2LVPC

Gp78cue domain bound to the distal ubiquitin of k48-linked diubiquitin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
52
structure length
52
Chain Sequence
SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin
publication title Promiscuous Interactions of gp78 E3 Ligase CUE Domain with Polyubiquitin Chains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/ligase
total genus 13
structure length 52
sequence length 52
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02845 CUE CUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2lvpC00
1AIPC 1OAIA 1Q02A 2B3TA 2R0IA 3K9PA 1Y8GA 2KNVA 2LVAA 1NV9A 2DENA 1EFUB 1A5TA 3MMPA 4GEWA 4F1IA 3FE3A 1JR3E 1ZMVA 2OO9A 3E21A 1GO5A 1KYIA 2LBCA 1DO2A 2JZ0A 4G3OA 3GLGE 2DAKA 4Q7JA 1R4GA 2BWBA 1P3QQ 1IFYA 1XB2B 2QSFX 2ZTCA 1XXHE 2JZ1A 4R71A 2KNAA 3T6PA 2CWBA 5JI2E 1WHCA 1HJPA 1WR1B 3BBZA 2LVOC 3FRHA 2LTUA 2EKFA 3LCVB 2DNAA 1OTRA 3K9OA 2H5XA 2BWEA 1VEJA 1QZEA 2JY6B 3F92A 2DAEA 1HT2E 2QHOB 3FRIA 1T43A 1ZMUA 4HEOA 2WZJA 1PGYA 1ZV1A 2QNJA 3IECA 1G41A 1CUKA 1G4AE 1BVSA 4UN2B 2G3QA 4DBGB 2JY5A 2MJ5B 1IXSA 1SG9A 2O25A 1TR8A 1F4IA 2JUJA 1DO0A 2OOAA 2L4FA 1DV0A 2KHHA 1C7YA 1OQYA 1IM2A 2JP7A 1NV8A 2KNZA 2MROB 1VDLA 5DFLA 3B89A 2CP8A 2DAGA 1VG5A 1HT1E 2DKLA 2ZTDA 2JNHA 1YLAA 3H4JA 3E46A 4F2LA 1G3IA 4WP2A 3LCUA 2LVPC 1WIVA 2OOBA 2RRUA 1WGNA 2MR9A 1E94E 1UFZA 1VEKA 1TTEA 2K9DA 3IHPA 2K0BX 1WGLA 2DI0A 2HAKA 2MGWA 2DHYA 2EKKA 2L4EA 1VEGA 2JY7A 3GLFE 2DAIA 1WJ7A 2HWJA 1MN3A 1OKSA 2LVNC 2JY8A 1VQ1A 3GLIE 1V92A 3GLHE 1HQYE 2EJSA 2LVQD 1ZMWA 2L2DA 2DAMA 1T6OA 2DZLA
chains in the Genus database with same CATH superfamily
4GC5A 1PJJA 1Q02A 4LF7M 2ZANA 2R0IA 4NOOB 1TDZA 1IN6A 2XFTA 3U60B 2W82A 4RNAA 1EFUB 3MMPA 4LF4M 3FE3A 3I4YA 3QAUA 1JR3E 4BBAA 4JI2M 1L1ZA 1K82A 3AV0A 1TH3A 1AUAA 2DZNB 2LBCA 2LH0A 2BJVA 2X8AA 1XMOM 4JI5M 3VFDA 1NSFA 2L7IA 5ITUA 2CUZA 1P3QQ 3GQ4A 2DXIA 3GRVA 1T3TA 4R71A 1L2CA 2ZTCA 5EP4A 2JZ1A 4NSOB 2CWBA 1Q3CA 4M9SA 1WHCA 2AHMA 1WR1B 4I8OA 4WURA 3TE6A 4YHHM 3C58A 2QBYA 1J7KA 3LCVB 2LTUA 4QHTA 1XMQM 3GRUA 4KT0F 3HHWA 4IBEA 4FWDA 1FNNA 1QYRA 3QWLA 1QZEA 4IBBA 2UXBM 1I94M 2JY6B 3R8FA 2DAEA 3SMSA 2XZFA 2HL7A 4RKUF 5FTNA 3AKZA 1J5EM 2CV2A 1T43A 3Q8XA 3HZJA 1PGYA 2R62A 3VK8A 3AFHA 3JR5A 2VIIA 4HLQA 1G41A 2QENA 2KW0A 4L4UA 4B3SM 2RKOA 4KLNA 4LF9M 1BVSA 4CISA 3AOGA 1HR0M 5C1BA 2XLJA 4AW4A 4LGMA 2YFQA 2MJ5B 3L26A 2N35A 2LHGA 3KP0E 4NL4H 4MGIE 1IN8A 2XF3A 1X37A 4LF6M 2OOAA 1DV0A 2KHHA 1C7YA 3L25A 4RF1A 2UUBM 1OQYA 3U6SA 1E9SA 1DGBA 2CHVA 1VDLA 2KRUA 1VG5A 4JI7M 2DZOB 1HT1E 3B7NA 1SXJC 4ZPXA 2UXDM 1JR3D 1YLAA 1IQPA 1UM8A 2R65A 3E46A 3HJQA 4DUZM 3PNYA 2UU9M 3GLFB 1GO5A 2D7EA 4Z8XA 2JWSA 