2LVWA

Solution nmr studies of the dimeric regulatory subunit ilvn of the e.coli acetohydroxyacid synthase i (ahas i)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
98
structure length
98
Chain Sequence
GSMQNTTHDNVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLVNDDQRLEQMISQIDKLEDVVKVQRNQSDPTMFNKIAVFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The coil-to-helix transition in IlvN regulates the allosteric control of Escherichia coli acetohydroxyacid synthase I
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Acetolactate synthase isozyme 1 small subunit
total genus 18
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature ec 2.2.1.6: Acetolactate synthase.
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lvwA00
4LUBA 2P9GA 1ZPVA 2P9EA 1YGYA 1Y7PA 2JOQA 3ENVA 3DDNA 5JJBA 4GMKA 3OFHA 2RE1A 3DHXA 4PWUA 3TUIC 3CEDA 1RWUA 4M8LA 2P9CA 3S1TA 2JHEA 2QSWA 3L7OA 2J0WA 2MDAA 2PC6A 1UJ5A 3AAWB 3OFEA 1LK7A 1SC6A 2I9SA 1XTZA 2QMWA 3K5PA 4GO7X 3ENQA 3IBWA 1KS2A 3OBIA 1YBAA 4X84A 1UJ4A 3MWBA 3TUZC 1UJ6A 2RQMA 3UW1A 1U8SA 3AB2B 3LOUA 2RQKA 1PSDA 2CDQA 1LK5A 3W7BA 3O1LA 4IO1A 3ENWA 3TUJC 2LQJA 2H9ZA 3HHEA 2J0XA 3P96A 1M0SA 2DT9A 2PA3A 3MTJA 2DTJA 3OFFA 3KWMA 3N0VA 4NMLA 3DC2A 2F8MA 2QMXA 2NYIA 5IT0A 5IT4A 3MAHA 5T41A 3IXQA 1O8BA 4GO5X 1LKZA 2FGCA 3U7JA 5FIIA 3NRBA 2KO1A 2QRRA 3LUYA 5IS2A 2F1FA 3DHWC 2ZHOA 2LVWA 3AB4B 3OFGA
chains in the Genus database with same CATH superfamily
2ZZTA 1YJ9S 1BQNB 3FKBA 1XBWA 3GG0A 4EZ6A 1PJ6A 3HZGA 4MIBA 4OZ0A 4UTGA 2CYYA 5A8KA 4DV1J 2FLNA 1Z2ZA 2QFIA 1OO0B 1YZ6A 1GK8A 2H4WB 2D41A 2YNIA 4KFBB 5HMYA 2OIHA 5HATA 5E7OB 4F3MA 4DR6J 4UQGA 1MWZA 4HTIA 3NMRA 2HRYA 3ENVA 2DNQA 3AT1B 4AXJA 1U1LA 4AUKA 4C48A 1DRZA 4DV7J 2R7OA 3NGRA 2J7UA 4TLRA 3RB6A 2WB1D 4GKKF 2NXJA 5GAHI 3JXOA 5CXTA 4PUOA 3M8QA 4ICLA 4KGVB 4CT8A 1XEZA 2LA4A 2P9CA 3GPAA 3ZXWA 3CDAA 4KBIA 4N8NA 1TKZB 5GAHU 1IWAA 1WEXA 3KJQB 2ZH5A 5ETRA 1PIEA 4FVMA 3QLHB 4FYDA 1IR0A 1K0VA 1MMDA 3CD6S 2ZHBA 2EG1A 3ZZRA 2C42A 4B3OB 3DDKA 1S76D 2V5HG 3SSRA 2C3OA 5M2PA 3M2UB 3VAFA 1PBAA 2BMBA 4OV1A 4RR5A 2AEJA 2NYHA 3SDEB 3HVTA 2NZCA 3BS9A 1JLQA 4ANEA 4RUHA 1SH0A 1HQ2A 4LSLA 3G87A 2LQBA 5AXKA 1PC5A 5FLXY 2GIFA 5C2GA 1HPZB 3BYRA 2F4FA 2RQCA 3I0RA 2Y9HA 3IBWA 1RQ0A 5EWEA 4K2XA 1FDBA 4PQUA 3N5BA 2KB2A 2CVEA 2OHDA 3QBCA 1DBDA 3OHAA 1R0AB 2LMIA 2QE5A 1I3OB 2VF3A 3QJPA 1VGYA 1TAUA 2CG8A 2GFFA 1NLKL 3J81U 1T0TV 4R25A 2J6SA 2CJBA 2MKIA 1S9EB 2AGQA 2HNYA 1PYTA 1U8SA 3MGJA 2VC0A 3M6XA 4LRFA 2JJ4D 3PEHA 4NL5A 3GJSB 3LOUA 1JB0C 1AZSB 3HKZD 3DLGA 3WDOA 4GVBB 1DQ8A 2W9AA 2BE2A 4ZP8A 4P6QA 4B3MJ 1RADB 4MMOA 2MQPA 5EHHA 2VBXA 3H5XA 5KFKA 9ATCB 2VJUA 1ZZNA 3DRYA 2GVZA 2UU9J 4P10A 4TN2A 5D4LA 1WOSA 1FX4A 4I56A 3BGUA 4HH0A 1QSLA 3AD7C 2ZE2B 3PTWA 5I3UA 2MY8A 4NLTA 3UNGC 3OL7A 1YJWS 2CJ9A 2AX0A 3T19A 4E98A 3EJMA 1LQ9A 4CLWA 1JXVA 4TXSA 3MM9B 1VR6A 3ZZTA 3UI3A 1SJRA 2CJKA 2ADBA 4JV1A 3CCVS 4DR5J 3RG6A 1KP6A 2MZTA 4O44B 4E2FB 3PO4A 4YUDA 1ZA1B 3CDEA 2B4PA 