2LVPC

Gp78cue domain bound to the distal ubiquitin of k48-linked diubiquitin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
b'SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin
publication title Promiscuous Interactions of gp78 E3 Ligase CUE Domain with Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/ligase
total genus 13
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lvpC00
2RRUA 1BVSA 2G3QA 3K9PA 1VG5A 2R0IA 2LTUA 1G41A 1C7YA 1Y8GA 2DHYA 3GLGE 1ZMWA 3E46A 2K0BX 3MMPA 3BBZA 1PGYA 1CUKA 4HEOA 1ZV1A 2DAMA 2JY8A 1VEJA 2ZTCA 1R4GA 1MN3A 2DI0A 2HAKA 2DZLA 2KNAA 2DENA 1OAIA 1VEKA 1YLAA 4R71A 2DKLA 2JY5A 2JZ0A 3F92A 1HT2E 1T6OA 2DAIA 3FRHA 2L4EA 1E94E 2OO9A 3B89A 4WP2A 1G3IA 2O25A 2B3TA 2HWJA 2CP8A 2LVAA 2LVPC 4UN2B 2QNJA 3GLHE 1ZMUA 3K9OA 1F4IA 2LBCA 1IM2A 2JUJA 2OOAA 1OKSA 2EJSA 1OTRA 2WZJA 4G3OA 1A5TA 1KYIA 2L4FA 1WJ7A 2QSFX 1NV9A 1DO2A 1V92A 1AIPC 3FE3A 3FRIA 5JI2E 1SG9A 5DFLA 1T43A 1XXHE 2CWBA 3E21A 2OOBA 2JY7A 2KHHA 1DV0A 2LVNC 1ZMVA 1WHCA 1IFYA 2MR9A 1QZEA 1UFZA 2BWBA 2ZTDA 2BWEA 1WGLA 2LVQD 2MROB 3LCUA 4Q7JA 3GLIE 2DAKA 2K9DA 2QHOB 1P3QQ 1Q02A 3IECA 3T6PA 1WIVA 1HJPA 2KNVA 2JZ1A 1TTEA 1TR8A 2MJ5B 3IHPA 1EFUB 2DAEA 2MGWA 2EKFA 2DNAA 2H5XA 1OQYA 2KNZA 2EKKA 4F2LA 3LCVB 3GLFE 1VQ1A 1WGNA 1G4AE 2LVOC 1GO5A 4F1IA 4DBGB 1JR3E 1WR1B 1VDLA 1XB2B 4GEWA 2JNHA 2JY6B 1VEGA 2DAGA 2L2DA 2JP7A 1HT1E 1NV8A 3H4JA 1HQYE 1IXSA 1DO0A
chains in the Genus database with same CATH superfamily
2MH8A 1DGGA 1BVSA 3D8LA 2G3QA 4CGYB 1N36M 4QOSA 2R0IA 5DYGA 1QAQA 1Y8GA 4KLNA 5EP3A 2X4AA 2K0BX 3E46A 1N78A 1RU3A 1QYRA 5EQTA 4NXNM 1HR0M 1PRBA 1GL6A 1SXJB 3SMPA 1SXJE 4REZA 1JB0F 2EA0A 1IXRC 3DZDA 1ZV1A 1N33M 2F5OA 1IN4A 1TH4A 1VEJA 1UM8A 4JXJA 5KPRA 2ZTCA 1G59A 3T1HM 1MJGM 1R4GA 2QBYA 1N75A 2DI0A 3K92A 2G8LA 4QOZC 1XMQM 1E9RA 3E4RA 2JA2A 2DKLA 4D80A 2F5NA 1DGHB 2FNAA 3FUWA 1SXJC 2FS1A 4I8OA 1TH3A 3C58A 3CF6E 2O01F 4WP2A 4MGKE 1N32M 1G3IA 2O25A 5C18A 4CIZA 4B3MM 1QUSA 2F4VM 4YY3M 2FE8A 2HWJA 1XWIA 2RGOA 2LVAA 4NRVA 4UN2B 3I04M 2QNJA 4AKHA 1ZMUA 3B74A 1IY0A 3VK7A 1W5TA 3GQ4A 4HL4A 1IM2A 1OIZA 3ZH9B 5ITQA 3CF2A 4B08A 4DV1M 4DR1M 3VK8A 2F5QA 3B9PA 4HLQA 2RKOA 3PNVA 4DV0M 4LF9M 5L8RF 1X37A 1L8QA 2EUCA 2Y21A 3L28A 2L4FA 3GRRA 5IREB 1NV9A 1PJJA 2HHHM 5ITTA 3FUUA 3SMSA 1SG9A 2XFSA 2CWBA 3E21A 4A3VB 5IWAM 2C9CA 2BJVA 3A45A 2I7PA 3I4VA 3VDPA 2LVNC 4AKIA 1IFYA 1PJQA 1UFZA 2BWBA 3J7AS 4DV2M 2N35A 3D8BA 3PVSA 1OFHA 3GPUA 5ITXE 3ZQJA 3SBJA 5KQDA 1XMOM 2HKJA 2LVQD 4FCVA 2D7GA 2DZOB 1IN6A 2GNOA 1LV7A 3CF0A 3KOYE 1AUAA 2V1UA 4WURA 1GKIA 3M6AA 4JI3M 3HGIA 2C99A 2KNVA 5ITRA 4D81A 2M60A 3J2PB 2CEAA 3LVWA 3L25A 1IY1A 3LMMA 1JR3A 1PJSA 