1HQCA 3FUVA 1QDRA 1WIVA 2OOBA 1MX0A 2RRUA 3RGSA 2RGOA 3TPZA 4MGHA 1SXJB 1QZMA 3GLHB 3RGPA 4QOZC 3DFZA 3KS8A 1WXQA 3IHPA 3SAUA 3L29A 3J7BA 2QZ4A 3SASA 1WGLA 2LWXA 3GPYA 1IY2A 4HL4A 1W5TA 4D80A 2HAKA 1IXSB 3FTCA 2MGWA 2DHYA 4DV0M 4B3TM 1VEGA 1NHGC 3UMMA 2V1CA 2JY7A 4JV5M 4WW0A 1GL6A 4QNRA 2XZUA 3FKEA 2DHRA 1N75A 3E9SA 4GKKM 2JY8A 4X62M 1DGHA 3U6MA 3V76A 4KHPM 3GLIE 1PJIA 3NBIA 4DV7M 1XXHA 3SYKA 1R5LA 3GPUA 1XHBA 3PXGA 2DWZB 2F5SA 2DAMA 3B7QA 4OW0A 2ZAOA 1NO1A 2H1RA 2GNOA 3ZQJA 3BXWA 3GLIB 4QNMA 3SAVA 4A3VB 1R2YA 4DR7M 3U61A 3BOSA 2CFOA 3W0FA 1EIJA 4CIZA 2D7HA 1IBLM 2QQ8A 1LV7A 2FS1A 4NXMM 4L78A 3UGJA 3SARA 5BPVA 1DGFA 2DENA 4PDGA 3M0EA 2CE7A 3HGIA 2OO9A 3SHFA 4DV4M 2DWLA 1KYIA 1GJTA 3RE8A 1DO2A 4G3OA 3GLGE 2C96A 1R4GA 5ITRA 4NC6A 2X49A 3A42A 2BWBA 1N77A 2V1UA 1IFYA 3DOAA 1SXJD 3B9PA 3GO8A 3T38A 4Z6YA 2L6OA 2J7OA 4DR5M 4B7GA 2OQ4A 4G4RA 2Z7JA 4MGZE 4DV1M 1L2BA 1N33M 2FOIC 2LVOC 3CGWA 4JI8M 2F5OA 2DNAA 3KSJA 4S12A 5FLXS 2H5XA 3A46A 2C5RA 4FVMA 3FD9A 1VEJA 1G8PA 4DR4M 3NBXX 4L15A 3UK6A 4OX9M 1XWIA 5IWAM 1GL7A 2VDBB 3FRIA 3HWSA 2KZSA 4G6ZA 3W0LB 4LFCM 4HEOA 1ZV1A 3LW5F 3W67A 5E26A 1R6BX 3IECA 3GLIA 2CV0A 1HNXM 1G4AE 1IBMM 2JXNA 3KOYE 3KFUG 1GKIA 2G3QA 3H4MA 1NY5A 4AG6A 3GRRA 2JA2A 2RGHA 2JY5A 3C3EA 4G4NA 4JI3M 1NJFA 3FYCA 4JI4M 1D2NA 1SG9A 4GITA 3CF0A 2ZM6M 3FUUA 3FUTA 4M0WA 3THGA 1HNZM 3SFZA 4DR6M 2CRUA 4M9ZA 2J5YA 3U5ZB 2I7NA 3U6DA 2OPFA 2JP7A 5EXTA 2R4JA 1JB0F 2KRKA 2MROB 5DFLA 1QUTA 4MM3B 3GLGA 1GABA 3PVSA 2LNHC 2Y21A 4AG5A 4I5SA 4LJ4A 4F2LA 1G3IA 2QPAA 1IN7A 2CHGA 3J2PB 4WP2A 4Y28F 5ITXA 1VDDA 1PJQA 2L7HA 2VQEM 1PM5A 3EIEA 4R3DA 1QAMA 1WGNA 3U60A 5EXPA 1E94E 2Q2EB 3MHVC 4QHSA 5EJCA 3TQSA 1TTEA 1TH4A 3B74A 3OTOM 2BNKA 3FUWA 3D8BA 1OIZA 3KOZE 2K0BX 1Z5CA 2HKJA 3LVWA 1LTMA 3HKPA 4DUYM 4NRVA 5ITTA 2YQZA 1I4WA 4B7HA 4K0KM 1JR3A 1QAOA 2O01F 4YY3M 1K3XA 3GLFE 5FSWA 2K6BA 2LXEA 5EXXA 8CATA 1NNJA 4EIWA 2LVNC 3SATA 4LJAA 1YE9A 2R44A 3L28A 4JXJA 4IBDA 1SXJE 3KVWA 3GLHE 1XNQM 4MGYE 3J80S 3SAWA 3U5ZA 1HQYE 2LVQD 4LFBM 2C9OA 2DWMA 4NSRA 3GQ3A 1FJGM 3Q8GA 4GKJM 4JI6M 1OAOC 2G5GX 2DZLA 4TUWA 5EQTA 1R2ZA 3K92A 2APLA 5L8RF 1OAIA 2B3TA 1ORYB 1Z59A 1EE8A 3K9PA 1Y8GA 1OFHA 1MJGM 3AOEC 3HJSA 1GVNA 2FNAA 2C9CA 3WHKA 3L27A 4NXNM 3J81S 2K47A 3PFIA 3TWLA 4GEWA 7CATA 4ITQA 3AL0C 2ERCA 2F5NA 3HHXA 5KPZA 4LJ8A 4D81A 4X64M 4RF0A 1IN4A 4LJ6A 3HHYA 3VKHA 5DNYA 3I4VA 5LMUM 1E32A 5FTMA 1XB2B 3FYDA 2KNAA 3T6PA 3GRYA 3SBJA 2XFSA 3U6QA 1QQWA 4OVZB 4LCBA 3BBZA 3ILKA 3TL4X 4MB7A 2FH0A 2CEAA 3E4RA 4JN6A 2G8LA 3LQQA 5F3WA 5KO3A 2XSZA 4GRIA 2QCUA 3GLFA 2QHOB 3D8LA 3QYEA 4IJEA 5H37D 1ZMUA 2FE8A 4LRSA 2XSZD 1L2DA 2WZJA 2QNJA 5EXSA 3FTEA 1SXJA 3K8ZA 1CUKA 3GLHA 3HX3A 4UN2B 