R4JA 3SAUA 2XH9A 3AV0A 1NJFA 2B3TA 2Q2EB 3PFIA 2ZBKB 3BXWA 1IXSA 3I04M 1D0LA 3QYEA 5C18A 2F5PA 2DWMA 1N33M 3L27A 4B7HA 4PT5A 4DV5M 1TGUA 4M9XA 2UUAM 1QUSA 3J2PB 5H37D 1L8QA 3NWLA 3DOAA 3HHYA 2OPFA 3E9SA 3AJIB 2ZAOA 3GPUA 1NSFA 1K82A 3ZH9B 2APLA 2CFOA 3SAVA 3RGPA 3FE3A 4DR7M 3PNVA 4JI8M 1SXJC 2I7NA 3MMPA 5FTJA 1XMQM 3B7ZA 1N78A 4XGIA 4PDGA 3QWLA 4KT0F 1LV7A 3E46A 4QHSA 4X64M 2DXIA 4AKIA 1VEGA 2R62A 1OJLA 7CATA 2CV0A 3VLFB 1HQCA 3SBJA 2MJ5B 2XSZA 2CHQA 2KNAA 5JI2E 4AZFA 4LY6A 2CV2A 1UM8A 1ORYB 2XGNA 1OKSA 5EQTA 2XLJA 3GLGB 4LRTA 3LCUA 2KEBA 4MGYE 4DR6M 3W68A 3VDPA 4GKKM 3HHXA 4L8RC 5E26A 2DHRA 1IN4A 1NV9A 3UJNA 1IN7A 4JI6M 1W5SA 3MHVC 1HQYE 3U6SA 1I94M 1SXJE 2EJSA 2XSZD 1XNRM 2ERCA 2XFSA 2RGOA 5DYGA 3GLGA 1P3QQ 2K47A 3KXEC 4KO8A 1V34A 5LMNM 2C5RA 2FOIC 4G4RA 4QHTA 2XFTA 2HAKA 3CGWA 4NRVA 5GKNA 3GQ5A 4I8OA 1ZMWA 2LHCA 2Z4SA 2VDBB 2F5SA 2Z3XA 1V33A 3TWKA 3M6AA 4WW0A 2CE7A 2BNKA 1QUTA 3E4RA 2HHHM 2N35A 4PD2A 4GITA 1GJSA 3GLHB 1PJJA 2DAKA 4Z6YA 1EFUB 4MGZE 1I4WA 8CATA 5EXXA 2WSEF 1R2YA 4Z8XA 2HWJA 4JI0M 4G4QA 1IBLM 3FKEA 1GL7A 3GLHA 4JYAM 1VDLA 2HL7A 3KOZE 4X62M 1JB0F 2KHHA 4JV5M 1KYIA 3BOSA 1ZV1A 5FTLA 3UMMA 3CTWB 4DUZM 4IIWA 3AOEA 3SARA 4LGMA 1E32A 5L8RF 4RF1A 4QNRA 2KZUA 2CHVA 3IECA 3U61B 3SAWA 3L2AA 1IXRC 3PVSA 3U6OA 4DR1M 4Q7JA 2QQ8A 3FTDA 4JI5M 4KHPM 1OAIA 1XWIA 2BWBA 4HLQA 2C9OA 3HZJA 3LCVB 2YR0A 3LMMA 3UK6A 1PJSA 2CWBA 3JAMS 4MB7A 1G59A 2UXCM 4FVMA 2JA2A 4JN6A 3K1JA 1JR3E 3L28A 3U61A 3VKGA 2FS1A 1D0KA 3GQ3A 3C3DA 1T3TA 2MR9A 4HL4A 1MX0A 3MK6A 1XXHB 3FRIA 1YSYA 2QHOB 2P5TA 4BBAA 4DV4M 2FE8A 4GHLA 5JI3E 3C3EA 2DAMA 4B7FA 4LF9M 3FYCA 4S12A 3M7GA 3GQ4A 2OOAA 1HT2E 1IY1A 2DZNB 3H4JA 4DUYM 3TWMA 3L25A 3VFDA 2CUZA 3GRRA 1D2NA 1XXHA 3D8LA 4KLNA 4BLCA 4F1IA 2C98A 4LJ6A 1PJQA 2QBYB 3UGJA 2R44A 4DBGB 3IG5A 5EP4A 2LWXA 2JZ0A 1NHWC 1OTRA 4M0DA 2DZOB 3HJSA 4I4LA 2KDLA 2JUJA 5EXSA 2BWEA 1R2ZA 1DV0A 1TTEA 3TPZA 2G5GX 4XK8F 2VQFM 2LVPC 4JI4M 3I4VA 5F3WA 1NNUC 2QBYA 3HGIA 3MJ5A 2OO9A 5EXPA 4RNAA 4G3OA 4G4NA 3I01M 2DWNA 2EO2A 3HU2A 5FTKA 4JI3M 4YHHM 3HU3A 3U6EA 4CISA 2JY6B 3J7BA 3AOGA 2V6ZM 2ZANA 5ITXE 1WXQA 2K0BX 5FLXS 3RE8A 1TDHA 1VG5A 2G3QA 2LVAA 3SMSA 2F5OA 2UXDM 3U6PA 2VF8A 2H1RA 5IZ7D 1A5TA 