4IBIA 4LZJA 4LF4M 2UUAM 3W0FA 2MJ5B 1EFUB 2WSEF 1VDDA 4XGIA 4OVZA 5KO3A 3NBIA 2DNAA 2Z4SA 3L26A 4GC5A 2EKKA 3TQSA 1NHWC 1WGNA 2C96A 2ZAMA 1G4AE 4ANRA 2R4JA 1JR3E 1QAOA 1WR1B 2C9OA 3IG5A 1D2NA 4LZZA 4R7GA 5F3WA 1D0KA 4D82A 3U6SA 3GP1A 2YQZA 4M9SA 1NNUC 3DOAA 1HT1E 3H4JA 2K9DA 1IXSA 2MR9A 3FYCA 2CV2A 2L7IA 4JI7M 1DGFA 1IN5A 3K9PA 4L4UA 4MGZE 1VG5A 4P17A 3GLFA 4JI6M 4NXMM 2VF7A 2LTUA 4MB7A 1ZMWA 4LJ7A 5KPTA 1ZQ9A 1ORYB 5FTKA 2C98A 4MM3B 1V34A 3HU2A 1L1ZA 1NJGA 3L29A 1V33A 4BBAA 3FD9A 1IXSB 5FTNA 2XF3A 2JY8A 4L6V6 4LJ6A 4DV6M 3SAUA 4GKKM 1GJSA 4RNAA 3UJNA 4LF6M 3C3EA 1QDTA 3KOZE 3SYKA 4LFCM 2R45A 3B7QA 5ITUA 2UU9M 1MN3A 1Z6TA 2HAKA 1Z5AA 2VQFM 3J80S 3KOXE 1OAIA 1SXJA 1YLAA 2XEPA 4P16A 4R71A 5JI3E 4IBCA 2JY5A 4Z6YA 1Q3CA 3EIHA 1QUTA 3NBXX 2KXEA 1NVMA 1Z5BA 3F92A 3HJSA 3HJ8A 5FTLA 3FRHA 4GH9A 2UXDM 2OO9A 3SHFA 1YSYA 4QNMA 3KS8A 1HNWM 4CHTB 4YHHM 1W5SA 5EXTA 3LQRA 4AW4A 1GABA 4GHAA 4LJ4A 1DGHA 1E9SA 2CP8A 4DR3M 2R4EA 1HNZM 3GLHE 3TL4X 3UGJA 4DR2M 1F4IA 2CHVA 2YR0A 4GITA 4DR6M 1I4WA 1NNJA 4MH0E 3FTCA 3HHYA 4DUZM 1OKSA 2XZUA 4L78A 3TWMA 4GKJM 2EJSA 1OTRA 2DHRA 3T1YM 3SHGB 4X64M 2Z3XA 4NRWA 3SFZA 2J7OA 3I01M 4PCZA 3I51A 2KDLA 1NY5A 1WJ7A 3FUTA 1WXQA 2R46A 5FSWA 2HCBA 2CE7A 4MGIE 5JI2E 2DWLA 3J7BA 1T43A 2OOBA 3HHXA 2JY7A 1FJGM 4KHPM 4AKGA 1JQJC 3GRYA 3U6DA 4B7GA 2QQ8A 2ZTDA 1QANA 2KEBA 1KFVA 3FTEA 3C9PA 3HY5A 3K8ZA 4LCBA 4LY6A 5KQ8A 3OTOM 4DUYM 5E6JA 1NY6A 4ITQA 2LNHC 2QPAA 4AG5A 1OFIA 1IY2A 4FVMA 4Q7JA 4DR4M 3GLIB 1Z59A 4RKUF 3GLIE 3SARA 4DR7M 5FTMA 1P3QQ 1GLNA 4G4RA 2L6OA 3J27B 1ZAEA 1WIVA 2CV1A 5ITXA 4AZFA 2Y0TA 2ZAOA 3AFHA 1R5LA 4PT5A 5KPZA 3L27A 1IBLM 3ZCBB 3IHPA 3I4YA 3ILKA 4AG6A 1N77A 1HQCA 1TH2A 4NOOB 3T38A 2Z8YM 5LMNM 1L1TA 4JI0M 4G4OA 2K6BA 3GO8A 2W82A 2LHCA 4LRSA 1OQYA 4B3SM 1IBMM 1EE8A 4FCWA 3LCVB 1OJLA 3BOSA 4FWHA 1NO1A 3K2LA 3GLGA 3HZJA 1JR3D 1S3SA 4JI1M 4DBGB 4AQYM 1TGUA 1XNQM 3FTFA 1G8PA 3UMMA 3A46A 4DR5M 2DZNB 1T3TA 7CATA 4EIWA 5C1BA 2UUCM 4F1IA 3QYEA 2M5ZA 1PJIA 1G41A 4FW9A 2R62A 5H37D 2DHYA 3GPPA 3GLGE 3GLGB 4IBKA 4X65M 4DV5M 4QHTA 2WSCF 1PM5A 4II7A 4M9XA 4GC9A 3J81S 4G4QA 4LFBM 4X66M 1FNNA 1CUKA 2CUZA 2P5TA 4M0DA 4LRTA 2DAMA 4JI8M 3JR4A 3PFIA 4Y28F 2ZBKB 2XLJA 3B7NA 1NHGC 1MX0A 2J7NA 2XH9A 5EP2A 2E5LM 5IT9S 2F5PA 2LH0A 2KNAA 2V1CA 5A2QS 3UZUA 3QAUA 3R8FA 1YE9A 4L15A 1G71A 1QDRA 2Y0QA 3KFUG 4XBOA 4LJ5A 1QAMA 3PXGA 5BR8M 1HT2E 3FUVA 3KXEC 1T6OA 4BB9A 3PNYA 4DV3M 1QQWA 1H6UA 2F5SA 3GPYA 2OPFA 3B89A 4RF1A 3V76A 4PDGA 4G4NA 4IJFA 3U6OA 1Q39A 1SXJD 2B3TA 4LGMA 2JWSA 3U61A 2A5YB 2LVPC 2X49A 3LQQA 4KODA 3LVVA 4JV5M 3W68A 4CJ6A 2DWNA 1GJTA 2LBCA 3E9SA 2JUJA 2VDBB 4MGYE 3C3DA 2VIIA 3RGSA 4GHLA 4GMQA 4Z8XA 