1S3SA 1QAQA 1K3WA 3FTFA 2WSCF 3K1JA 4B7FA 1QDTA 4W5WA 4XBOA 4LY6A 5FTKA 3A45A 4JI0M 4DBGB 1IXSA 2Y20A 2DVWB 2O25A 4FW9A 1Q39A 1TR8A 4BLCA 1TDHA 2NQ8C 3M7GA 3GP1A 3A98B 2Y0TA 4LZJA 4BB9A 1IY1A 1KFVA 2WSEF 1NV8A 1MU5A 3M6AA 1V34A 3VDUA 2KNZA 1J09A 5KPRA 4GHAA 2QBYB 2CP8A 2DAGA 3RFWA 1D0KA 2GQFA 4OU7A 2DKLA 2R6FA 3EIHA 2MH8A 4OVZA 4AKGA 2JNHA 3L2AA 2UUAM 3H4JA 4P17A 5EP1A 2P5TA 1NJGA 3U6OA 1N32M 5E6JA 5DYGA 3SYLA 2WSFF 4R7GA 1TH2A 3KP1E 4AZFA 4B08A 4CJ6A 2EA0A 3UJNA 4DV2M 4JI1M 2O5RA 5KQDA 2MR9A 1UFZA 2Y0QA 1VEKA 2YR0A 4REZA 4I4LA 4AQYM 1YSYA 2K9DA 1OJLA 3GQ5A 4GH9A 1PJSA 4DR2M 4LF8M 2YNMD 4GHLA 2DI0A 2Z8YM 3IG8A 2QP9X 3KDSE 1Z6TA 2M5ZA 1W5SA 1IY0A 2L4EA 5FTLA 3ZC7B 3LVVA 1PJTA 2KZUA 4FWHA 3KXEC 5ITQA 1JQJC 3HY5A 4FCTA 2VQFM 2DAIA 1WJ7A 4IBCA 1R7RA 5EP3A 4D82A 1V33A 3C9PA 4II7A 2VF7A 3GPPA 4B3MM 1MN3A 4MH0E 1NHWC 1C1KA 2CV1A 1VQ1A 5JI3E 3K2LA 2L09A 3B7ZA 2KXEA 3J27B 1XC8A 5IT9S 3DZDA 2VF8A 3GPXA 1ZMWA 4LFAM 3VKGA 1NY6A 2XGNA 3CF6E 4P16A 5LMNM 1T6OA 2HCBA 3ZH9B 4G4QA 2D7GA 3U6LA 1AIPC 4B3RM 1ZAEA 3SC3A 3TWKA 1KSFX 3U6EA 2KNVA 2F4VM 2EUCA 4CHTB 1IBKM 4LRTA 2LVAA 5A2QS 1NV9A 2R4EA 4I81A 5IZ7D 4XGIA 1PRBA 4FD2A 1A5TA 4L8RC 4DV6M 4F1IA 1IXRC 2LHCA 4ANRA 2Z4SA 1ZMVA 3E21A 4FCWA 1IN5A 4IBFA 4LZZA 1L1TA 1YUBA 2C98A 3FTDA 3IG5A 3KS4A 2JZ0A 3WHLA 2DAKA 4IBIA 4Q7JA 3T15A 3J7AS 3HU2A 3HU1A 3TWMA 1TGUA 3NWLA 2QSFX 5JI2E 3UZUA 1XXHE 3LMMA 4GIPA 4NRWA 4X65M 4FWGA 5BR8M 4LF5M 1HJPA 1QUSA 3LQRA 1DGHB 2ZBKB 1RU3A 1Z5BA 4IBJA 4LJ9A 5FTJA 3SMPA 3ZCBB 4PDIA 1TF0B 3FRHA 4IJFA 2EKFA 1D0LA 1XXHB 1OTRA 3K9OA 3I01M 4FCVA 1G71A 1E9RA 1G59A 2BWEA 2Z4RA 1H6UA 4IBKA 4DR1M 4GC9A 1QANA 3F92A 1IXZA 3HJ8A 1HT2E 2KEBA 5IREB 5ITYA 4KODA 3U61B 1GLNA 2BJWA 2KDLA 4PT5A 3T1HM 4CGYB 2A5YB 4M9XA 1N36M 3CTWB 5GKNA 4GMQA 3AJIB 5KQ8A 4MGKE 1OIPA 1N78A 3I04M 4AKIA 2V6ZM 3HHZA 4IBGA 3MK6A 4LGYA 4PCZA 4JYAM 1F4IA 2M60A 2JUJA 2Z3XA 1DO0A 2L4FA 3T1YM 4L16A 4PD2A 3KSXA 4DV3M 1IM2A 2FFJA 4IIWA 4AKHA 2J7NA 3VK7A 3B89A 1L8QA 3KOWE 3U6CA 2I7PA 5EP2A 2R45A 4LG2A 2ZTDA 4QOSA 2F5PA 2X4AA 1XNRM 1OFIA 2E5LM 4LJ7A 2XH9A 1D0MA 3LCUA 3KOXE 4M0DA 3W68A 2LVPC 1NVMA 3KW6A 2C99A 4X66M 4DR3M 4XK8F 3U6PA 1GJSA 5DYIA 2ZAMA 1NNUC 3HU3A 2UUCM 3C3DA 3JR4A 4KO8A 3AOEA 3PNVA 2EKKA 2HHHM 3I51A 4L6V6 5KPTA 4AI6A 1ZQ9A 3VDPA 3VLFB 2HWJA 2XEPA 5C18A 3JAMS 3SHGB 1OKSA 1HNWM 2R46A 3DA1A 2R18A 3FUXA 2CHQA 2UXCM 1V92A 5ITXE 2EJSA 1Z5AA 3MJ5A 3GLGB 1QVRA 1Q3BA 2DWNA 4DV5M 2L2DA 4G4OA 2F5QA 4LJ5A 2EO2A 3QYBA 1N34M 1DGGA 3R9XB 3CF2A 2KA6B
chains in the Genus database with same CATH topology