3PX0A 4QIGA 3CC7S 2QL7B 1N56A 3C6UA 3OV7A 1YHQS 2VUGA 3MTKA 2R8HA 2MB0B 2C2RA 3PW0A 3MM9A 2QA4S 2KH9A 2AT1B 5CYJA 3KUEA 4DPTA 4CCHA 1B3TA 2GVZB 5KG3A 3TNVA 2A1BA 4FF3A 2ZD1B 2HMIB 4JI7F 4RU9A 5A6PA 2FY8A 3M6UA 3KDOA 3QAUA 4TLQA 3I5BA 3QWPA 2HQFA 4ZVUB 1K44A 4QCLA 3J7YI 1U1KA 3G71S 4H4KC 2E5LJ 3EGZA 3MPDA 4DV2J 2HLUA 2ROPA 1HNZJ 5KFGA 4KHPF 2CQCA 1RAHB 1UWAA 5KFRA 3T9NA 2A2CA 1OWXA 1HI1A 5T7LA 1M5PC 4O3PA 1RWVB 2KI2A 2RU9A 5E3PA 1SQEA 4KKOA 4X4QA 1G2EA 1VLOA 4AFFA 2VG6A 4NCGA 3D2WA 4JI1F 4OZ2A 2GIRA 3RB4A 2ZUGA 1TK8A 4B3OA 1QSSA 2X1FA 2OMLA 1Y7PA 4RNNA 1D1UA 1AXQA 3O6QA 3A3NB 2J6UA 4PZVA 4F4ZA 5B0GA 3CT9A 2D3OR 1FKPB 3WQPA 1CJVA 1VBKA 3J80U 3CMES 1JLQB 3K8VA 4TU9A 4QYRA 4RW9B 4PXCA 2Q66A 2EC2A 3J80Y 4WYLA 3I32A 1OPZA 3UDEA 2B6AA 4NLDA 1SKWA 2HVHA 3FK4A 4DL0C 4QIFA 2ZBCA 2DGTA 4DZ6A 1S6PA 3HULA 3CXCR 3G6ES 3LH2S 1EIYB 2KVIA 1S1WB 5BR8F 2OPRA 4LFBF 2HHTA 2V8HA 2GNKA 2PA8D 3G9CA 3JS9A 1RP5A 2I9SA 2PN6A 4RWWA 2B4VA 3MMCB 4U8VA 2UUTA 2KYXA 2RF2B 5J2MB 1GXTA 4U7UK 2MGZB 2MJUA 3MEGB 4D3HA 4NA1A 3OW2R 3CC4S 2Z2YB 1RBAA 3FC9A 2IM1A 4TVAB 2GVDA 1BMQB 2FPHX 1R6YA 1P6TA 3RAQA 2AEFA 2HQ3A 2XLIA 2LECA 3RR7A 1NBEB 4YS2A 3N6LA 2R2SA 3RZAA 4MFBA 1VIOA 4O4GA 2R7XA 4NLYA 2Z2LA 5D4OA 1EQMA 3AJDA 4UT4A 3DYAB 4F2SA 4I4BA 1H2UX 5H9FK 3ILJA 7FD1A 4WE1A 3IAS9 1X4HA 5J2NA 4JYAJ 2MSSA 1RAOA 2YNGB 5DGAA 1BQNA 2H48B 3DU6A 3OTOF 1TR0A 1QSYA 4WF9Q 1WKKA 5HO4A 1VC0A 3Q89A 1R31A 4ZIWA 3T1AA 1HIYA 4QZVB 3ADAC 5ETMA 5A2QU 1L3UA 1CQNA 5KFDA 1TL3A 1XC9A 4LT6A 4IO1A 3TQ1A 1VFJA 3D5MA 2LCWA 4NLWA 1U0HA 4U7UD 1LWXA 2WVDA 3WHIA 3W9JA 3B82A 1VQLS 4HT5A 1TK5A 1HNZF 2XCPA 1Q5YA 2K06A 4IDKA 1B70B 5DLGA 2VD3A 4YB5A 4NA2A 3D1HA 2DT9A 2OP5A 1XR7A 3QIDA 3P49B 2JL9A 2GAHC 3LGHA 1R89A 4LRDA 1XNQJ 3QJLA 1NDLA 3R3TA 4ZLPA 4EZ9A 4UY85 4Y34A 1IQTA 1U6BA 2PD1A 5CABA 4J9LA 4B3TJ 1X7VA 3H7HB 4NXNJ 4DR3F 2XO6A 1FXDA 4DV5J 4DPWA 2G2YA 3CJKA 4U9RA 3B4MA 3BKUA 4YN3B 4ZVOB 4DFMA 2XI2A 4KGMA 1P1LA 3VVTA 4C11B 4DV0J 2WW4A 4F25A 1B7YB 4NRUA 1RWXB 2JRSA 3AY0A 2HEKA 1QM9A 4BC7A 4RPFA 2QT7A 4ED5A 5AT1B 3IP0A 2ROEA 3W61A 5IS2A 3BGRA 1EKSA 4DCJB 1HWJA 3FZ2A 3PACA 1N33F 1U6FA 2ZHOA 1S1VB 1HLWA 4E8UA 1XERA 1B4SA 4ETXA 1LXJA 1BWEA 4CP5A 4IG0B 2Y0BB 3HM9A 2W8KA 1OS5A 1X8DA 3KG1A 4JUZA 5J1EB 3I9V9 4DL3A 2R7UA 1NHKL 3WIVA 1HWUA 2I8EA 2P9EA 3D0GE 4BC9A 4GVBA 2J8AA 2BRLA 2ZBIA 3DDNA 1WELA 5ETLA 3UNYA 1D8YA 3Q2TC 5F3ZA 2IIHA 1TKZA 4OX9F 2R2TA 1S4FA 2OEMA 3LP1A 3CCUS 2Z2MA 1FEHA 2W4CA 2B43A 4FS1A 1FFGB 4M8LA 4ZPBA 5E3RA 3KLGB 3D3BJ 2MZ1A 2DVIA 1UVKA 3ICLA 1CJTB 4HHJA 4CRJA 5HJYA 2JLGA 2QL9B 4RX6A 4ZPAA 3GIRA 3K2YA 5KFIA 3PYEA 4OLOA 2W9CB 2OEKA 2QV6A 2ZJQQ 4OI0A 2AW0A 3BV8A 4WU2A 3VQSA 2PC6A 3MM7A 2HQCA 4RW4B 3NCRA 1CC7A 2V2ZA 3AAWB 1RT2A 1YJRA 1AFJA 2AGPA 4HLBA 3UR3C 3Q22A 3CULA 1NH8A 2BKNA 2WCXA 3THVA 4J9RA 1R0AA 2CZ9A 1Y5LB 4ED1A 3OTOJ 3EXYA 3ZC4A 4PKDB 3LP0A 4K5SA 4MK7A 1XMOF 3OL8A 2H5JB 2BZ2A 4USVA 4ZK7M 1OQ6A 4Q7AA 5LJ3Y 4P2SA 2OD6A 3PHTA 3M8SA 1HNIA 3DYAA 5KFFA 2HFZA 2H5IB 2HHPA 5IZHA 5HP1B 