2X8AA 1NJGA 2ZTCA 4AW4A 2XZUA 1WR1B 4GC9A 4ITQA 4GKJM 1EIJA 2YFQA 2MROB 4B3TM 2Z4RA 3HX3A 3GLFB 4GH9A 3TWLA 3B7QA 1IXZA 3KP1E 2K6BA 3HJ8A 2RKOA 2XZFA 4REZA 4LF8M 2CRUA 1VEKA 5ITUA 1N77A 4D81A 1HJPA 2O01F 3DA1A 1XB2B 4IBBA 3SMPA 2L09A 1K3WA 2M5ZA 5KQDA 2UUBM 4M9ZA 4NL4H 3W0FA 1QVRA 2YQZA 3GLFA 3B7NA 4B7GA 4DV7M 1HNXM 1DGHB 4MH0E 4D80A 2WSCF 1WJ7A 1GVNA 3Q8GA 2F5NA 1T43A 4LFCM 3FD9A 3K92A 1QANA 4FCWA 4IBFA 4L78A 4WURA 3C58A 2DWZB 3FTEA 3AL0C 3LVWA 3WHKA 1V92A 1R5LA 2VQEM 2R4EA 1VQ1A 4AI6A 1DGHA 2UU9M 1R7RA 1D0MA 2L6OA 3FUWA 3HU1A 1Z59A 4LFAM 4FCVA 2KRKA 4QNMA 4WP2A 5DYIA 2QP9X 3A98B 1HNZM 1ZAEA 2L7HA 3HHZA 2LHGA 4QOZC 1SXJB 1JQJC 2Z7JA 1J7KA 4EIWA 1G4AE 3WHLA 1IN5A 5KPZA 2WZJA 5ITYA 1FJGM 2FFJA 2MGWA 3I4YA 2DWLA 3EIHA 4B3MM 3KSXA 5KQ8A 1T6OA 1PJTA 2KRUA 4DR5M 2LBCA 1MJGM 3KW6A 1WHCA 1SXJA 3JR5A 3VK8A 3B89A 1TH2A 3PNYA 2XF3A 4IBIA 1E9SA 3A45A 2EUCA 3A42A 3U6QA 1N36M 3I51A 3C9PA 1PGYA 1OAOC 3NBXX 2KXEA 1SXJD 2KA6B 2WSFF 3GLIE 2E5LM 2CV1A 2D7HA 4NSOB 1QDRA 2JXNA 1LTMA 1NY6A 1N34M 4IJFA 4LF6M 3GLHE 2ZTDA 4DV1M 3LQRA 4JXJA 2BJVA 2LH0A 2C9CA 3GRYA 1C1KA 4GRIA 4OVZB 3VKHA 4IBEA 4BB9A 3B9PA 4P17A 1K3XA 1S3SA 1KSFX 2R0IA 1IQPA 5EXTA 1J09A 4L6V6 5DNYA 1WIVA 4OVZA 2EKFA 1Z5BA 1YUBA 1GLNA 5IWAM 3EIEA 2JWSA 3KP0E 2X4AA 3T6PA 4JI2M 1GO5A 1ZMVA 4LGYA 2BJWA 2Y21A 4CIZA 1NY5A 1DGFA 4DV2M 1OFIA 2CEAA 4R3DA 1PM5A 4QOSA 2CHGA 4G4OA 2R45A 1SG9A 3SYLA 4LF7M 1JR3A 2Y20A 1OQYA 3DZDA 5BR8M 4YY3M 1ZMUA 2J5YA 4NSRA 3D8BA 4LJ4A 2DNAA 3L26A 2JZ1A 2LTUA 2UUCM 3J7AS 1L2BA 2R18A 4LCBA 3T38A 4II7A 2M60A 2DENA 1PRBA 1JR3D 3KOXE 3K8ZA 3FUUA 2H5XA 2LVOC 5EP2A 3M0EA 3SFZA 2OQ4A 1XNQM 5ITTA 2KNZA 2V1CA 1R6BX 3E21A 2W82A 3FTCA 1AUAA 4NC6A 3T1HM 5EJCA 2RRUA 1NV8A 1WGNA 4OW0A 4IBDA 4X66M 1UFZA 2R65A 2R6FA 1NO1A 1OIZA 4Y28F 1NNJA 1GL6A 1KFVA 3W0LB 2V1UA 2NQ8C 1Z6TA 2HKJA 2J7NA 4LFBM
chains in the Genus database with same CATH topology