2WZJA 4G3OA 4NC6A 3GQ5A 1QZMA 3HU3A 4FCTA 1A5TA 4M9ZA 2HL7A 2QSFX 3U61B 4IBGA 2XZFA 3Q8GA 3GLHA 3SC3A 5BPVA 2UXBM 1DO2A 1V92A 2RGHA 1AIPC 3FE3A 4LFAM 3AOGA 5E26A 2Q2EB 5DFLA 1XXHE 1GVNA 4AI6A 4XK8F 5FLXS 3GRVA 1DV0A 1R7RA 3DFZA 1ZMVA 2VF8A 3AOEC 4BLCA 3W67A 4JI4M 1QZEA 2Z4RA 3T15A 3SASA 1TDHA 2BWEA 1DGBA 1EIJA 3GLHB 2FFJA 1L2DA 2MROB 1IBKM 4PD2A 2QZ4A 3HX3A 3A42A 2DXIA 4LJAA 3VFDA 2XSZD 4GIPA 5DNYA 2DAKA 8CATA 3AL0C 2QHOB 3U6CA 3TWKA 3IECA 4LJ9A 3T6PA 5DYIA 1YUBA 3RFWA 2DWMA 1HJPA 1MU5A 2GQFA 4W5WA 3L2AA 5EP4A 2ZM6M 1L2CA 3KVWA 4NL4H 3U6QA 4FWGA 3THGA 2KRUA 3NWLA 3AJIB 3BXWA 3LW5F 4KO8A 5EJCA 1R2YA 2DAEA 4OU7A 3GLIA 3FKEA 2XSZA 2MGWA 5FTJA 1R2ZA 3U5ZB 3VLFB 1C1KA 2CRUA 2V6ZM 2H5XA 2KNZA 4IBFA 3W0LB 4LGYA 1XHBA 3KSXA 2LVOC 3VKHA 1IQPA 1VDLA 4G6ZA 3AV0A 2O5RA 1IN7A 3KSJA 2JY6B 2DAGA 2L2DA 2R18A 3TWLA 2CV0A 4B3RM 4B3TM 4R3DA 4TUWA 1NV8A 3MK6A 2ZANA 1DO0A 3M7GA 2RRUA 3U6MA 3SAWA 5EXSA 1D0MA 4FWDA 3U6LA 2CHGA 3SYLA 1C7YA 2L7HA 3U6PA 2QBYB 3U6EA 2UXCM 2FH0A 5ITYA 2CFOA 1OIPA 3FUXA 2UUBM 3MMPA 2J5YA 4IJEA 3BBZA 4JN6A 5GKNA 1PGYA 2NQ8C 2Z7JA 3TPZA 2CHQA 4HEOA 3MHVC 3DA1A 2KA6B 2LHGA 4LF5M 2QENA 1QVRA 4L16A 4CISA 4GRIA 4QHSA 3SATA 2DZLA 3WHKA 3JR5A 1Q3BA 2DENA 4WW0A 4FD2A 1VEKA 2AHMA 3RE8A 4X62M 2Y20A 2JZ0A 3HWSA 2YNMD 2DWZB 2I7NA 4OX9M 2WSFF 5EXPA 2DAIA 3HU1A 2L4EA 1E94E 3HKPA 1E32A 1IXZA 1J7KA 3GRUA 4ZPXA 3WHLA 3HHWA 4QNRA 1NSFA 1LTMA 5LMUM 4DV4M 1N34M 2K47A 3VDUA 3KS4A 3GPXA 2D7EA 4PDIA 4I5SA 3K9OA 1TDZA 4LG2A 2R44A 3QWLA 4LJ8A 4JI5M 3SAVA 3U60A 2OOAA 5EP1A 1XNRM 2LWXA 3VKGA 5IZ7D 3CTWB 2L09A 4I4LA 3IG8A 1KYIA 3JAMS 4JYAM 4I81A 3FRIA 1J09A 3AOEA 1TF0B 2BJWA 3H4MA 2LXEA 3U60B 4IBBA 2KHHA 3UK6A 1HNXM 2QCUA 3EIEA 1WHCA 4NSRA 1J5EM 3ZC7B 2DVWB 4L8RC 2G5GX 1L2BA 3R9XB 3K1JA 3CGWA 2OQ4A 1KSFX 1IN8A 3KP1E 1PJTA 3FYDA 1WGLA 1GL7A 2XGNA 5EXXA 4IBDA 1XXHA 3LCUA 2APLA 1D0LA 3QYBA 1XC8A 2D7HA 2JXNA 4M0WA 1R6BX 3HJQA 1K82A 2X8AA 2C5RA 1OAOC 1NJFA 1Q02A 4OVZB 3KP0E 4RF0A 4MGHA 3B7ZA 3HHZA 1K3WA 1K3XA 3TE6A 3M0EA 3FTDA 1Z5CA 4LF8M 2JZ1A 1TTEA 2BNKA 2ERCA 2EO2A 2KRKA 2KZUA 1TR8A 2KZSA 4JI2M 4KT0F 1XXHB 2R65A 4IBJA 3KDSE 4S12A 4B7HA 2EKFA 3KW6A 4DV7M 4F2LA 3GLFB 4LF7M 3GLFE 4OW0A 1VQ1A 2QP9X 2H1RA 3Q8XA 2YFQA 3GQ3A 1GO5A 3AKZA 1XB2B 4GEWA 2KW0A 2FOIC 2JNHA 4B7FA 1I94M 1VEGA 2XFTA 3KOWE 2VQEM 3A98B 3U5ZA 2JP7A 4K0KM 4NSOB 1HQYE 2R6FA 4IBEA 3RGPA 4IIWA 3MJ5A
chains in the Genus database with same CATH topology