2LQ9A 3MM5B 4DQRA 3NP5A 4DF4A 1UJ4A 1HBUB 1N48A 1UFLA 3TAPA 3BR9A 3BGLA 3GIMA 1GEHA 4Y2IA 3GV7B 1RACB 5IC6B 2YWHA 2J6TA 4DQIA 2LP4A 3DOMA 3KK2A 3MEEB 4F4XA 2HURA 2C2OB 2YX4A 3RW6A 2XLKA 4LBHA 1S57A 1HWIA 2DNKA 3BQ1A 3JAMU 3G4SS 1TL7B 2DPJA 4DL7A 1F9FA 4LVOP 2M4MA 2KFYA 4F3OA 3BPSP 1ZTWA 1NK5A 3HFVA 2PGCA 3EDRB 3D0HE 5SZTA 4LF9J 2WOMA 2OFHX 3GU0A 3FFIA 1BD6A 1SJ3P 2JH3A 1UEUA 1H6KX 5M2RA 5C25A 5KFAA 1FJGF 3F56A 1FKPA 3M6WA 2Y3YA 3P8BB 5E3CA 3RYLA 3TA1A 1RJJA 3MMBA 4EUVA 5RUBA 4XO0A 1D3WA 3W9HA 4AL7A 2R8KA 3OTEA 2W2OP 4I68A 4X4RA 1NDPA 4DPUA 2FLLA 4C0HA 2UV8A 2VA3A 2AF6A 1PCAA 3HLUA 4HT7A 2VPWB 4JI4J 4X4VA 2IM0A 2DTJA 3Q2SC 4NCGB 5E0OA 2GX8A 3MMAB 4K4UA 4NLVA 2HIQA 3GCWP 4FDFA 2MLZA 5CZXA 4CH0S 3FDSA 1KONA 6AT1B 3PRVA 3OSPA 1WDDA 3OUYB 1QVGR 2QMXA 4CNZA 2XY5A 2AIRB 1NZ8A 2KRBA 2M0GB 1TU0B 4XPEA 3PZPA 2EPIA 4X62F 3CCLS 1A6LA 4EYHB 1KLMB 4K0KJ 2V2KA 3S01A 4K4ZA 3KLVA 2MQ8A 2WBRA 3H2VE 1FTCA 2PIIA 2WK4A 1AA1B 2QLFB 1KWMA 2L9DA 3TVYA 1RAIB 1LWFB 3W63A 4FS2A 2WRMA 1NJWA 4LMZA 1CLFA 2MMYA 3DLKB 3NCPA 3PYDA 5HANA 5GADU 3THPA 1H7XA 4DFPA 2FY1A 3PM9A 3Q0AA 4WP9A 1SI9A 3MR5A 4NLOA 2JX2A 4YP3A 1VHFA 3OR2A 1SIWB 4O23A 2W8LA 2XULA 1UPPA 2P9GA 3DXBA 2B8QA 3ILIA 3N5FA 4FNIA 2DHAA 4P7VA 1VQPS 4KGKA 2QA2A 2VQFF 2FJBB 1TUGB 4IG3B 3CE8A 3MPWA 4L6V3 1T3NA 1J5EF 1S12A 1Q95G 1TL1A 3PNIA 2AGOA 3HFKA 1RE1B 4F4AA 1TV6B 2CNKB 4IOAQ 2E7VA 3OPKA 2UUCJ 2CPYA 2LXIA 4M5KA 3VF0B 3P3DA 3D68A 2NPIA 2NR0A 2E66A 2XZWA 3AOBA 4ZP6A 3M9MB 1LEOA 1RWUA 2MYFA 4J90A 4EYIB 4RW7B 2DEJA 4ZS6A 3DOLB 3HDSA 3B6BA 2HLTA 4DX6A 3HCXA 1GXLA 1PJ5A 4DU8A 2IMWP 1YBUA 4DEZA 1U47A 3WC2A 4L75A 4W92B 3FNNA 2CPDA 2XTJP 5T14A 2DB1A 2GV1A 2J0WA 3CJ4A 2XS2A 2YH1A 2UXDJ 3HJFA 3ZZUA 4TNOA 4ZKAA 2MLXA 4QU6A 3SCJE 2XMUA 1MLAA 3DLEB 3OFEA 3TVZA 2UXDF 3I5CA 2YVSA 2FHMA 3QT5A 4ZJOA 3RGIA 2O3DA 1VQKS 2XBPA 2N7CA 2RU3A 1RTHA 5B0DA 1DTQA 4WZQA 2YX1A 3OL9A 3I82A 3TO8A 2W2MP 1KKHA 5H9EJ 4BLGA 1SB6A 2K1RA 4Y2AA 2CNOB 3R1LA 3QQCD 1N6QB 1S1TA 3DM2A 4ELVA 2RRBA 1PAUB 4X64F 4ALZA 1D9FA 2OTJS 2D9PA 2EW9A 3EM1A 2ZE2A 1N34J 3ZNUA 1T03B 3QSIA 1NSAA 1D9AA 2I2YA 4PG4A 3C46A 1XQIA 3HJVA 3TRGA 1YI2S 2W25A 3KMQA 5A8RA 4AXIA 1WKJA 2YWFA 2UVUA 4J9VA 5IM0A 3FEZA 1VK3A 2RQKA 5EDWA 2B7CB 2BM1A 3OTDA 1LK5A 2V4JB 4IO9Q 1FKOA 5DJBA 3H4BA 1N32J 4F3QA 2FJVA 1HYSB 5IQ6A 2W9BA 2HNYB 5KG2A 2R9LA 2GAGC 2AJ0A 2LLZA 3AH6A 4KGZB 3ZTRA 2R7RA 2SXLA 4M5IA 5IC4B 3PXGa 4ENOA 5EGYA 1XJWB 2C22A 1NB7A 3LWLA 2Z2ZA 4CM2A 2DO0A 3MMAA 1M0SA 2CZ4A 2RSQA 2CFXA 1RHRB 3I4HX 4X66J 4B3SJ 2D69A 2VBYA 4JP8A 5KAKA 3NL0A 3MTJA 1NB2A 2C2KB 1FVSA 3H2UB 3W2WA 4LRBA 2GHWA 1TL3B 2J9EA 3AJ2A 3GMGA 4NWBA 2PMWA 2RHSB 1QTNB 2Q79A 3K5OA 2I5JA 4P9SA 5LMNF 2AKWB 2J9DA 2XNQA 3BR8A 4XDCA 5I42B 3LPYA 1RHKB 1B99A 1R8PA 1Y10A 3IC1A 3FCWA 2N82B 4ELTA 2PI4A 4LF6F 3BF4A 4URSA 3GYNA 1DFDA 1FVQA 1LNQA 1LKZA 2IC3B 3NGKA 1FE0A 2BACA 2MPUA 5KFQA 2CPZA 3VQTA 1RTIA 1VRQC 1VQSA 2CQ0A 2DCLA 5IT9U 4G3IA 4DPOA 4KYZA 4HKQA 3QRQA 2QYCA 4Q45A 3SBMA 1RSCA 1Y0HA 2ZM6F 2ACYA 3FGVA 3PCOB 