1EFUB 1IM2A 2JY5A 1V92A 1E94E 1XXHE 2L4EA 1VQ1A 2HWJA 4R71A 4WP2A 3K9PA 1G3IA 1VDLA 2KHHA 2DKLA 2K9DA 1KYIA 1ZV1A 2CP8A 1G41A 1G4AE 3K9OA 2WZJA 1R4GA 3IECA 1TR8A 2MGWA 1IFYA 4Q7JA 1T6OA 2LBCA 1WHCA 2JNHA 2BWBA 1OAIA 1VEJA 3B89A 3LCVB 2DI0A 1C7YA 3GLFE 2CWBA 1YLAA 1DO0A 3IHPA 1JR3E 2LVNC 2MR9A 4GEWA 3FRIA 2QHOB 1CUKA 2DAGA 1PGYA 2JP7A 2LVQD 1F4IA 2DZLA 1MN3A 2L2DA 3GLIE 2L4FA 2DAMA 2OOBA 2DAEA 2OOAA 1DO2A 1HT2E 3H4JA 3GLHE 2ZTDA 2JY7A 2B3TA 3GLGE 1IXSA 4F1IA 4DBGB 2R0IA 2JZ0A 1OTRA 1DV0A 2JUJA 2BWEA 1TTEA 2LVPC 1WIVA 1QZEA 3FE3A 2EKFA 2OO9A 3MMPA 4G3OA 5DFLA 3T6PA 1GO5A 3E46A 1ZMVA 2JY6B 1VEGA 1WGLA 1SG9A 2K0BX 2MJ5B 1VG5A 2G3QA 2KNAA 2KNVA 2LVAA 5JI2E 1OQYA 3F92A 1Y8GA 1ZMUA 4HEOA 1A5TA 1OKSA 4UN2B 2EKKA 2DNAA 2ZTCA 3LCUA 2JZ1A 1HT1E 2LTUA 2QSFX 1WR1B 1AIPC 1NV9A 2O25A 3BBZA 2MROB 3FRHA 1HQYE 1BVSA 2DAIA 2DENA 2EJSA 2H5XA 2LVOC 1P3QQ 1VEKA 1Q02A 2KNZA 3E21A 1HJPA 1XB2B 2HAKA 2RRUA 1NV8A 1ZMWA 1WGNA 2JY8A 4F2LA 2QNJA 1UFZA 1WJ7A 1T43A 2DHYA 2DAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EFU B;  1IM2 A;  2JY5 A;  1V92 A;  1E94 E;  1XXH E;  2L4E A;  1VQ1 A;  2HWJ A;  4R71 A;  4WP2 A;  3K9P A;  1G3I A;  1VDL A;  2KHH A;  2DKL A;  2K9D A;  1KYI A;  1ZV1 A;  2CP8 A;  1G41 A;  1G4A E;  3K9O A;  2WZJ A;  1R4G A;  3IEC A;  1TR8 A;  2MGW A;  1IFY A;  4Q7J A;  1T6O A;  2LBC A;  1WHC A;  2JNH A;  2BWB A;  1OAI A;  1VEJ A;  3B89 A;  3LCV B;  2DI0 A;  1C7Y A;  3GLF E;  2CWB A;  1YLA A;  1DO0 A;  3IHP A;  1JR3 E;  2LVN C;  2MR9 A;  4GEW A;  3FRI A;  2QHO B;  1CUK A;  2DAG A;  1PGY A;  2JP7 A;  2LVQ D;  1F4I A;  2DZL A;  1MN3 A;  2L2D A;  3GLI E;  2L4F A;  2DAM A;  2OOB A;  2DAE A;  2OOA A;  1DO2 A;  1HT2 E;  3H4J A;  3GLH E;  2ZTD A;  2JY7 A;  2B3T A;  3GLG E;  1IXS A;  4F1I A;  4DBG B;  2R0I A;  2JZ0 A;  1OTR A;  1DV0 A;  2JUJ A;  2BWE A;  1TTE A;  2LVP C;  1WIV A;  1QZE A;  3FE3 A;  2EKF A;  2OO9 A;  3MMP A;  4G3O A;  5DFL A;  3T6P A;  1GO5 A;  3E46 A;  1ZMV A;  2JY6 B;  1VEG A;  1WGL A;  1SG9 A;  2K0B X;  2MJ5 B;  1VG5 A;  2G3Q A;  2KNA A;  2KNV A;  2LVA A;  5JI2 E;  1OQY A;  3F92 A;  1Y8G A;  1ZMU A;  4HEO A;  1A5T A;  1OKS A;  4UN2 B;  2EKK A;  2DNA A;  2ZTC A;  3LCU A;  2JZ1 A;  1HT1 E;  2LTU A;  2QSF X;  1WR1 B;  1AIP C;  1NV9 A;  2O25 A;  3BBZ A;  2MRO B;  3FRH A;  1HQY E;  1BVS A;  2DAI A;  2DEN A;  2EJS A;  2H5X A;  2LVO C;  1P3Q Q;  1VEK A;  1Q02 A;  2KNZ A;  3E21 A;  1HJP A;  1XB2 B;  2HAK A;  2RRU A;  1NV8 A;  1ZMW A;  1WGN A;  2JY8 A;  4F2L A;  2QNJ A;  1UFZ A;  1WJ7 A;  1T43 A;  2DHY A;  2DAK A; 