1AIPC 1OAIA 1Q02A 2B3TA 2R0IA 3K9PA 1Y8GA 2KNVA 2LVAA 1NV9A 2DENA 1EFUB 1A5TA 3MMPA 4GEWA 4F1IA 3FE3A 1JR3E 1ZMVA 2OO9A 3E21A 1GO5A 1KYIA 2LBCA 1DO2A 2JZ0A 4G3OA 3GLGE 2DAKA 4Q7JA 1R4GA 2BWBA 1P3QQ 1IFYA 1XB2B 2QSFX 2ZTCA 1XXHE 2JZ1A 4R71A 2KNAA 3T6PA 2CWBA 5JI2E 1WHCA 1HJPA 1WR1B 3BBZA 2LVOC 3FRHA 2LTUA 2EKFA 3LCVB 2DNAA 1OTRA 3K9OA 2H5XA 2BWEA 1VEJA 1QZEA 2JY6B 3F92A 2DAEA 1HT2E 2QHOB 3FRIA 1T43A 1ZMUA 4HEOA 2WZJA 1PGYA 1ZV1A 2QNJA 3IECA 1G41A 1CUKA 1G4AE 1BVSA 4UN2B 2G3QA 4DBGB 2JY5A 2MJ5B 1IXSA 1SG9A 2O25A 1TR8A 1F4IA 2JUJA 1DO0A 2OOAA 2L4FA 1DV0A 2KHHA 1C7YA 1OQYA 1IM2A 2JP7A 1NV8A 2KNZA 2MROB 1VDLA 5DFLA 3B89A 2CP8A 2DAGA 1VG5A 1HT1E 2DKLA 2ZTDA 2JNHA 1YLAA 3H4JA 3E46A 4F2LA 1G3IA 4WP2A 3LCUA 2LVPC 1WIVA 2OOBA 2RRUA 1WGNA 2MR9A 1E94E 1UFZA 1VEKA 1TTEA 2K9DA 3IHPA 2K0BX 1WGLA 2DI0A 2HAKA 2MGWA 2DHYA 2EKKA 2L4EA 1VEGA 2JY7A 3GLFE 2DAIA 1WJ7A 2HWJA 1MN3A 1OKSA 2LVNC 2JY8A 1VQ1A 3GLIE 1V92A 3GLHE 1HQYE 2EJSA 2LVQD 1ZMWA 2L2DA 2DAMA 1T6OA 2DZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AIP C;  1OAI A;  1Q02 A;  2B3T A;  2R0I A;  3K9P A;  1Y8G A;  2KNV A;  2LVA A;  1NV9 A;  2DEN A;  1EFU B;  1A5T A;  3MMP A;  4GEW A;  4F1I A;  3FE3 A;  1JR3 E;  1ZMV A;  2OO9 A;  3E21 A;  1GO5 A;  1KYI A;  2LBC A;  1DO2 A;  2JZ0 A;  4G3O A;  3GLG E;  2DAK A;  4Q7J A;  1R4G A;  2BWB A;  1P3Q Q;  1IFY A;  1XB2 B;  2QSF X;  2ZTC A;  1XXH E;  2JZ1 A;  4R71 A;  2KNA A;  3T6P A;  2CWB A;  5JI2 E;  1WHC A;  1HJP A;  1WR1 B;  3BBZ A;  2LVO C;  3FRH A;  2LTU A;  2EKF A;  3LCV B;  2DNA A;  1OTR A;  3K9O A;  2H5X A;  2BWE A;  1VEJ A;  1QZE A;  2JY6 B;  3F92 A;  2DAE A;  1HT2 E;  2QHO B;  3FRI A;  1T43 A;  1ZMU A;  4HEO A;  2WZJ A;  1PGY A;  1ZV1 A;  2QNJ A;  3IEC A;  1G41 A;  1CUK A;  1G4A E;  1BVS A;  4UN2 B;  2G3Q A;  4DBG B;  2JY5 A;  2MJ5 B;  1IXS A;  1SG9 A;  2O25 A;  1TR8 A;  1F4I A;  2JUJ A;  1DO0 A;  2OOA A;  2L4F A;  1DV0 A;  2KHH A;  1C7Y A;  1OQY A;  1IM2 A;  2JP7 A;  1NV8 A;  2KNZ A;  2MRO B;  1VDL A;  5DFL A;  3B89 A;  2CP8 A;  2DAG A;  1VG5 A;  1HT1 E;  2DKL A;  2ZTD A;  2JNH A;  1YLA A;  3H4J A;  3E46 A;  4F2L A;  1G3I A;  4WP2 A;  3LCU A;  2LVP C;  1WIV A;  2OOB A;  2RRU A;  1WGN A;  2MR9 A;  1E94 E;  1UFZ A;  1VEK A;  1TTE A;  2K9D A;  3IHP A;  2K0B X;  1WGL A;  2DI0 A;  2HAK A;  2MGW A;  2DHY A;  2EKK A;  2L4E A;  1VEG A;  2JY7 A;  3GLF E;  2DAI A;  1WJ7 A;  2HWJ A;  1MN3 A;  1OKS A;  2LVN C;  2JY8 A;  1VQ1 A;  3GLI E;  1V92 A;  3GLH E;  1HQY E;  2EJS A;  2LVQ D;  1ZMW A;  2L2D A;  2DAM A;  1T6O A;  2DZL A; 
#chains in the Genus database with same CATH topology