4QU7A 2DIVA 1YRXA 3AB4B 2X7IA 3CJQA 1H74A 3L09A 3JYTA 3R5JB 2JEFA 4ELUA 1NK9A 4JI1J 3GE9A 2IVYA 4OYWA 4NCBA 2MZJA 3PW4A 1WC1A 1N88A 2F4VJ 1RTJB 1YDLA 2LDIA 3PIOQ 4OYZA 4RJVA 2HYIB 1FDNA 1QDUB 2HNZA 2V2QA 4I2QB 1T9YA 5DG7A 1XNRF 4B9SA 3CIZA 4OZ5A 4GMKA 4WFNQ 4MKAA 3CCES 3D6HB 1SJQA 2XO7A 1YWXA 2DIUA 2KXFA 2DH7A 5EN1A 1C1CB 4QWDA 3G8QA 3O3LA 2VPYB 4DMZA 2DR9A 2V50A 1BY9A 4HACA 3RUBL 2FVRA 1WD6A 3DRXA 3U02A 2DRBA 2MSTA 1JX4A 4PYAA 2FVPA 1TL5A 3IMQJ 4P75A 5EX0A 3ZFVA 1UFKA 5KFEA 4V19J 4CO3A 3ZTQA 5AXNA 4DX7A 2WAQD 3A3PB 2VKRA 4NLUA 3SV4A 1JLBA 3I9ZA 4WK3A 4DS4A 3AOAA 3M2RA 1WNEA 4QYZJ 1C1CA 3SI8A 1M90T 5B0CA 5KTQA 1UETA 2IVMA 1TKXA 3M32B 1TVRB 3A8IA 1TTHB 2DO4A 2BV3A 1NXIA 2ATLA 4DR2F 1KVKA 1S7IA 3A8KA 3IR7B 3MPYA 4U95A 4MAKA 1R0CB 4ECYA 4M5HA 3ISNC 2EWHA 1UEVA 1Y00A 3KG0A 3KHLA 1FWKA 2Y8WA 3MZIA 3HSJA 1ICEB 4OYIA 1UJ6A 2BJEA 2D3ZA 3UQSA 1UVIA 4GVLA 3VV2B 3E01A 2HZAA 4DQSA 1NK4A 3S7RA 1KNZA 3IM9A 3I6PA 4WPAA 1FTRA 1RB0A 3X1LB 1S1TB 1N0VC 3PR4A 3IWXA 4IH5A 4GC7A 4OHYA 2BDPA 3MMBB 3TEGA 3OLAA 4U8YA 5KFJA 3MOZA 2JFDA 5ITHA 5KFHA 4IH6A 1VC5A 2Q43A 4ED8A 2AU0A 1SXLA 4ZPVR 5DQGA 1JLEB 1HFEL 2DBBA 2EK1A 3TANA 3BDPA 3RAXA 4C8MA 1C0UB 4HHHA 2Y8YA 3TARA 3BSCA 2B56A 4A8OA 4F04B 2QLBB 3CCTA 3IO1A 4UZCA 5K8NA 2R7SA 2A2DA 3CD0A 3EGNA 3VWSA 4B9MA 1TP7A 4WZMA 1E6YA 4O3OA 5IQQA 4IQMA 4DR4J 2YH0A 1R8AA 4DV6J 3QIPA 4ILRA 4NXMF 1FWLA 1T3OA 5AE1A 3KG4A 2DNNA 3OXGA 1OY6A 1M5SA 3C16B 3UE2A 3OFFA 4KB7A 2VFSA 1DTTA 2ZM6J 2BOPA 3TVKA 4P2FA 2NS1B 4L73A 3GIKA 3GFHA 1RT1A 2KXHA 4L76A 1FJEB 1X4BA 2YWWA 4JI5F 1S77D 3DMJA 1VRTB 3DGVA 5ETVA 3EYZA 4EI2A 4M5LA 1G6BA 4LFAF 2YY3A 2KFZA 3TAQA 2ZFHA 3TZXA 1FEEA 4UOGA 3W5XA 2AV5A 2FJWA 1UVJA 1RAAB 1WC0A 4FBUA 4DLEA 1EETB 4LF1A 4KV8A 1TL4A 5DM7Q 2K7KA 4L74A 1RT5A 3BBCA 3VVUA 2E1PA 3IS9A 2Y1JA 1SH3A 2HS4A 2AD9A 4OYMA 2KG0A 2JNJA 1MN7A 1F9HA 1HQEB 1SL0A 5L1KA 3CPWR 1HNXJ 3PRDA 3GR0A 2RT3A 3KJVB 1QUVA 4IFVB 3CD7A 1JIHA 2DNMA 2OAUA 4DSJA 2Z8QA 2VC1A 3DLKA 4F4WA 1RYSA 4M94A 2ZHAA 4I6WA 4WIQA 5HMWA 2VOOA 1ITPA 4IYQA 1NHUA 1K1SA 1GQEA 3DKDA 1H0HB 1RT7B 4DV1F 3CJ8A 1S9GB 4OHZA 1XIQA 3K5LA 2WONA 2XS5A 1LXNA 2VG7B 2LXFA 4Y00A 1X60A 4C3MA 4D3GA 1X0FA 3EVMA 4ECSA 3OFHA 3TYTA 1R8CA 3R5CA 5CQGA 1NPPA 3S8SA 5CH7B 4Q2LA 4GKJF 1BE4A 3T1YJ 3DHXA 3I55S 3EDQB 5KFVA 1IBLF 3TWZA 2IM2A 2ZH9A 4WJBA 3KMSA 1X4CA 4EGLA 2CWKA 4F0MA 2AJ1A 2DXDA 2B4UA 4EWTA 5DG9A 1C1BB 2DNRA 3SFGA 2BVZA 5KOWA 2OPPB 1RABB 1VJWA 3C16A 4OHWA 2POKA 4OX8A 1HNIB 4YB6A 5HP1A 2ZEJA 1S99A 2F63A 4YY3F 2IBKA 4FF1A 2F7VA 1N6QA 5K8PA 3FVYA 3VAKA 4WFYA 1X9SA 2K7JA 2GJFA 1Q8LA 1DAXA 2Q6BA 3CJ0A 2BJ7A 2D74B 2JC1A 4YY3J 1VQ8S 5HROB 3J7A1 2KZZA 1OYDA 1H72C 2CQ2A 3DLBA 5D78A 1HMVA 4K5RA 2QYGA 2E7XA 4MT1A 3CDUA 2V8DA 2XSFA 3ENQA 4URGA 4DV2F 1QVFR 1KS2A 2E5GA 1PGZA 1KQFB 4WTOB 5LJ5Y 1K73T 2DR8A 1NSKL 3R97A 2GA7A 2Q1LA 3LTOA 1VQ6S 1KHWA 4G65A 2ZNYA 5D77A 1MG7A 4WIIA 1NSQA 5D3GA 2M3DA 3MXHP 2CPHA 2DNZA 2JVRA 1MU2A 4JOUA 2OPQB 3CJ5A 3AQOA 4AQYF 1EAYC 2MEWA 3UCZP 1M5HA 1RT1B 1VI7A 