#chains in the Genus database with same CATH topology
 3IG8 A;  5E6J A;  4PCZ A;  3ZQJ A;  3FTF A;  1IM2 A;  5IT9 S;  4G6Z A;  1L2D A;  4A3V B;  1E94 E;  2L4E A;  1Q3B A;  1L1T A;  2YNM D;  1QZM A;  2D7G A;  3SC3 A;  5KO3 A;  1E9R A;  1N75 A;  1G3I A;  2QPA A;  3K9P A;  3FYD A;  3R9X B;  4GHA A;  1TH4 A;  3L29 A;  3QYB A;  4CGY B;  2AHM A;  3K9O A;  4LF5 M;  4AQY M;  4NRW A;  3A46 A;  1R4G A;  2QCU A;  3J27 B;  1VDD A;  3RGS A;  1TH3 A;  2QEN A;  3SYK A;  1TF0 B;  3U6L A;  1IN8 A;  1X37 A;  2JNH A;  3HWS A;  3KOW E;  2UXB M;  3ZCB B;  5LMU M;  2DI0 A;  4RKU F;  5BPV A;  3GLF E;  2R46 A;  4MM3 B;  1YLA A;  4FD2 A;  3IHP A;  4DR4 M;  2LVN C;  4LZJ A;  4ZPX A;  1IN6 A;  1ZQ9 A;  4GC5 A;  2LXE A;  1H6U A;  4ANR A;  3GPY A;  3UZU A;  3U6M A;  4GEW A;  4X65 M;  3RFW A;  3OTO M;  1CUK A;  2DAG A;  4CJ6 A;  2LVQ D;  4DV6 M;  1F4I A;  2L7I A;  2VF7 A;  3QAU A;  1Z5A A;  3U60 B;  2DAE A;  2RGH A;  3KSJ A;  4GIP A;  2JY7 A;  5EP1 A;  4IBC A;  3GLG E;  1QQW A;  1MU5 A;  3U5Z B;  4B08 A;  2FH0 A;  4CHT B;  4LJ8 A;  3GP1 A;  3SAT A;  1QAQ A;  3PXG A;  4LJ7 A;  1NHG C;  3U60 A;  1DGG A;  2FNA A;  3AOE C;  3FUT A;  3GO8 A;  2XEP A;  3HHW A;  3J80 S;  3GPP A;  4I5S A;  2Z8Y M;  4MGK E;  3V76 A;  4FWH A;  1OFH A;  1XHB A;  3U5Z A;  4OX9 M;  1QZE A;  2Y0T A;  3R8F A;  4LF4 M;  3T1Y M;  4FWD A;  1IY0 A;  1GJT A;  1G71 A;  2DVW B;  3SHG B;  2HCB A;  5DFL A;  3TL4 X;  4LJ5 A;  5FSW A;  2ZM6 M;  4AKH A;  4JI7 M;  3GLI B;  1WGL A;  1OIP A;  4I81 A;  3GRV A;  4PDI A;  1Q3C A;  2KNV A;  1QAO A;  2KZS A;  3F92 A;  1Y8G A;  4L16 A;  1W5T A;  3LVV A;  4FCT A;  4HEO A;  1QYR A;  4NOO B;  4UN2 B;  2EKK A;  4L4U A;  5KPR A;  5ITR A;  1N32 M;  2Y0Q A;  4IBG A;  1HT1 E;  2QSF X;  3H4M A;  2F5Q A;  2I7P A;  2F4V M;  1IBK M;  4GMQ A;  3GLI A;  1AIP C;  3J81 S;  2O25 A;  3BBZ A;  3FUX A;  3FRH A;  2KW0 A;  4LZZ A;  1J5E M;  2A5Y B;  2C96 A;  4M9S A;  2LNH C;  1BVS A;  2DAI A;  3SHF A;  4P16 A;  4AG6 A;  5EP3 A;  1NVM A;  2O5R A;  2D7E A;  3W67 A;  4D82 A;  3JR4 A;  3KS8 A;  1Q02 A;  2GQF A;  4AG5 A;  3DFZ A;  3LQQ A;  3KDS E;  1IBM M;  2ZAM A;  3U6D A;  2G8L A;  4AKG A;  3KOY