 4GC5 A;  1PJJ A;  1Q02 A;  4LF7 M;  2ZAN A;  2R0I A;  4NOO B;  1TDZ A;  1IN6 A;  2XFT A;  3U60 B;  2W82 A;  4RNA A;  1EFU B;  3MMP A;  4LF4 M;  3FE3 A;  3I4Y A;  3QAU A;  1JR3 E;  4BBA A;  4JI2 M;  1L1Z A;  1K82 A;  3AV0 A;  1TH3 A;  1AUA A;  2DZN B;  2LBC A;  2LH0 A;  2BJV A;  2X8A A;  1XMO M;  4JI5 M;  3VFD A;  1NSF A;  2L7I A;  5ITU A;  2CUZ A;  1P3Q Q;  3GQ4 A;  2DXI A;  3GRV A;  1T3T A;  4R71 A;  1L2C A;  2ZTC A;  5EP4 A;  2JZ1 A;  4NSO B;  2CWB A;  1Q3C A;  4M9S A;  1WHC A;  2AHM A;  1WR1 B;  4I8O A;  4WUR A;  3TE6 A;  4YHH M;  3C58 A;  2QBY A;  1J7K A;  3LCV B;  2LTU A;  4QHT A;  1XMQ M;  3GRU A;  4KT0 F;  3HHW A;  4IBE A;  4FWD A;  1FNN A;  1QYR A;  3QWL A;  1QZE A;  4IBB A;  2UXB M;  1I94 M;  2JY6 B;  3R8F A;  2DAE A;  3SMS A;  2XZF A;  2HL7 A;  4RKU F;  5FTN A;  3AKZ A;  1J5E M;  2CV2 A;  1T43 A;  3Q8X A;  3HZJ A;  1PGY A;  2R62 A;  3VK8 A;  3AFH A;  3JR5 A;  2VII A;  4HLQ A;  1G41 A;  2QEN A;  2KW0 A;  4L4U A;  4B3S M;  2RKO A;  4KLN A;  4LF9 M;  1BVS A;  4CIS A;  3AOG A;  1HR0 M;  5C1B A;  2XLJ A;  4AW4 A;  4LGM A;  2YFQ A;  2MJ5 B;  3L26 A;  2N35 A;  2LHG A;  3KP0 E;  4NL4 H;  4MGI E;  1IN8 A;  2XF3 A;  1X37 A;  4LF6 M;  2OOA A;  1DV0 A;  2KHH A;  1C7Y A;  3L25 A;  4RF1 A;  2UUB M;  1OQY A;  3U6S A;  1E9S A;  1DGB A;  2CHV A;  1VDL A;  2KRU A;  1VG5 A;  4JI7 M;  2DZO B;  1HT1 E;  3B7N A;  1SXJ C;  4ZPX A;  2UXD M;  1JR3 D;  1YLA A;  1IQP A;  1UM8 A;  2R65 A;  3E46 A;  3HJQ A;  4DUZ M;  3PNY A;  2UU9 M;  3GLF B;  1GO5 A;  2D7E A;  4Z8X A;  2JWS A;  1HQC A;  3FUV A;  1QDR A;  1WIV A;  2OOB A;  1MX0 A;  2RRU A;  3RGS A;  2RGO A;  3TPZ A;  4MGH A;  1SXJ B;  1QZM A;  3GLH B;  3RGP A;  4QOZ C;  3DFZ A;  3KS8 A;  1WXQ A;  3IHP A;  3SAU A;  3L29 A;  3J7B A;  2QZ4 A;  3SAS A;  1WGL A;  2LWX A;  3GPY A;  1IY2 A;  4HL4 A;  1W5T A;  4D80 A;  2HAK A;  1IXS B;  3FTC A;  2MGW A;  2DHY A;  4DV0 M;  4B3T M;  1VEG A;  1NHG C;  3UMM A;  2V1C A;  2JY7 A;  4JV5 M;  4WW0 A;  1GL6 A;  4QNR A;  2XZU A;  3FKE A;  2DHR A;  1N75 A;  3E9S A;  4GKK M;  2JY8 A;  4X62 M;  1DGH A;  3U6M A;  3V76 A;  4KHP M;  3GLI E;  1PJI A;  3NBI A;  4DV7 M;  1XXH A;  3SYK A;  1R5L A;  3GPU A;  1XHB A;  3PXG A;  2DWZ B;  2F5S A;  2DAM A;  3B7Q A;  4OW0 A;  2ZAO A;  1NO1 A;  2H1R A;  2GNO A;  3ZQJ A;  3BXW A;  3GLI B;  4QNM A;  3SAV A;  4A3V B;  1R2Y A;  4DR7 M;  3U61 A;  3BOS A;  2CFO A;  3W0F A;  1EIJ A;  4CIZ A;  2D7H A;  1IBL M;  2QQ8 A;  1LV7 A;  2FS1 A;  4NXM M;  4L78 A;  3UGJ A;  3SAR A;  5BPV A;  1DGF A;  2DEN A;  4PDG A;  3M0E A;  2CE7 A;  3HGI A;  2OO9 A;  3SHF A;  4DV4 M;  2DWL A;  1KYI A;  1GJT A;  3RE8 A;  1DO2 A;  4G3O A;  3GLG E;  2C96 A;  1R4G A;  5ITR A;  4NC6 A;  2X49 A;  3A42 A;  2BWB A;  1N77 A;  2V1U A;  1IFY A;  3DOA A;  1SXJ D;  3B9P A;  3GO8 A;  3T38 A;  4Z6Y A;  2L6O A;  2J7O A;  4DR5 M;  4B7G A;  2OQ4 A;  4G4R A;  2Z7J A;  4MGZ E;  4DV1 M;  1L2B A;  1N33 M;  2FOI C;  2LVO C;  3CGW A;  4JI8 M;  2F5O A;  2DNA A;  3KSJ A;  4S12 A;  5FLX S;  2H5X A;  3A46 A;  2C5R A;  4FVM A;  3FD9 A;  1VEJ A;  1G8P A;  4DR4 M;  3NBX X;  4L15 A;  3UK6 A;  4OX9 M;  1XWI A;  5IWA M;  1GL7 A;  2VDB B;  3FRI A;  3HWS A;  2KZS A;  4G6Z A;  3W0L B;  4LFC M;  4HEO A;  1ZV1 A;  3LW5 F;  3W67 A;  5E26 A;  1R6B X;  3IEC A;  3GLI A;  2CV0 A;  1HNX M;  1G4A E;  1IBM M;  2JXN A;  3KOY E;  3KFU G;  1GKI A;  2G3Q A;  3H4M A;  1NY5 A;  4AG6 A;  3GRR A;  2JA2 A;  2RGH A;  2JY5 A;  3C3E A;  4G4N A;  4JI3 M;  1NJF A;  3FYC A;  4JI4 M;  1D2N A;  1SG9 A;  4GIT A;  3CF0 A;  2ZM6 M;  3FUU A;  3FUT A;  4M0W A;  3THG A;  1HNZ M;  3SFZ A;  4DR6 M;  2CRU A;  4M9Z A;  2J5Y A;  3U5Z B;  2I7N A;  3U6D A;  2OPF A;  2JP7 A;  5EXT A;  2R4J A;  1JB0 F;  2KRK A;  2MRO B;  5DFL A;  1QUT A;  4MM3 B;  3GLG A;  1GAB A;  3PVS A;  2LNH C;  2Y21 A;  4AG5 A;  4I5S A;  4LJ4 A;  4F2L A;  1G3I A;  2QPA A;  1IN7 A;  2CHG A;  3J2P B;  4WP2 A;  4Y28 F;  5ITX A;  1VDD A;  1PJQ A;  2L7H A;  2VQE M;  1PM5 A;  3EIE A;  4R3D A;  1QAM A;  1WGN A;  3U60 A;  5EXP A;  1E94 E;  2Q2E B;  3MHV C;  4QHS A;  5EJC A;  3TQS A;  1TTE A;  1TH4 A;  3B74 A;  3OTO M;  2BNK A;  3FUW A;  3D8B A;  1OIZ A;  3KOZ E;  2K0B X;  1Z5C A;  2HKJ A;  3LVW A;  1LTM A;  3HKP A;  4DUY M;  4NRV A;  5ITT A;  2YQZ A;  1I4W A;  4B7H A;  4K0K M;  1JR3 A;  1QAO A;  2O01 F;  4YY3 M;  1K3X A;  3GLF E;  5FSW A;  2K6B A;  2LXE A;  5EXX A;  8CAT A;  1NNJ A;  4EIW A;  2LVN C;  3SAT A;  4LJA A;  1YE9 A;  2R44 A;  3L28 A;  4JXJ A;  4IBD A;  1SXJ E;  3KVW A;  3GLH E;  1XNQ M;  4MGY E;  3J80 S;  3SAW A;  3U5Z A;  1HQY E;  2LVQ D;  4LFB M;  2C9O A;  2DWM A;  4NSR A;  3GQ3 A;  1FJG M;  3Q8G A;  4GKJ M;  4JI6 M;  1OAO C;  2G5G X;  2DZL A;  4TUW A;  5EQT A;  1R2Z A;  3K92 A;  2APL A;  5L8R F;  1OAI A;  2B3T A;  1ORY B;  1Z59 A;  1EE8 A;  3K9P A;  1Y8G A;  1OFH A;  1MJG M;  3AOE C;  3HJS A;  1GVN A;  2FNA A;  2C9C A;  3WHK A;  3L27 A;  4NXN M;  3J81 S;  2K47 A;  3PFI A;  3TWL A;  4GEW A;  7CAT A;  4ITQ A;  3AL0 C;  2ERC A;  2F5N A;  3HHX A;  5KPZ A;  4LJ8 A;  4D81 A;  4X64 M;  4RF0 A;  1IN4 A;  4LJ6 A;  3HHY A;  3VKH A;  5DNY A;  3I4V A;  5LMU M;  1E32 A;  5FTM A;  1XB2 B;  3FYD A;  2KNA A;  3T6P A;  3GRY A;  3SBJ A;  2XFS A;  3U6Q A;  1QQW A;  4OVZ B;  4LCB A;  3BBZ A;  3ILK A;  3TL4 X;  4MB7 A;  2FH0 A;  2CEA A;  3E4R A;  4JN6 A;  2G8L A;  3LQQ A;  5F3W A;  5KO3 A;  2XSZ A;  4GRI A;  2QCU A;  3GLF A;  2QHO B;  3D8L A;  3QYE A;  4IJE A;  5H37 D;  1ZMU A;  2FE8 A;  4LRS A;  2XSZ D;  1L2D A;  2WZJ A;  2QNJ A;  5EXS A;  3FTE A;  1SXJ A;  3K8Z A;  1CUK A;  3GLH A;  3HX3 A;  