1SIZA 2U2FA 4RUAA 3G6YA 4DR2J 1UA0A 3I96A 3H90A 1V3ZA 1VS3A 5G4DA 3IBFB 1TAQA 3V6KA 4ECTA 5HBMA 1RA6A 2CQ4A 1V3SA 2IRYA 3TR5A 3M05A 4JI8F 1ELOA 2RD5C 2AJQA 3OVSA 4ZLJA 2IYGA 3LGMA 2WSCC 1S0OA 3VALA 1OSDA 2DGXA 5KOXA 1YRUA 2WHOA 3MR7A 5DDRC 1K9MT 1YG0A 2XEXA 3V4MA 4CLPA 4ER8A 2DRDA 4M5NA 3T41A 2RJZA 2OPSB 3HKWA 2EFPA 1JLGB 1Q8IA 2FVSA 3M32A 3PX4A 2C3MA 3QGGA 2L08A 4OZ1A 3RR8A 1ZAVA 4CO4A 4DR7F 1IKYB 1W7WA 2ZWPA 1S1VA 4WU3A 4KY3A 2DR7A 1GX6A 1RU1A 4B3RF 2KRRA 3R6LB 3TZYA 2ZJRQ 1DY3A 2EFNA 4MFBB 1CQMA 4DFJA 3FSYA 3O8WA 3VCDA 2QN6B 3RBDA 4IUFA 5F9NA 2NXCA 1VBXA 4PPZA 4A46A 3MFHA 1Y5IB 1U24A 3IGVA 1IR1A 5DO2A 1T05B 4JV5F 1A7GE 5K14A 3CUNA 1WOPA 3ETMA 4W90B 3AA8A 2RF2A 4FZVA 3TJAA 5J2MA 1SPBP 3ZTOA 3CC2S 2M7SA 3CCWA 2NPFA 2ZDOA 2R2UA 1JLCA 2BQUA 3VGVA 4RUBA 3K89A 3KK3A 1YKWA 2XQCA 2C28A 2M88A 5AJ3J 4IDKB 1YJVA 3SCKE 2B9XA 2XC9A 1N36J 2CG4A 4Q44A 1VRUA 3ETOA 4N47A 4CLTA 2AWZA 2X1BA 1HHQA 3NS5A 1KTQA 5HLFA 3HO1A 2F3JA 4PQAA 4IFYA 2R3VA 2Y1RI 1CJVB 1YGYA 4LREA 8AT1B 2VG5B 2WSFC 2E9RX 3R2DJ 4ZJLA 1Q4RA 1XR6A 3FEXB 1DQAA 1M5KC 2P6SA 2R4FA 4XDDA 5KFBA 3SYZA 1WG4A 2FLOA 3SDEA 5D0EA 4WXOA 3EWGA 4F50A 2KVQE 2IRUA 2L48A 2XMKA 5CYQA 5L39A 3T1HF 2OUGA 3GP9A 4XAKA 1O0PA 3N6NA 1RCXB 2VL1A 1REGX 4X4OA 1RT4A 3C15A 3IG1A 1JJ2R 1TFWA 3A13A 1HI8A 3MD1A 1EHWA 3QFWA 3J81j 3FJ2A 5DGBA 3KK1B 2KG1A 1HBUA 2G2OA 4G1PA 4ID8A 4R8UB 1UJ5A 3M8QB 4DN9A 1ZM2A 3L7PA 2K2PA 3CMAS 1GTEA 1QE1A 1NJZA 2I1RA 1K8AT 2J9DE 2OPRB 4CO5A 1S1XA 5HSPA 3CCSS 3H40A 5CYMB 1Y3KA 3C15B 3US5A 3HHLA 3X3UA 1WI6A 1U48A 4NEZA 1HARA 4RW6A 4QOTA 3K8WA 4WFAQ 3LP0B 2AJ2A 5J2NB 1FNOA 2Z57B 2IJNA 4HEA9 2GO9A 1C0UA 2MQLA 5IOLA 3VAHA 4RZRA 1JK9B 5IWAJ 4IG0A 2YKAA 2RS8A 1SL2A 4R0JA 1FFSB 3VAGA 4UOCA 3I87A 1U4BA 3J7YU 5HLFB 4F4KA 5THWA 4A47A 2BQRA 1LWEA 4LVNP 3CO0P 3EX7B 2R7TA 2CDQA 3UD5A 4H4MA 1VK8A 1UW4A 3SFUA 1HA1A 1N5VA 4FVCA 4DL6A 4B9VA 4ED6A 2EVZA 4JI0F 4USIA 1MROB 1IM4A 2I0XA 3ZTSA 3O1LA 2H3EB 1U6ZA 2GQ2A 5G0RA 1IKXB 1MNEA 2ZKTA 5CYQB 4ZVRB 2KYZA 5AJ3F 2PEHA 2D3O1 2DH9A 5JVGQ 4ID5A 1S9FA 4C97A 1LOUA 2HHWA 1R27B 4QW8A 3ULHA 3BKTA 2E7WA 2J8SA 2W7AA 1BGXT 1HKAA 4TY9A 4BWJA 5E41A 4J9NA 1S10A 2ZD1A 2HMIA 1KVIA 1UKUA 1Q0NA 1RHUB 3W9IA 4LF8J 1RT6A 2XI3A 5HVHA 3T5JA 3IR6B 1RAFB 2Y0SD 5J2PA 4ECQA 2OGUA 3FMBA 5KT7A 1RAJA 3NNCA 3GJQB 2NYIA 1ROFA 5F3TA 3JSMA 3R7NB 3QO9B 2HHHF 4NZ7A 2IDEA 4HH1A 5B0EA 2VQFJ 1J5EJ 2XB2D 2HHXA 2N4CA 2DHHA 3HVWA 4NLQA 3RBZA 2YWKA 5DDQC 4RUCA 2LKZA 5KFOA 4XPCA 3HPOA 3ET6B 5E2QA 2KO1A 2M8DB 1APSA 2UXBF 5T7LB 3JTOA 1KQSR 3G2XA 4C3LA 2C1EB 2V8GA 4P7TA 1G1XA 4DR7J 2OSRA 4PWWA 4YHHF 1NDCA 2A3JA 5ETSA 3S6EA 2EFOA 4ZIVA 3EE3A 1U25A 3I4PA 3RRKA 1WKLA 3RB0A 2FZKB 1GAOA 2Y1IA 3U1NA 3DFEA 3QT8A 1ZPVA 2MQMA 3PKYA 2QA4G 1S1UB 5LOQA 2AYGA 4IQXA 3MCOA 5GAEI 5U47A 1RTZA 3SMZA 5B0FA 2HVZA 3CCJS 2H4YB 2HQGA 4MIAA 3JSRA 1GTHA 4DLGA 3E2EA 2UXCJ 3W8PA 3KK1A 3KLFA 4JI4F 1RHJB 1PYOB 2G1HA 4MIWA 4TYAA 4DV0F 1RT4B 3IG1B 5F8HA 1UVLA 4LR7A 3PEJA 5KT6A 4KE5A 1ZYQA 3CCQS 4F0KA 4JYAF 1S1WA 2HBYB 2QSWA 1FRIA 2JC0A 2W2PP 4KO0A 4M1KA 4DR1F 1YVFA 1FDAA 2W24A 3G86A 4ZPCA 4CH1A 1KBRA 2DYAA 2QL5B 2B5JA 2IMOA 2ZOFA 4KSEB 4X2BA 2CPFA 4UY8T 5LMUF 4OYBA 4X65F 3I0RB 1I6JA 2MKKA 2OSQA 5CYMA 1R43A 2L9WA 2I6WA 2KJVA 1FRHA 4CI0B 5KFXA 3OR1A 2ZH2A 5LT5A 2AYEA 2QMWA 3H5UA 3JQJA 4NEYA 2RRAA 3B8HA 1KQGB 2FYXA 2YPZA 3AD8C 2JVOA 3WC0A 1DZ5A 1JLAB 3DCAA 4P2MA 3T5LA 4LFCJ 2KU7A 1EB0A 1QAYA 3W1YC 3BQ0A 2EBEA 5HQMA 4CLLA 3GJRB 3ENAA 2DCUB 4PCQA 4WKRA 1S72S 1RTIB 3UFCX 4LF4J 4ED7A 2DGQA 1HYSA 3SQOP 1H2VZ 1NRKA 3OHBA 1JLCB 2B3TB 2FHKA 2GC8A 5HMXA 5L38A 1WWHA 4ZVEA 7FDRA 1WJ9A 3H4DA 4FP9A 2ZZNA 3R2CJ 2V4JA 1KFDA 2MTLA 4GKJJ 2HHSA 3HX9A 4Y3CA 3MEKA 4DUZF 3R8YA 2YKOA 2C3UA 1VQOS 3VZHA 1RWNB 1S6PB 2HBRB 1HW9A 2VG7A 3CNQP 4DCPB 4DSFA 4EMDA 3O5TB 1TQLA 3C8YA 2WVEA 4LF4F 1S9GA 2DHGA 3VGSA 2CQBA 5C5JA 1ZH5A 5KFUA 4ECVA 4DX8H 1WTFA 2VG5A 1BQXA 5F8IA 4ZJQA 2OI2A 1RAEB 2ILYA 3PRBA 5FDLB 4QW9A 4LF6J 2KTQA 1FD8A 2X1AA 2RS2A 2YKNB 3BPDA 4Q8FA 1GMVA 4DR4F 1A9NB 3ELHA 3CW2C 2J0XA 3FFIB 4HI2A 2FJXA 3DU5A 4BCAA 4NLXA 4OYOA 3V2UC 1HD1A 2HZCA 2BXJA 2A6OA 3C6UB 1NHVA 4RW6B 1FE4A 1K47A 1X5TA 4P52A 3UR0A 2P8IA 2PMHA 5KT2A 2HWHA 2BJ8A 5L1LA 1JJHA 3QSYB 1WF2A 2XMVA 4NLRA 5A0YB 5DLFA 2XY7A 3KWMA 3TW0A 2J7WA 1L3VA 3CTRA 3N0VA 5DM6Q 1CC8A 1HQUA 2W4DA 3JAMY 2C3YA 1HWLA 4LFAJ 2DGSA 4KPYA 1ZTTA 4ZITA 5KT5A 1HNWJ 4ZN1A 3MAHA 3IXQA 1Q1KA 1UPMB 2PI5A 2AHOB 2PFDA 2M8HA 2VASA 2BKOA 3DRRA 2BE7D 2PT0A 3MUMP 2BKPA 3KJVA 1AUDA 4ZPWR 4DUTA 4QWCA 1WG5A 1LWCA 2WBMA 5LL6d 1PKUA 3M6VA 3Q8VA 3TA0A 3N01A 4DFKA 4FF2A 1HBOB 2DKOB 1IR2A 2A18A 1T11A 2VFTA 2HFNA 4KV8B 1KFSA 3SSSA 4EO6A 4O0IA 1N34F 1FI4A 1TL1B 1GMWA 1U7LA 3OFGA 2LEPA 4AD6A 4CLYA 2B8PA 1OPIA 3DLJA 5KT3A 2J9CA 1KSPA 1Y4ZB 2ACMA 1D9DA 1T9VA 4JV2A 2E1CA 2NCKL 1MW7A 2GHVC 2M70A 2OFGX 1LWCB 3ILLA 3DDIA 4MK8A 1IJEB 3KTQA 4WFZA 2NSBA 5MAOA 1NCLA 5CD4H 3W3SA 2CWXA 1CJTA 2W1BA 3I31A 3NXZA 4KHMA 1REVB 4HDGA 3J81Y 2MKHA 2UP1A 1WHYA 2N3OA 2OH2A 1S1UA 1YITS 1U1MA 2EC0A 2HHUA 1UVMA 4C6AA 5GMKa 1JNRB 4J9PA 4Y2MA 2O01C 4B9NA 4H4OA 2G2ZA 3P5TL 1MWQA 3TX0A 1P27B 3QFHA 4NMXA 5IT9Y 5CA5A 1S59A 3C19A 3DRSA 5J2QB 2BOAA 2CXEA 3KDNA 2CADA 3TX8A 2PFFB 1E6VA 2ZC3A 1IUJA 5DZ7A 3H42A 4WCEQ 1QUPA 5I4MA 3A8JA 3GWCA 5DQHA 4Q2MA 1T05A 4PQUB 5EWGA 2VV5A 3ZZYA 5EWFA 5FDLA 2ABYA 2QEXS 1SC1B 1RWOB 1NMEB 2GGPA 2HFUA 1XN9A 3LP2A 4W98A 3NMAA 1IKVA 1Z4UA 1SUQA 3VHQA 3MCSA 5C7PA 4Y6IA 2YQ1A 4JB8B 2H51B 4PG5A 3NS6A 2XMMA 4WP3A 4Z7CA 4JI2J 1WORA 2EBGA 2IVFB 2HRTA 1SH2A 3GG1A 3N4WA 1D8ZA 3GSDA 3SIPB 2O1PA 1Y9OA 3TUZC 3UN2A 1HQEA 4CO0A 2UZAA 1JLGA 3CCMS 3FCHA 3AB2B 6FD1A 1U1QA 2NREA 3FBFA 3MM6A 2HSEB 4KR0B 2V0NA 2JFKA 1WF0A 2C2MB 1B0TA 3KNGA 1YSJA 3BBFA 3C6TA 1VBZA 3GCXP 2XNRA 2GMLA 2Z0GA 1YQHA 2FZCB 4MH8A 1U8WA 2XYPB 3IWLA 2XMWA 1YJUA 5BR8J 4A8QA 5EUHA 3PW7A 4LFBJ 2QX0A 2XYHB 2XLJA 1NKBA 2X51A 5JXSA 4OZLA 2HW3A 2EFGA 3OR1B 1RUSA 4H4MB 4TU8A 2FQQB 1WTBA 1RXOB 4FKYA 1U09A 5KT4A 3AODA 1BWVA 2CA9A 3FBCA 1HD0A 4NZ6A 5FJ4A 1GMUA 1FT8A 1YJTA 2RUSA 4MYUA 3T5HA 2QTWA 4M5DB 