E;  2JY8 A;  4IJE A;  4F2L A;  3VDU A;  2QNJ A;  4B3R M;  3VK7 A;  4LJ9 A;  1GKI A;  2DHY A;  4LG2 A;  4JI1 M;  5FTN A;  2GNO A;  4LJA A;  3ILK A;  4OU7 A;  1DGB A;  2JY5 A;  3B74 A;  2C99 A;  1XXH E;  5A2Q S;  4FWG A;  1HNW M;  4XBO A;  4DR2 M;  1L2C A;  3SAS A;  3GRU A;  4L15 A;  1QDT A;  4IBJ A;  1QAM A;  1HR0 M;  4R71 A;  3AFH A;  3HJQ A;  3GPX A;  3T15 A;  2DKL A;  5KPT A;  2K9D A;  2J7O A;  4FW9 A;  1FNN A;  2CP8 A;  3HY5 A;  1G41 A;  4MGI E;  2VII A;  3KS4 A;  4NXM M;  3NBI A;  5FTM A;  3TE6 A;  3TQS A;  5C1B A;  5ITQ A;  4DR3 M;  2X49 A;  1TR8 A;  4LRS A;  2QZ4 A;  3AKZ A;  1IFY A;  4B3S M;  3FUV A;  3THG A;  4KOD A;  4DV0 M;  1Q39 A;  4W5W A;  3ZC7 B;  1VEJ A;  4RF0 A;  1GAB A;  1RU3 A;  1C7Y A;  3U6C A;  1XMO M;  1IY2 A;  2MH8 A;  1Z5C A;  3CF0 A;  3CF2 A;  1DO0 A;  3LW5 F;  3CF6 E;  4DV3 M;  3K2L A;  3KVW A;  4M0W A;  3Q8X A;  4MGH A;  1XC8 A;  1L1Z A;  3HKP A;  1EE8 A;  2EA0 A;  1G8P A;  1TDZ A;  2JP7 A;  1IXS B;  5ITX A;  3KFU G;  2DZL A;  1MN3 A;  2L2D A;  4TUW A;  2L4F A;  4IBK A;  2OOB A;  1YE9 A;  4R7G A;  5IRE B;  4NXN M;  1PJI A;  4K0K M;  1DO2 A;  2R4J A;  3SAU A;  2XH9 A;  3AV0 A;  1NJF A;  2B3T A;  2Q2E B;  3PFI A;  2ZBK B;  3BXW A;  1IXS A;  3I04 M;  1D0L A;  3QYE A;  5C18 A;  2F5P A;  2DWM A;  1N33 M;  3L27 A;  4B7H A;  4PT5 A;  4DV5 M;  1TGU A;  4M9X A;  2UUA M;  1QUS A;  3J2P B;  5H37 D;  1L8Q A;  3NWL A;  3DOA A;  3HHY A;  2OPF A;  3E9S A;  3AJI B;  2ZAO A;  3GPU A;  1NSF A;  1K82 A;  3ZH9 B;  2APL A;  2CFO A;  3SAV A;  3RGP A;  3FE3 A;  4DR7 M;  3PNV A;  4JI8 M;  1SXJ C;  2I7N A;  3MMP A;  5FTJ A;  1XMQ M;  3B7Z A;  1N78 A;  4XGI A;  4PDG A;  3QWL A;  4KT0 F;  1LV7 A;  3E46 A;  4QHS A;  4X64 M;  2DXI A;  4AKI A;  1VEG A;  2R62 A;  1OJL A;  7CAT A;  2CV0 A;  3VLF B;  1HQC A;  3SBJ A;  2MJ5 B;  2XSZ A;  2CHQ A;  2KNA A;  5JI2 E;  4AZF A;  4LY6 A;  2CV2 A;  1UM8 A;  1ORY B;  2XGN A;  1OKS A;  5EQT A;  2XLJ A;  3GLG B;  4LRT A;  3LCU A;  2KEB A;  4MGY E;  4DR6 M;  3W68 A;  3VDP A;  4GKK M;  3HHX A;  4L8R C;  5E26 A;  2DHR A;  1IN4 A;  1NV9 A;  3UJN A;  1IN7 A;  4JI6 M;  1W5S A;  3MHV C;  1HQY E;  3U6S A;  1I94 M;  1SXJ E;  2EJS A;  2XSZ D;  1XNR M;  2ERC