2RRUA 1BVSA 2G3QA 3K9PA 1VG5A 2R0IA 2LTUA 1G41A 1C7YA 1Y8GA 2DHYA 3GLGE 1ZMWA 3E46A 2K0BX 3MMPA 3BBZA 1PGYA 1CUKA 4HEOA 1ZV1A 2DAMA 2JY8A 1VEJA 2ZTCA 1R4GA 1MN3A 2DI0A 2HAKA 2DZLA 2KNAA 2DENA 1OAIA 1VEKA 1YLAA 4R71A 2DKLA 2JY5A 2JZ0A 3F92A 1HT2E 1T6OA 2DAIA 3FRHA 2L4EA 1E94E 2OO9A 3B89A 4WP2A 1G3IA 2O25A 2B3TA 2HWJA 2CP8A 2LVAA 2LVPC 4UN2B 2QNJA 3GLHE 1ZMUA 3K9OA 1F4IA 2LBCA 1IM2A 2JUJA 2OOAA 1OKSA 2EJSA 1OTRA 2WZJA 4G3OA 1A5TA 1KYIA 2L4FA 1WJ7A 2QSFX 1NV9A 1DO2A 1V92A 1AIPC 3FE3A 3FRIA 5JI2E 1SG9A 5DFLA 1T43A 1XXHE 2CWBA 3E21A 2OOBA 2JY7A 2KHHA 1DV0A 2LVNC 1ZMVA 1WHCA 1IFYA 2MR9A 1QZEA 1UFZA 2BWBA 2ZTDA 2BWEA 1WGLA 2LVQD 2MROB 3LCUA 4Q7JA 3GLIE 2DAKA 2K9DA 2QHOB 1P3QQ 1Q02A 3IECA 3T6PA 1WIVA 1HJPA 2KNVA 2JZ1A 1TTEA 1TR8A 2MJ5B 3IHPA 1EFUB 2DAEA 2MGWA 2EKFA 2DNAA 2H5XA 1OQYA 2KNZA 2EKKA 4F2LA 3LCVB 3GLFE 1VQ1A 1WGNA 1G4AE 2LVOC 1GO5A 4F1IA 4DBGB 1JR3E 1WR1B 1VDLA 1XB2B 4GEWA 2JNHA 2JY6B 1VEGA 2DAGA 2L2DA 2JP7A 1HT1E 1NV8A 3H4JA 1HQYE 1IXSA 1DO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RRU A;  1BVS A;  2G3Q A;  3K9P A;  1VG5 A;  2R0I A;  2LTU A;  1G41 A;  1C7Y A;  1Y8G A;  2DHY A;  3GLG E;  1ZMW A;  3E46 A;  2K0B X;  3MMP A;  3BBZ A;  1PGY A;  1CUK A;  4HEO A;  1ZV1 A;  2DAM A;  2JY8 A;  1VEJ A;  2ZTC A;  1R4G A;  1MN3 A;  2DI0 A;  2HAK A;  2DZL A;  2KNA A;  2DEN A;  1OAI A;  1VEK A;  1YLA A;  4R71 A;  2DKL A;  2JY5 A;  2JZ0 A;  3F92 A;  1HT2 E;  1T6O A;  2DAI A;  3FRH A;  2L4E A;  1E94 E;  2OO9 A;  3B89 A;  4WP2 A;  1G3I A;  2O25 A;  2B3T A;  2HWJ A;  2CP8 A;  2LVA A;  2LVP C;  4UN2 B;  2QNJ A;  3GLH E;  1ZMU A;  3K9O A;  1F4I A;  2LBC A;  1IM2 A;  2JUJ A;  2OOA A;  1OKS A;  2EJS A;  1OTR A;  2WZJ A;  4G3O A;  1A5T A;  1KYI A;  2L4F A;  1WJ7 A;  2QSF X;  1NV9 A;  1DO2 A;  1V92 A;  1AIP C;  3FE3 A;  3FRI A;  5JI2 E;  1SG9 A;  5DFL A;  1T43 A;  1XXH E;  2CWB A;  3E21 A;  2OOB A;  2JY7 A;  2KHH A;  1DV0 A;  2LVN C;  1ZMV A;  1WHC A;  1IFY A;  2MR9 A;  1QZE A;  1UFZ A;  2BWB A;  2ZTD A;  2BWE A;  1WGL A;  2LVQ D;  2MRO B;  3LCU A;  4Q7J A;  3GLI E;  2DAK A;  2K9D A;  2QHO B;  1P3Q Q;  1Q02 A;  3IEC A;  3T6P A;  1WIV A;  1HJP A;  2KNV A;  2JZ1 A;  1TTE A;  1TR8 A;  2MJ5 B;  3IHP A;  1EFU B;  2DAE A;  2MGW A;  2EKF A;  2DNA A;  2H5X A;  1OQY A;  2KNZ A;  2EKK A;  4F2L A;  3LCV B;  3GLF E;  1VQ1 A;  1WGN A;  1G4A E;  2LVO C;  1GO5 A;  4F1I A;  4DBG B;  1JR3 E;  1WR1 B;  1VDL A;  1XB2 B;  4GEW A;  2JNH A;  2JY6 B;  1VEG A;  2DAG A;  2L2D A;  2JP7 A;  1HT1 E;  1NV8 A;  3H4J A;  1HQY E;  1IXS A;  1DO0 A; 
#chains in the Genus database with same CATH topology