3UVJB 4DPYA 4X4SA 2HG4A 4ED3A 3FRZA 4RBUA 1T7PA 5C25B 3GTYX 5DQIA 1R7IA 1OJ4A 3DLLQ 3GV8B 3DNCA 2HVEA 2WOMB 1EP4A 2HK2A 4DL4A 4M5DA 1HWKA 2LU1A 3UVJA 4CLUA 3BO4A 1F2HA 5IXUA 3BGFA 1TK0A 4LRAA 1TELA 4NMLA 1FNXH 3DC2A 4U7CA 3QT6A 3T3FA 2IA6A 1W25A 2CAJA 2CPJA 4MKVA 4QR0A 3M9NB 3TI0A 1WEZA 4C8KA 5C2CA 3RRGA 2QLWA 5GMDA 1TZ0A 2CQGA 2DXEA 5KG5A 1I1GA 1UWBA 2Z30B 3DGPA 2G0CA 4GO5X 4DSLA 2GVDB 2HBZB 3DMJB 1IKVB 4J9QA 4KHRA 4DV7F 4QYZK 2F5GA 2WVFA 3MURP 4GKKJ 2MLYA 1WSVA 2JEIA 3NNHA 4Z7YA 1DTTB 2CPEA 3EGWB 1QY7A 3NOGA 4Q43A 5AXMA 1YJ7A 1G7CB 1WC6A 2E1RA 2HAIA 2JLFA 1S6OA 4I6YA 2YNHA 3UD3P 3C2PA 2Q3PA 4CM0A 3Q24A 4MYTA 1Y11A 1HHSA 4ED4A 4X65J 5LMUJ 3Q8YA 4CLFA 1CS4B 1PO6A 3FRYA 4Y0FA 4OL8A 4R5PB 4YEAA 4LQ3A 1GNKA 1FD2A 3PVXA 2YKMA 1PG5B 1C4CA 1FJ7A 1CJKB 4ZOSA 1FRKA 5F9LA 2MKJA 4H54A 1TVRA 4ETZA 2FC9A 1JKHB 3ET6A 4USHA 1T8EA 1O51A 3JB9k 4LRCA 2UV8G 4XTTA 3BSNA 4CQ1A 3BN7A 1RHMB 3KLIB 5KFWA 2IJFA 2KN4A 3NBPB 3CGIA 2QSFA 4OYXA 5ETNA 1UZDA 3NS7B 2WW8A 3I0SB 2VFVA 3QO9A 4IFYB 4DBQA 1N5YB 2UXCF 3D1QA 3TZZA 1VRUB 2YXLA 2XGQA 1L3KA 3QATA 3GIIA 4IR9A 1KN6A 1NH7A 4USJC 2GGPB 1WUUA 5K20B 5D4NA 3HI9A 4NYPA 2HAFA 3PR5B 1VQMS 4IKAA 2M5YA 2VQEF 1ZA2B 2H1YA 5F8MA 3K58A 3R1HA 2YQ3A 2DISA 2KT3A 4KGXB 3RU0A 4ZHRA 3KLHA 3F0NA 2BYCA 2ILZA 3M4XA 1ZM3A 3GLJA 3MCMA 3M8PA 4YHHJ 2MY7A 1W2BR 2BE9B 1XMBA 2V6AA 4WK1A 1I94J 2DD8S 4MJKA 2DH8A 4A8KA 4OJGA 1G3OA 5MLCV 4IRDA 4ZCLA 3SCLE 4H4OB 3W8GA 3K5PA 3R6GB 5I3UB 5KFLA 1KHVA 1KTVA 2V9WA 3IFEA 2U1AA 4ZP7A 1QAIA 4JI6J 4E0DA 3OBIA 1V9OA 2CJYB 2K8GA 3MAAA 4I2PB 4I7FB 4J5OA 2GMHA 3M9OB 1Q82T 1I94F 1RTDA 3PHEA 1X9WA 4K2JA 3G6XA 2HHHJ 4F8RA 4USKA 2VONA 3PW2A 3GR1A 1TKDA 3D28A 2OELA 3UW1A 1IKWB 5J1PA 2QJ3A 1L3TA 1WSRA 3WZ0A 3GYGA 4GC6A 4J37A 1WG1A 6FDRA 1X5SA 1S9EA 2FLPA 3HZEA 2ZOMA 3D54A 1ZBTA 4DV4J 2ASYA 2MZRA 2OPSA 1CJKA 5H1SV 4ED0A 3A12A 3NGDA 2CJXB 4QR1A 1URRA 1WHVA 4KC5A 4M5GA 4LQ9A 5AXLA 3UDVA 1T94A 4CZCA 4X4NA 4J9SA 2OJ3A 3HHNB 3ENWA 1QE1B 2ZC4A 3NBPA 3TUJC 1TFYA 1OQ3A 3HD1A 4N8OA 3GQCA 3K0JA 4ILMA 2J0QD 2OEJA 3DOLA 2O5DA 2LQJA 4OHXA 2QG9B 4DHVA 2OPPA 1S49A 2COLA 2ZKUA 3ISND 3OTBA 5DDPC 2CQIA 3HP6A 3NWGA 4HHUA 1SL1A 1NK0A 3D0IE 2W2QP 2HQIA 4EEYA 2BX6A 3MHYA 1C2PA 2PMZD 2ERRA 4OI2A 3M7VA 2W9BB 3KLHB 1O5JA 3W64A 3OVAA 3AQPA 4URQU 4DN0A 2R7WA 4K7QA 5B0AA 3M1VA 2ZZMA 5IT0A 5HL7Q 1CJUA 3QRPA 1SV5A 1FX2A 1HMVB 2A10A 2HKEA 2XZTB 4NA3A 4ICLB 5GAGI 2KFNA 4F7VA 3GIJA 1VCTA 4BBYA 3DOKA 3U7JA 2ZH4A 2BA9A 4MKBA 2J0SD 3SCIE 4UZBA 2RIJA 4USTA 1UFWA 1P8GA 3CF5Q 2R8JA 2E9ZA 1GH8A 3IGNA 1B0VA 1WACA 2KT5A 3DM2B 4FYVB 1FJGJ 1YRTA 4WWSA 2KM8C 1JKHA 4CYUA 3QZ7A 3IS9B 1Q86T 5IV4A 5LXRA 2RDDA 3BBBA 5C24B 4RWXA 4LF5F 1BXNA 2NXEA 1Q7LB 4TY8A 1TL7A 5A76A 1F5CA 1EETA 4M5JA 2RHQB 2WTFA 1UW9A 1VISA 3A8EA 4RBVA 2Y1LB 2VPXB 3GFYA 3T1HJ 5J2QA 2AP6A 4DJBA 4B08A 3DN9A 3QAEA 3L95X 1Q79A 2UVWA 4A8SA 5HAOA 1QAXA 2WONB 3R5DA 3MEDB 4NYZA 3W5YA 3PX6A 2VOPA 1S0MA 4CLSA 4KIAA 3OXFA 4B02A 2QGFB 2IM3A 1REVA 5D0GA 3RAMA 2HZVA 3D7SB 5DDOC 2MQOA 3KHHA 