A;  2XFS A;  2RGO A;  5DYG A;  3GLG A;  1P3Q Q;  2K47 A;  3KXE C;  4KO8 A;  1V34 A;  5LMN M;  2C5R A;  2FOI C;  4G4R A;  4QHT A;  2XFT A;  2HAK A;  3CGW A;  4NRV A;  5GKN A;  3GQ5 A;  4I8O A;  1ZMW A;  2LHC A;  2Z4S A;  2VDB B;  2F5S A;  2Z3X A;  1V33 A;  3TWK A;  3M6A A;  4WW0 A;  2CE7 A;  2BNK A;  1QUT A;  3E4R A;  2HHH M;  2N35 A;  4PD2 A;  4GIT A;  1GJS A;  3GLH B;  1PJJ A;  2DAK A;  4Z6Y A;  1EFU B;  4MGZ E;  1I4W A;  8CAT A;  5EXX A;  2WSE F;  1R2Y A;  4Z8X A;  2HWJ A;  4JI0 M;  4G4Q A;  1IBL M;  3FKE A;  1GL7 A;  3GLH A;  4JYA M;  1VDL A;  2HL7 A;  3KOZ E;  4X62 M;  1JB0 F;  2KHH A;  4JV5 M;  1KYI A;  3BOS A;  1ZV1 A;  5FTL A;  3UMM A;  3CTW B;  4DUZ M;  4IIW A;  3AOE A;  3SAR A;  4LGM A;  1E32 A;  5L8R F;  4RF1 A;  4QNR A;  2KZU A;  2CHV A;  3IEC A;  3U61 B;  3SAW A;  3L2A A;  1IXR C;  3PVS A;  3U6O A;  4DR1 M;  4Q7J A;  2QQ8 A;  3FTD A;  4JI5 M;  4KHP M;  1OAI A;  1XWI A;  2BWB A;  4HLQ A;  2C9O A;  3HZJ A;  3LCV B;  2YR0 A;  3LMM A;  3UK6 A;  1PJS A;  2CWB A;  3JAM S;  4MB7 A;  1G59 A;  2UXC M;  4FVM A;  2JA2 A;  4JN6 A;  3K1J A;  1JR3 E;  3L28 A;  3U61 A;  3VKG A;  2FS1 A;  1D0K A;  3GQ3 A;  3C3D A;  1T3T A;  2MR9 A;  4HL4 A;  1MX0 A;  3MK6 A;  1XXH B;  3FRI A;  1YSY A;  2QHO B;  2P5T A;  4BBA A;  4DV4 M;  2FE8 A;  4GHL A;  5JI3 E;  3C3E A;  2DAM A;  4B7F A;  4LF9 M;  3FYC A;  4S12 A;  3M7G A;  3GQ4 A;  2OOA A;  1HT2 E;  1IY1 A;  2DZN B;  3H4J A;  4DUY M;  3TWM A;  3L25 A;  3VFD A;  2CUZ A;  3GRR A;  1D2N A;  1XXH A;  3D8L A;  4KLN A;  4BLC A;  4F1I A;  2C98 A;  4LJ6 A;  1PJQ A;  2QBY B;  3UGJ A;  2R44 A;  4DBG B;  3IG5 A;  5EP4 A;  2LWX A;  2JZ0 A;  1NHW C;  1OTR A;  4M0D A;  2DZO B;  3HJS A;  4I4L A;  2KDL A;  2JUJ A;  5EXS A;  2BWE A;  1R2Z A;  1DV0 A;  1TTE A;  3TPZ A;  2G5G X;  4XK8 F;  2VQF M;  2LVP C;  4JI4 M;  3I4V A;  5F3W A;  1NNU C;  2QBY A;  3HGI A;  3MJ5 A;  2OO9 A;  5EXP A;  4RNA A;  4G3O A;  4G4N A;  3I01 M;  2DWN A;  2EO2 A;  3HU2 A;  5FTK A;  4JI3 M;  4YHH M;  3HU3 A;  3U6E A;  4CIS A;  2JY6 B;  3J7B A;  3AOG A;  2V6Z M;  2ZAN A;  5ITX E;  1WXQ A;  2K0B X;  5FLX S;  3RE8 A;  1TDH A;  1VG5 A;  2G3Q A;  2LVA A;  3SMS A;  2F5O A;  2UXD M;  3U6P A;  2VF8 