 2MH8 A;  1DGG A;  1BVS A;  3D8L A;  2G3Q A;  4CGY B;  1N36 M;  4QOS A;  2R0I A;  5DYG A;  1QAQ A;  1Y8G A;  4KLN A;  5EP3 A;  2X4A A;  2K0B X;  3E46 A;  1N78 A;  1RU3 A;  1QYR A;  5EQT A;  4NXN M;  1HR0 M;  1PRB A;  1GL6 A;  1SXJ B;  3SMP A;  1SXJ E;  4REZ A;  1JB0 F;  2EA0 A;  1IXR C;  3DZD A;  1ZV1 A;  1N33 M;  2F5O A;  1IN4 A;  1TH4 A;  1VEJ A;  1UM8 A;  4JXJ A;  5KPR A;  2ZTC A;  1G59 A;  3T1H M;  1MJG M;  1R4G A;  2QBY A;  1N75 A;  2DI0 A;  3K92 A;  2G8L A;  4QOZ C;  1XMQ M;  1E9R A;  3E4R A;  2JA2 A;  2DKL A;  4D80 A;  2F5N A;  1DGH B;  2FNA A;  3FUW A;  1SXJ C;  2FS1 A;  4I8O A;  1TH3 A;  3C58 A;  3CF6 E;  2O01 F;  4WP2 A;  4MGK E;  1N32 M;  1G3I A;  2O25 A;  5C18 A;  4CIZ A;  4B3M M;  1QUS A;  2F4V M;  4YY3 M;  2FE8 A;  2HWJ A;  1XWI A;  2RGO A;  2LVA A;  4NRV A;  4UN2 B;  3I04 M;  2QNJ A;  4AKH A;  1ZMU A;  3B74 A;  1IY0 A;  3VK7 A;  1W5T A;  3GQ4 A;  4HL4 A;  1IM2 A;  1OIZ A;  3ZH9 B;  5ITQ A;  3CF2 A;  4B08 A;  4DV1 M;  4DR1 M;  3VK8 A;  2F5Q A;  3B9P A;  4HLQ A;  2RKO A;  3PNV A;  4DV0 M;  4LF9 M;  5L8R F;  1X37 A;  1L8Q A;  2EUC A;  2Y21 A;  3L28 A;  2L4F A;  3GRR A;  5IRE B;  1NV9 A;  1PJJ A;  2HHH M;  5ITT A;  3FUU A;  3SMS A;  1SG9 A;  2XFS A;  2CWB A;  3E21 A;  4A3V B;  5IWA M;  2C9C A;  2BJV A;  3A45 A;  2I7P A;  3I4V A;  3VDP A;  2LVN C;  4AKI A;  1IFY A;  1PJQ A;  1UFZ A;  2BWB A;  3J7A S;  4DV2 M;  2N35 A;  3D8B A;  3PVS A;  1OFH A;  3GPU A;  5ITX E;  3ZQJ A;  3SBJ A;  5KQD A;  1XMO M;  2HKJ A;  2LVQ D;  4FCV A;  2D7G A;  2DZO B;  1IN6 A;  2GNO A;  1LV7 A;  3CF0 A;  3KOY E;  1AUA A;  2V1U A;  4WUR A;  1GKI A;  3M6A A;  4JI3 M;  3HGI A;  2C99 A;  2KNV A;  5ITR A;  4D81 A;  2M60 A;  3J2P B;  2CEA A;  3LVW A;  3L25 A;  1IY1 A;  3LMM A;  1JR3 A;  1PJS A;  4IBI A;  4LZJ A;  4LF4 M;  2UUA M;  3W0F A;  2MJ5 B;  1EFU B;  2WSE F;  1VDD A;  4XGI A;  4OVZ A;  5KO3 A;  3NBI A;  2DNA A;  2Z4S A;  3L26 A;  4GC5 A;  2EKK A;  3TQS A;  1NHW C;  1WGN A;  2C96 A;  2ZAM A;  1G4A E;  4ANR A;  2R4J A;  1JR3 E;  1QAO A;  1WR1 B;  2C9O A;  3IG5 A;  1D2N A;  4LZZ A;  4R7G A;  5F3W A;  1D0K A;  4D82 A;  3U6S A;  3GP1 A;  2YQZ A;  4M9S A;  1NNU C;  3DOA A;  1HT1 E;  3H4J A;  2K9D A;  1IXS A;  2MR9 A;  3FYC A;  2CV2 A;  2L7I A;  4JI7 M;  1DGF A;  1IN5 A;  3K9P A;  4L4U A;  4MGZ E;  1VG5 A;  4P17 A;  3GLF A;  4JI6 M;  4NXM M;  2VF7 A;  2LTU A;  4MB7 A;  1ZMW A;  4LJ7 A;  5KPT A;  1ZQ9 A;  1ORY B;  5FTK A;  2C98 A;  4MM3 B;  1V34 A;  3HU2 A;  1L1Z A;  1NJG A;  3L29 A;  1V33 A;  4BBA A;  3FD9 A;  1IXS B;  5FTN A;  2XF3 A;  2JY8 A;  4L6V 6;  4LJ6 A;  4DV6 M;  3SAU A;  4GKK M;  1GJS A;  4RNA A;  3UJN A;  4LF6 M;  3C3E A;  1QDT A;  3KOZ E;  3SYK A;  4LFC M;  2R45 A;  3B7Q A;  5ITU A;  2UU9 M;  1MN3 A;  1Z6T A;  2HAK A;  1Z5A A;  2VQF M;  3J80 S;  3KOX E;  1OAI A;  1SXJ A;  1YLA A;  2XEP A;  4P16 A;  4R71 A;  5JI3 E;  4IBC A;  2JY5 A;  4Z6Y A;  1Q3C A;  3EIH A;  1QUT A;  3NBX X;  2KXE A;  