4UN2 B;  1S3S A;  1QAQ A;  1K3W A;  3FTF A;  2WSC F;  3K1J A;  4B7F A;  1QDT A;  4W5W A;  4XBO A;  4LY6 A;  5FTK A;  3A45 A;  4JI0 M;  4DBG B;  1IXS A;  2Y20 A;  2DVW B;  2O25 A;  4FW9 A;  1Q39 A;  1TR8 A;  4BLC A;  1TDH A;  2NQ8 C;  3M7G A;  3GP1 A;  3A98 B;  2Y0T A;  4LZJ A;  4BB9 A;  1IY1 A;  1KFV A;  2WSE F;  1NV8 A;  1MU5 A;  3M6A A;  1V34 A;  3VDU A;  2KNZ A;  1J09 A;  5KPR A;  4GHA A;  2QBY B;  2CP8 A;  2DAG A;  3RFW A;  1D0K A;  2GQF A;  4OU7 A;  2DKL A;  2R6F A;  3EIH A;  2MH8 A;  4OVZ A;  4AKG A;  2JNH A;  3L2A A;  2UUA M;  3H4J A;  4P17 A;  5EP1 A;  2P5T A;  1NJG A;  3U6O A;  1N32 M;  5E6J A;  5DYG A;  3SYL A;  2WSF F;  4R7G A;  1TH2 A;  3KP1 E;  4AZF A;  4B08 A;  4CJ6 A;  2EA0 A;  3UJN A;  4DV2 M;  4JI1 M;  2O5R A;  5KQD A;  2MR9 A;  1UFZ A;  2Y0Q A;  1VEK A;  2YR0 A;  4REZ A;  4I4L A;  4AQY M;  1YSY A;  2K9D A;  1OJL A;  3GQ5 A;  4GH9 A;  1PJS A;  4DR2 M;  4LF8 M;  2YNM D;  4GHL A;  2DI0 A;  2Z8Y M;  3IG8 A;  2QP9 X;  3KDS E;  1Z6T A;  2M5Z A;  1W5S A;  1IY0 A;  2L4E A;  5FTL A;  3ZC7 B;  3LVV A;  1PJT A;  2KZU A;  4FWH A;  3KXE C;  5ITQ A;  1JQJ C;  3HY5 A;  4FCT A;  2VQF M;  2DAI A;  1WJ7 A;  4IBC A;  1R7R A;  5EP3 A;  4D82 A;  1V33 A;  3C9P A;  4II7 A;  2VF7 A;  3GPP A;  4B3M M;  1MN3 A;  4MH0 E;  1NHW C;  1C1K A;  2CV1 A;  1VQ1 A;  5JI3 E;  3K2L A;  2L09 A;  3B7Z A;  2KXE A;  3J27 B;  1XC8 A;  5IT9 S;  3DZD A;  2VF8 A;  3GPX A;  1ZMW A;  4LFA M;  3VKG A;  1NY6 A;  2XGN A;  3CF6 E;  4P16 A;  5LMN M;  1T6O A;  2HCB A;  3ZH9 B;  4G4Q A;  2D7G A;  3U6L A;  1AIP C;  4B3R M;  1ZAE A;  3SC3 A;  3TWK A;  1KSF X;  3U6E A;  2KNV A;  2F4V M;  2EUC A;  4CHT B;  1IBK M;  4LRT A;  2LVA A;  5A2Q S;  1NV9 A;  2R4E A;  4I81 A;  5IZ7 D;  4XGI A;  1PRB A;  4FD2 A;  1A5T A;  4L8R C;  4DV6 M;  4F1I A;  1IXR C;  2LHC A;  4ANR A;  2Z4S A;  1ZMV A;  3E21 A;  4FCW A;  1IN5 A;  4IBF A;  4LZZ A;  1L1T A;  1YUB A;  2C98 A;  3FTD A;  3IG5 A;  3KS4 A;  2JZ0 A;  3WHL A;  2DAK A;  4IBI A;  4Q7J A;  3T15 A;  3J7A S;  3HU2 A;  3HU1 A;  3TWM A;  1TGU A;  3NWL A;  2QSF X;  5JI2 E;  3UZU A;  1XXH E;  3LMM A;  4GIP A;  4NRW A;  4X65 M;  4FWG A;  5BR8 M;  4LF5 M;  1HJP A;  1QUS A;  3LQR A;  1DGH B;  2ZBK B;  1RU3 A;  1Z5B A;  4IBJ A;  4LJ9 A;  5FTJ A;  3SMP A;  3ZCB B;  4PDI A;  1TF0 B;  3FRH A;  4IJF A;  2EKF A;  1D0L A;  1XXH B;  1OTR A;  3K9O A;  3I01 M;  4FCV A;  1G71 A;  1E9R A;  1G59 A;  2BWE A;  2Z4R A;  1H6U A;  4IBK A;  4DR1 M;  4GC9 A;  1QAN A;  3F92 A;  1IXZ A;  3HJ8 A;  1HT2 E;  2KEB A;  5IRE B;  5ITY A;  4KOD A;  3U61 B;  1GLN A;  2BJW A;  2KDL A;  4PT5 A;  3T1H M;  4CGY B;  2A5Y B;  4M9X A;  1N36 M;  3CTW B;  5GKN A;  4GMQ A;  3AJI B;  