A;  2H1R A;  5IZ7 D;  1A5T A;  2X8A A;  1NJG A;  2ZTC A;  4AW4 A;  2XZU A;  1WR1 B;  4GC9 A;  4ITQ A;  4GKJ M;  1EIJ A;  2YFQ A;  2MRO B;  4B3T M;  2Z4R A;  3HX3 A;  3GLF B;  4GH9 A;  3TWL A;  3B7Q A;  1IXZ A;  3KP1 E;  2K6B A;  3HJ8 A;  2RKO A;  2XZF A;  4REZ A;  4LF8 M;  2CRU A;  1VEK A;  5ITU A;  1N77 A;  4D81 A;  1HJP A;  2O01 F;  3DA1 A;  1XB2 B;  4IBB A;  3SMP A;  2L09 A;  1K3W A;  2M5Z A;  5KQD A;  2UUB M;  4M9Z A;  4NL4 H;  3W0F A;  1QVR A;  2YQZ A;  3GLF A;  3B7N A;  4B7G A;  4DV7 M;  1HNX M;  1DGH B;  4MH0 E;  4D80 A;  2WSC F;  1WJ7 A;  1GVN A;  3Q8G A;  2F5N A;  1T43 A;  4LFC M;  3FD9 A;  3K92 A;  1QAN A;  4FCW A;  4IBF A;  4L78 A;  4WUR A;  3C58 A;  2DWZ B;  3FTE A;  3AL0 C;  3LVW A;  3WHK A;  1V92 A;  1R5L A;  2VQE M;  2R4E A;  1VQ1 A;  4AI6 A;  1DGH A;  2UU9 M;  1R7R A;  1D0M A;  2L6O A;  3FUW A;  3HU1 A;  1Z59 A;  4LFA M;  4FCV A;  2KRK A;  4QNM A;  4WP2 A;  5DYI A;  2QP9 X;  3A98 B;  1HNZ M;  1ZAE A;  2L7H A;  3HHZ A;  2LHG A;  4QOZ C;  1SXJ B;  1JQJ C;  2Z7J A;  1J7K A;  4EIW A;  1G4A E;  3WHL A;  1IN5 A;  5KPZ A;  2WZJ A;  5ITY A;  1FJG M;  2FFJ A;  2MGW A;  3I4Y A;  2DWL A;  3EIH A;  4B3M M;  3KSX A;  5KQ8 A;  1T6O A;  1PJT A;  2KRU A;  4DR5 M;  2LBC A;  1MJG M;  3KW6 A;  1WHC A;  1SXJ A;  3JR5 A;  3VK8 A;  3B89 A;  1TH2 A;  3PNY A;  2XF3 A;  4IBI A;  1E9S A;  3A45 A;  2EUC A;  3A42 A;  3U6Q A;  1N36 M;  3I51 A;  3C9P A;  1PGY A;  1OAO C;  3NBX X;  2KXE A;  1SXJ D;  2KA6 B;  2WSF F;  3GLI E;  2E5L M;  2CV1 A;  2D7H A;  4NSO B;  1QDR A;  2JXN A;  1LTM A;  1NY6 A;  1N34 M;  4IJF A;  4LF6 M;  3GLH E;  2ZTD A;  4DV1 M;  3LQR A;  4JXJ A;  2BJV A;  2LH0 A;  2C9C A;  3GRY A;  1C1K A;  4GRI A;  4OVZ B;  3VKH A;  4IBE A;  4BB9 A;  3B9P A;  4P17 A;  1K3X A;  1S3S A;  1KSF X;  2R0I A;  1IQP A;  5EXT A;  1J09 A;  4L6V 6;  5DNY A;  1WIV A;  4OVZ A;  2EKF A;  1Z5B A;  1YUB A;  1GLN A;  5IWA M;  3EIE A;  2JWS A;  3KP0 E;  2X4A A;  3T6P A;  4JI2 M;  1GO5 A;  1ZMV A;  4LGY A;  2BJW A;  2Y21 A;  4CIZ A;  1NY5 A;  1DGF A;  4DV2 M;  1OFI A;  2CEA A;  4R3D A;  1PM5 A;  4QOS A;  2CHG A;  4G4O A;  2R45 A;  1SG9 A;  3SYL A;  4LF7 M;  1JR3 A;  2Y20 A;  1OQY A;  3DZD A;  5BR8 M;  4YY3 