1NVM A;  1Z5B A;  3F92 A;  3HJS A;  3HJ8 A;  5FTL A;  3FRH A;  4GH9 A;  2UXD M;  2OO9 A;  3SHF A;  1YSY A;  4QNM A;  3KS8 A;  1HNW M;  4CHT B;  4YHH M;  1W5S A;  5EXT A;  3LQR A;  4AW4 A;  1GAB A;  4GHA A;  4LJ4 A;  1DGH A;  1E9S A;  2CP8 A;  4DR3 M;  2R4E A;  1HNZ M;  3GLH E;  3TL4 X;  3UGJ A;  4DR2 M;  1F4I A;  2CHV A;  2YR0 A;  4GIT A;  4DR6 M;  1I4W A;  1NNJ A;  4MH0 E;  3FTC A;  3HHY A;  4DUZ M;  1OKS A;  2XZU A;  4L78 A;  3TWM A;  4GKJ M;  2EJS A;  1OTR A;  2DHR A;  3T1Y M;  3SHG B;  4X64 M;  2Z3X A;  4NRW A;  3SFZ A;  2J7O A;  3I01 M;  4PCZ A;  3I51 A;  2KDL A;  1NY5 A;  1WJ7 A;  3FUT A;  1WXQ A;  2R46 A;  5FSW A;  2HCB A;  2CE7 A;  4MGI E;  5JI2 E;  2DWL A;  3J7B A;  1T43 A;  2OOB A;  3HHX A;  2JY7 A;  1FJG M;  4KHP M;  4AKG A;  1JQJ C;  3GRY A;  3U6D A;  4B7G A;  2QQ8 A;  2ZTD A;  1QAN A;  2KEB A;  1KFV A;  3FTE A;  3C9P A;  3HY5 A;  3K8Z A;  4LCB A;  4LY6 A;  5KQ8 A;  3OTO M;  4DUY M;  5E6J A;  1NY6 A;  4ITQ A;  2LNH C;  2QPA A;  4AG5 A;  1OFI A;  1IY2 A;  4FVM A;  4Q7J A;  4DR4 M;  3GLI B;  1Z59 A;  4RKU F;  3GLI E;  3SAR A;  4DR7 M;  5FTM A;  1P3Q Q;  1GLN A;  4G4R A;  2L6O A;  3J27 B;  1ZAE A;  1WIV A;  2CV1 A;  5ITX A;  4AZF A;  2Y0T A;  2ZAO A;  3AFH A;  1R5L A;  4PT5 A;  5KPZ A;  3L27 A;  1IBL M;  3ZCB B;  3IHP A;  3I4Y A;  3ILK A;  4AG6 A;  1N77 A;  1HQC A;  1TH2 A;  4NOO B;  3T38 A;  2Z8Y M;  5LMN M;  1L1T A;  4JI0 M;  4G4O A;  2K6B A;  3GO8 A;  2W82 A;  2LHC A;  4LRS A;  1OQY A;  4B3S M;  1IBM M;  1EE8 A;  4FCW A;  3LCV B;  1OJL A;  3BOS A;  4FWH A;  1NO1 A;  3K2L A;  3GLG A;  3HZJ A;  1JR3 D;  1S3S A;  4JI1 M;  4DBG B;  4AQY M;  1TGU A;  1XNQ M;  3FTF A;  1G8P A;  3UMM A;  3A46 A;  4DR5 M;  2DZN B;  1T3T A;  7CAT A;  4EIW A;  5C1B A;  2UUC M;  4F1I A;  3QYE A;  2M5Z A;  1PJI A;  1G41 A;  4FW9 A;  2R62 A;  5H37 D;  2DHY A;  3GPP A;  3GLG E;  3GLG B;  4IBK A;  4X65 M;  4DV5 M;  4QHT A;  2WSC F;  1PM5 A;  4II7 A;  4M9X A;  4GC9 A;  3J81 S;  4G4Q A;  4LFB M;  4X66 M;  1FNN A;  1CUK A;  2CUZ A;  2P5T A;  4M0D A;  4LRT A;  2DAM A;  4JI8 M;  3JR4 A;  3PFI A;  4Y28 F;  2ZBK B;  2XLJ A;  3B7N A;  1NHG C;  1MX0 A;  2J7N A;  2XH9 A;  5EP2 A;  2E5L M;  5IT9 S;  2F5P A;  2LH0 A;  2KNA A;  2V1C A;  5A2Q S;  3UZU A;  3QAU A;  3R8F A;  1YE9 A;  4L15 A;  1G71 A;  1QDR A;  2Y0Q A;  3KFU G;  4XBO A;  4LJ5 A;  1QAM A;  3PXG A;  5BR8 M;  1HT2 E;  3FUV A;  3KXE C;  1T6O A;  4BB9 A;  3PNY A;  4DV3 M;  1QQW A;  1H6U A;  2F5S A;  3GPY A;  2OPF A;  3B89 A;  4RF1 A;  3V76 A;  4PDG A;  4G4N A;  4IJF A;  3U6O A;  1Q39 A;  1SXJ D;  2B3T A;  4LGM A;  2JWS A;  3U61 A;  2A5Y B;  2LVP C;  2X49 A;  3LQQ A;  4KOD A;  3LVV