5KQ8 A;  4MGK E;  1OIP A;  1N78 A;  3I04 M;  4AKI A;  2V6Z M;  3HHZ A;  4IBG A;  3MK6 A;  4LGY A;  4PCZ A;  4JYA M;  1F4I A;  2M60 A;  2JUJ A;  2Z3X A;  1DO0 A;  2L4F A;  3T1Y M;  4L16 A;  4PD2 A;  3KSX A;  4DV3 M;  1IM2 A;  2FFJ A;  4IIW A;  4AKH A;  2J7N A;  3VK7 A;  3B89 A;  1L8Q A;  3KOW E;  3U6C A;  2I7P A;  5EP2 A;  2R45 A;  4LG2 A;  2ZTD A;  4QOS A;  2F5P A;  2X4A A;  1XNR M;  1OFI A;  2E5L M;  4LJ7 A;  2XH9 A;  1D0M A;  3LCU A;  3KOX E;  4M0D A;  3W68 A;  2LVP C;  1NVM A;  3KW6 A;  2C99 A;  4X66 M;  4DR3 M;  4XK8 F;  3U6P A;  1GJS A;  5DYI A;  2ZAM A;  1NNU C;  3HU3 A;  2UUC M;  3C3D A;  3JR4 A;  4KO8 A;  3AOE A;  3PNV A;  2EKK A;  2HHH M;  3I51 A;  4L6V 6;  5KPT A;  4AI6 A;  1ZQ9 A;  3VDP A;  3VLF B;  2HWJ A;  2XEP A;  5C18 A;  3JAM S;  3SHG B;  1OKS A;  1HNW M;  2R46 A;  3DA1 A;  2R18 A;  3FUX A;  2CHQ A;  2UXC M;  1V92 A;  5ITX E;  2EJS A;  1Z5A A;  3MJ5 A;  3GLG B;  1QVR A;  1Q3B A;  2DWN A;  4DV5 M;  2L2D A;  4G4O A;  2F5Q A;  4LJ5 A;  2EO2 A;  3QYB A;  1N34 M;  1DGG A;  3R9X B;  3CF2 A;  2KA6 B; 
#chains in the Genus database with same CATH homology
 1AIP C;  1OAI A;  1Q02 A;  2B3T A;  2R0I A;  3K9P A;  1Y8G A;  2KNV A;  2LVA A;  1NV9 A;  2DEN A;  1EFU B;  1A5T A;  3MMP A;  4GEW A;  4F1I A;  3FE3 A;  1JR3 E;  1ZMV A;  2OO9 A;  3E21 A;  1GO5 A;  1KYI A;  2LBC A;  1DO2 A;  2JZ0 A;  4G3O A;  3GLG E;  2DAK A;  4Q7J A;  1R4G A;  2BWB A;  1P3Q Q;  1IFY A;  1XB2 B;  2QSF X;  2ZTC A;  1XXH E;  2JZ1 A;  4R71 A;  2KNA A;  3T6P A;  2CWB A;  5JI2 E;  1WHC A;  1HJP A;  1WR1 B;  3BBZ A;  2LVO C;  3FRH A;  2LTU A;  2EKF A;  3LCV B;  2DNA A;  1OTR A;  3K9O A;  2H5X A;  2BWE A;  1VEJ A;  1QZE A;  2JY6 B;  3F92 A;  2DAE A;  1HT2 E;  2QHO B;  3FRI A;  1T43 A;  1ZMU A;  4HEO A;  2WZJ A;  1PGY A;  1ZV1 A;  2QNJ A;  3IEC A;  1G41 A;  1CUK A;  1G4A E;  1BVS A;  4UN2 B;  2G3Q A;  4DBG B;  2JY5 A;  2MJ5 B;  1IXS A;  1SG9 A;  2O25 A;  1TR8 A;  1F4I A;  2JUJ A;  1DO0 A;  2OOA A;  2L4F A;  1DV0 A;  2KHH A;  1C7Y A;  1OQY A;  1IM2 A;  2JP7 A;  1NV8 A;  2KNZ A;  2MRO B;  1VDL A;  5DFL A;  3B89 A;  2CP8 A;  2DAG A;  1VG5 A;  1HT1 E;  2DKL A;  2ZTD A;  2JNH A;  1YLA A;  3H4J A;  3E46 A;  4F2L A;  1G3I A;  4WP2 A;  3LCU A;  2LVP C;  1WIV A;  2OOB A;  2RRU A;  1WGN A;  2MR9 A;  1E94 E;  1UFZ A;  1VEK A;  1TTE A;  2K9D A;  3IHP A;  2K0B X;  1WGL A;  2DI0 A;  2HAK A;  2MGW A;  2DHY A;  2EKK A;  2L4E A;  1VEG A;  2JY7 A;  3GLF E;  2DAI A;  1WJ7 A;  2HWJ A;  1MN3 A;  1OKS A;  2LVN C;  2JY8 A;  1VQ1 A;  3GLI E;  1V92 A;  3GLH E;  1HQY E;  2EJS A;  2LVQ D;  1ZMW A;  2L2D A;  2DAM A;  1T6O A;  2DZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...