M;  1ZMU A;  2J5Y A;  4NSR A;  3D8B A;  4LJ4 A;  2DNA A;  3L26 A;  2JZ1 A;  2LTU A;  2UUC M;  3J7A S;  1L2B A;  2R18 A;  4LCB A;  3T38 A;  4II7 A;  2M60 A;  2DEN A;  1PRB A;  1JR3 D;  3KOX E;  3K8Z A;  3FUU A;  2H5X A;  2LVO C;  5EP2 A;  3M0E A;  3SFZ A;  2OQ4 A;  1XNQ M;  5ITT A;  2KNZ A;  2V1C A;  1R6B X;  3E21 A;  2W82 A;  3FTC A;  1AUA A;  4NC6 A;  3T1H M;  5EJC A;  2RRU A;  1NV8 A;  1WGN A;  4OW0 A;  4IBD A;  4X66 M;  1UFZ A;  2R65 A;  2R6F A;  1NO1 A;  1OIZ A;  4Y28 F;  1NNJ A;  1GL6 A;  1KFV A;  3W0L B;  2V1U A;  2NQ8 C;  1Z6T A;  2HKJ A;  2J7N A;  4LFB M; 
#chains in the Genus database with same CATH homology
 1EFU B;  1IM2 A;  2JY5 A;  1V92 A;  1E94 E;  1XXH E;  2L4E A;  1VQ1 A;  2HWJ A;  4R71 A;  4WP2 A;  3K9P A;  1G3I A;  1VDL A;  2KHH A;  2DKL A;  2K9D A;  1KYI A;  1ZV1 A;  2CP8 A;  1G41 A;  1G4A E;  3K9O A;  2WZJ A;  1R4G A;  3IEC A;  1TR8 A;  2MGW A;  1IFY A;  4Q7J A;  1T6O A;  2LBC A;  1WHC A;  2JNH A;  2BWB A;  1OAI A;  1VEJ A;  3B89 A;  3LCV B;  2DI0 A;  1C7Y A;  3GLF E;  2CWB A;  1YLA A;  1DO0 A;  3IHP A;  1JR3 E;  2LVN C;  2MR9 A;  4GEW A;  3FRI A;  2QHO B;  1CUK A;  2DAG A;  1PGY A;  2JP7 A;  2LVQ D;  1F4I A;  2DZL A;  1MN3 A;  2L2D A;  3GLI E;  2L4F A;  2DAM A;  2OOB A;  2DAE A;  2OOA A;  1DO2 A;  1HT2 E;  3H4J A;  3GLH E;  2ZTD A;  2JY7 A;  2B3T A;  3GLG E;  1IXS A;  4F1I A;  4DBG B;  2R0I A;  2JZ0 A;  1OTR A;  1DV0 A;  2JUJ A;  2BWE A;  1TTE A;  2LVP C;  1WIV A;  1QZE A;  3FE3 A;  2EKF A;  2OO9 A;  3MMP A;  4G3O A;  5DFL A;  3T6P A;  1GO5 A;  3E46 A;  1ZMV A;  2JY6 B;  1VEG A;  1WGL A;  1SG9 A;  2K0B X;  2MJ5 B;  1VG5 A;  2G3Q A;  2KNA A;  2KNV A;  2LVA A;  5JI2 E;  1OQY A;  3F92 A;  1Y8G A;  1ZMU A;  4HEO A;  1A5T A;  1OKS A;  4UN2 B;  2EKK A;  2DNA A;  2ZTC A;  3LCU A;  2JZ1 A;  1HT1 E;  2LTU A;  2QSF X;  1WR1 B;  1AIP C;  1NV9 A;  2O25 A;  3BBZ A;  2MRO B;  3FRH A;  1HQY E;  1BVS A;  2DAI A;  2DEN A;  2EJS A;  2H5X A;  2LVO C;  1P3Q Q;  1VEK A;  1Q02 A;  2KNZ A;  3E21 A;  1HJP A;  1XB2 B;  2HAK A;  2RRU A;  1NV8 A;  1ZMW A;  1WGN A;  2JY8 A;  4F2L A;  2QNJ A;  1UFZ A;  1WJ7 A;  1T43 A;  2DHY A;  2DAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...