A;  4JV5 M;  3W68 A;  4CJ6 A;  2DWN A;  1GJT A;  2LBC A;  3E9S A;  2JUJ A;  2VDB B;  4MGY E;  3C3D A;  2VII A;  3RGS A;  4GHL A;  4GMQ A;  4Z8X A;  2WZJ A;  4G3O A;  4NC6 A;  3GQ5 A;  1QZM A;  3HU3 A;  4FCT A;  1A5T A;  4M9Z A;  2HL7 A;  2QSF X;  3U61 B;  4IBG A;  2XZF A;  3Q8G A;  3GLH A;  3SC3 A;  5BPV A;  2UXB M;  1DO2 A;  1V92 A;  2RGH A;  1AIP C;  3FE3 A;  4LFA M;  3AOG A;  5E26 A;  2Q2E B;  5DFL A;  1XXH E;  1GVN A;  4AI6 A;  4XK8 F;  5FLX S;  3GRV A;  1DV0 A;  1R7R A;  3DFZ A;  1ZMV A;  2VF8 A;  3AOE C;  4BLC A;  3W67 A;  4JI4 M;  1QZE A;  2Z4R A;  3T15 A;  3SAS A;  1TDH A;  2BWE A;  1DGB A;  1EIJ A;  3GLH B;  2FFJ A;  1L2D A;  2MRO B;  1IBK M;  4PD2 A;  2QZ4 A;  3HX3 A;  3A42 A;  2DXI A;  4LJA A;  3VFD A;  2XSZ D;  4GIP A;  5DNY A;  2DAK A;  8CAT A;  3AL0 C;  2QHO B;  3U6C A;  3TWK A;  3IEC A;  4LJ9 A;  3T6P A;  5DYI A;  1YUB A;  3RFW A;  2DWM A;  1HJP A;  1MU5 A;  2GQF A;  4W5W A;  3L2A A;  5EP4 A;  2ZM6 M;  1L2C A;  3KVW A;  4NL4 H;  3U6Q A;  4FWG A;  3THG A;  2KRU A;  3NWL A;  3AJI B;  3BXW A;  3LW5 F;  4KO8 A;  5EJC A;  1R2Y A;  2DAE A;  4OU7 A;  3GLI A;  3FKE A;  2XSZ A;  2MGW A;  5FTJ A;  1R2Z A;  3U5Z B;  3VLF B;  1C1K A;  2CRU A;  2V6Z M;  2H5X A;  2KNZ A;  4IBF A;  3W0L B;  4LGY A;  1XHB A;  3KSX A;  2LVO C;  3VKH A;  1IQP A;  1VDL A;  4G6Z A;  3AV0 A;  2O5R A;  1IN7 A;  3KSJ A;  2JY6 B;  2DAG A;  2L2D A;  2R18 A;  3TWL A;  2CV0 A;  4B3R M;  4B3T M;  4R3D A;  4TUW A;  1NV8 A;  3MK6 A;  2ZAN A;  1DO0 A;  3M7G A;  2RRU A;  3U6M A;  3SAW A;  5EXS A;  1D0M A;  4FWD A;  3U6L A;  2CHG A;  3SYL A;  1C7Y A;  2L7H A;  3U6P A;  2QBY B;  3U6E A;  2UXC M;  2FH0 A;  5ITY A;  2CFO A;  1OIP A;  3FUX A;  2UUB M;  3MMP A;  2J5Y A;  4IJE A;  3BBZ A;  4JN6 A;  5GKN A;  1PGY A;  2NQ8 C;  2Z7J A;  3TPZ A;  2CHQ A;  4HEO A;  3MHV C;  3DA1 A;  2KA6 B;  2LHG A;  4LF5 M;  2QEN A;  1QVR A;  4L16 A;  4CIS A;  4GRI A;  4QHS A;  3SAT A;  2DZL A;  3WHK A;  3JR5 A;  1Q3B A;  2DEN A;  4WW0 A;  4FD2 A;  1VEK A;  2AHM A;  3RE8 A;  4X62 M;  2Y20 A;  2JZ0 A;  3HWS A;  2YNM D;  2DWZ B;  2I7N A;  4OX9 M;  2WSF F;  5EXP A;  2DAI A;  3HU1 A;  2L4E A;  1E94 E;  3HKP A;  1E32 A;  1IXZ A;  1J7K A;  3GRU A;  4ZPX A;  3WHL A;  3HHW A;  4QNR A;  1NSF A;  1LTM A;  5LMU M;  4DV4 M;  1N34 M;  2K47 A;  3VDU A;  3KS4 A;  3GPX A;  2D7E A;  4PDI A;  4I5S A;  3K9O A;  1TDZ A;  4LG2 A;  2R44 A;  3QWL A;  4LJ8 A;  4JI5 M;  3SAV A;  3U60 A;  2OOA A;  5EP1 A;  1XNR M;  2LWX A;  3VKG A;  5IZ7 D;  3CTW B;  2L09 A;  4I4L A;  3IG8 A;  1KYI A;  3JAM S;  4JYA M;  4I81 A;  3FRI A;  1J09 A;  3AOE A;  1TF0 B;  2BJW A;  3H4M A;  2LXE A;  3U60 B;  4IBB A;  2KHH A;  3UK6 A;  1HNX M;  2QCU A;  3EIE A;  1WHC A;  4NSR A;  1J5E M;  3ZC7 B;  2DVW B;  4L8R C;  2G5G X;  1L2B A;  3R9X B;  3K1J A;  3CGW A;  2OQ4 A;  1KSF X;  1IN8 A;  3KP1 E;  1PJT A;  3FYD A;  1WGL A;  1GL7 A;  2XGN A;  5EXX A;  4IBD A;  1XXH A;  3LCU A;  2APL A;  1D0L A;  3QYB A;  1XC8 A;  2D7H A;  2JXN A;  4M0W A;  1R6B X;  3HJQ A;  1K82 A;  2X8A A;  2C5R A;  1OAO C;  1NJF A;  1Q02 A;  4OVZ B;  3KP0 E;  4RF0 A;  4MGH A;  3B7Z A;  3HHZ A;  1K3W A;  1K3X A;  3TE6 A;  3M0E A;  3FTD A;  1Z5C A;  4LF8 M;  2JZ1 A;  1TTE A;  2BNK A;  2ERC A;  2EO2 A;  2KRK A;  2KZU A;  1TR8 A;  2KZS A;  4JI2 M;  4KT0 F;  1XXH B;  2R65 A;  4IBJ A;  3KDS E;  4S12 A;  4B7H A;  2EKF A;  3KW6 A;  4DV7 M;  4F2L A;  3GLF B;  4LF7 M;  3GLF E;  4OW0 A;  1VQ1 A;  2QP9 X;  2H1R A;  3Q8X A;  2YFQ A;  3GQ3 A;  1GO5 A;  3AKZ A;  1XB2 B;  4GEW A;  2KW0 A;  2FOI C;  2JNH A;  4B7F A;  1I94 M;  1VEG A;  2XFT A;  3KOW E;  2VQE M;  3A98 B;  3U5Z A;  2JP7 A;  4K0K M;  4NSO B;  1HQY E;  2R6F A;  4IBE A;  3RGP A;  4IIW A;  3MJ5 A; 
#chains in the Genus database with same CATH homology
 2RRU A;  1BVS A;  2G3Q A;  3K9P A;  1VG5 A;  2R0I A;  2LTU A;  1G41 A;  1C7Y A;  1Y8G A;  2DHY A;  3GLG E;  1ZMW A;  3E46 A;  2K0B X;  3MMP A;  3BBZ A;  1PGY A;  1CUK A;  4HEO A;  1ZV1 A;  2DAM A;  2JY8 A;  1VEJ A;  2ZTC A;  1R4G A;  1MN3 A;  2DI0 A;  2HAK A;  2DZL A;  2KNA A;  2DEN A;  1OAI A;  1VEK A;  1YLA A;  4R71 A;  2DKL A;  2JY5 A;  2JZ0 A;  3F92 A;  1HT2 E;  1T6O A;  2DAI A;  3FRH A;  2L4E A;  1E94 E;  2OO9 A;  3B89 A;  4WP2 A;  1G3I A;  2O25 A;  2B3T A;  2HWJ A;  2CP8 A;  2LVA A;  2LVP C;  4UN2 B;  2QNJ A;  3GLH E;  1ZMU A;  3K9O A;  1F4I A;  2LBC A;  1IM2 A;  2JUJ A;  2OOA A;  1OKS A;  2EJS A;  1OTR A;  2WZJ A;  4G3O A;  1A5T A;  1KYI A;  2L4F A;  1WJ7 A;  2QSF X;  1NV9 A;  1DO2 A;  1V92 A;  1AIP C;  3FE3 A;  3FRI A;  5JI2 E;  1SG9 A;  5DFL A;  1T43 A;  1XXH E;  2CWB A;  3E21 A;  2OOB A;  2JY7 A;  2KHH A;  1DV0 A;  2LVN C;  1ZMV A;  1WHC A;  1IFY A;  2MR9 A;  1QZE A;  1UFZ A;  2BWB A;  2ZTD A;  2BWE A;  1WGL A;  2LVQ D;  2MRO B;  3LCU A;  4Q7J A;  3GLI E;  2DAK A;  2K9D A;  2QHO B;  1P3Q Q;  1Q02 A;  3IEC A;  3T6P A;  1WIV A;  1HJP A;  2KNV A;  2JZ1 A;  1TTE A;  1TR8 A;  2MJ5 B;  3IHP A;  1EFU B;  2DAE A;  2MGW A;  2EKF A;  2DNA A;  2H5X A;  1OQY A;  2KNZ A;  2EKK A;  4F2L A;  3LCV B;  3GLF E;  1VQ1 A;  1WGN A;  1G4A E;  2LVO C;  1GO5 A;  4F1I A;  4DBG B;  1JR3 E;  1WR1 B;  1VDL A;  1XB2 B;  4GEW A;  2JNH A;  2JY6 B;  1VEG A;  2DAG A;  2L2D A;  2JP7 A;  1HT1 E;  1NV8 A;  3H4J A;  1HQY E;  1IXS A;  1DO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...