1FK9B 3T6BA 1RWPB 3ONQA 4V19X 4RW7A 3BZQA 4N56A 3H59A 2CDRB 2MDAA 5ETKA 3DRPB 1W2IA 3FMWA 3DLHA 4ANCA 4EBCA 2G9OA 2MZSA 4KT0C 4K4XA 2M9KA 3GFXA 4OJ3A 4QQBA 3R9LA 2HRUA 3UCUP 1F5BA 4OV6A 4JI2F 4DV6F 3CDWA 1OIAA 4DV4F 4OFZA 1SCJB 2R42A 4PYDA 1ACMB 2O67A 2ZWOA 1NK6A 2DR6A 3DRSB 3HVAA 1H2TZ 1EX8A 1V5VA 3QGPA 2FJAB 1YLXA 3OQ2A 3TJ8A 3C14B 1UMJA 3M30B 2ZJPQ 4NI2B 3CJ2A 2QFJA 3VAMA 2IRXA 1JXLA 3FBEA 2LQ5A 1IBKF 4YB1P 3N79A 1RI7A 1U0SA 2RQ4A 5E5NA 3PFEA 1LW0A 3MAAB 2VBWA 1RTDB 1LW2A 1TKTA 3N6MA 4BDPA 2DHXA 2HNDA 3ZO7A 2FUG9 3TOQA 2H5EA 3MFIA 4RW8A 2WVCA 4OX9J 1E6YB 1ZM9A 1FWPA 3V6JA 1F3FA 4C98A 5LSRA 2FVQA 3V5RA 1KLMA 3CSKA 4ZHRB 3OL6A 4EO8A 5ADZA 5JUMA 1WDTA 2VICA 2ZH6A 4IR1A 4USMA 2ASJA 3IBCB 2ROGA 2XS7A 3OSNA 1UZHA 4DQPA 2KXNB 3W62A 3KJNB 3VZIA 1CPZA 1NO8A 1X5PA 1FFWB 5A8WB 2UUWA 2LQ8A 4V1Ak 2C2EA 2C2ZB 2HGLA 2F40A 2O66A 1UL3A 1T03A 3OXLA 3FQLA 3MF5A 3HHEA 2H9ZA 3NGSA 4RNHA 1ZOTA 1Q5VA 3TQEA 1N33J 4PABA 1RT6B 1WHXA 1VJQA 3OR2B 4ZP9A 2EFVA 3IAM9 4Y2CA 5J2PB 4HYKA 2K1RB 2KM8B 2GJIA 5E3QA 2NXUA 3PJWA 5E3AA 4FXDA 1RLCL 4FYWB 1LFPA 1R3NA 1OY9A 3MR6A 3EICA 4DUYF 4UUWA 3UDCA 8RUCA 2BJ1A 4AQYJ 1E6VB 2HQDA 2RDIA 1UA1A 3AA9A 2DR5A 1WEYA 2D9OA 3CO9A 1VBYA 4TQRA 4QIWD 1RGVA 4IH7A 4KPCA 1UP1A 2DGVA 3BO3A 2KHDA 5LSLA 3DLEA 2MKYA 4L3KA 2OD4A 5BYRA 4J9MA 1KOOA 2YQ0A 1O8BA 1IQZA 5T41A 1HR0J 2HFOA 3NOCA 1SQGA 1ULRA 4A48A 5DG8A 2YKMB 1KR4A 4ECRA 4LIWA 1VC6A 3AXKA 4A4JA 1NKEA 3CJTA 2UU9F 1Z2LA 1JJ4A 3KOAA 1MMLA 2IY5B 5FIIA 3R7BB 1XWLA 1ZAXA 3EVOA 2N3LA 1S48A 3GILA 4ED2A 3U1LA 2QRRA 4TYBA 1T95A 1UWBB 3AD9C 3LUYA 2VKZG 1HQUB 2FGOA 2YKNA 3C14A 3M30A 3CMQA 3NEKA 4OX6A 1MMNA 3HFZB 4TKTA 4IOCQ 1HHTP 3M2VA 2W01A 1T9XA 4KFBA 3P5BP 1X4DA 3DGPB 2J7KA 1AT1B 4LSLB 4UOHA 2XSJB 1GXUA 4O4RA 5L8RC 5KFYA 1EP4B 4C8NA 4K4YA 1X4AA 2D3UA 4DSKA 3CJRA 4LF5J 2CQPA 1HBOA 2OTLS 3N28A 1CVJA 5ETTA 3F44A 4DG1B 4FNHA 3T1YF 3PW5A 4WP8A 5GAEU 3Q83A 3LW5C 1FK9A 2GZOA 4HL9A 5GMEA 4CDIA 1VIXA 4DI6A 4QPXA 2RKIA 2YNFA 4OI6A 3TZWA 4ZLNA 1M1KT 2JZ5A 1NU4A 5K8MA 1OY8A 4PUOB 5HVFA 2IAJA 4LSZB 3SSQA 2ZVSA 1AYEA 1CULB 3MR2A 3KHRA 2QIFA 4NYOA 3MECB 2DGWA 2WZ1A 2I38A 3C6TB 2YNFB 2RH3A 2CUYA 2AQ4A 3MM5A 4ZA1A 5L1JA 3LP1B 3NY0A 4DU7A 1P1TA 1RYRA 3FBBA 5L9NA 5LMNJ 2VBZA 5E33A 3Q8QB 1FJCA 2AZ3A 4EU0A 1VMBA 3OUYA 4K4WA 1KD1T 4HDHA 4WE1B 4WKYA 3UPFA 4XK8C 4CWBA 2LDYA 2QC3A 2X3GA 4QPTA 3PDNA 3BQ2A 3PKMA 4O4GB 5ETPA 1FERA 3E51A 3OJUA 2AYBA 2DNHA 4WBFA 1N32F 2RRNA 3D6FB 3MM7B 3NGTA 4RW4A 2R8GA 2CVIA 4JI7J 4Y65A 2L41A 3MWBA 1NJYA 2H54B 1IN0A 1Y5NB 2WB4A 4LBIA 3EZ5A 3EXCX 1RBOB 2ZOGA 4U6PA 2HIYA 3D6TB 3D3CJ 4N7TA 4TU7A 1D09B 3D1OA 1Q16B 2MGZA 2R8IA 2AX1A 4KO0B 5LSOA 3RRHA 3VGTA 2B4OA 3L3CA 1Q8BA 2ZH8A 1U02A 4C11A 2V4RA 2V2VA 5ETOA 4ZDNA 1EKRA 1V5IB 4NLSA 3BB5A 4X64J 1FHTA 4GRSA 3PYFA 3W2VB 1T9UA 5D0HA 1PC4A 2XHCA 4DR5F 2FDNA 2P2CB 3M8RA 1CG2A 1O6XA 5HQLA 3EVWA 3DOMB 3KK2B 2W7PA 4UF4A 1WF1A 2HWIA 3ISZA 1N5SA 3MPVA 5SUHA 5KFTA 5A8RB 4ATNA 3BO2A 5K14B 4NZ0A 1L5UA 4OYAA 3EMTA 1NPRA 1HNVA 2HS0A 3HD2A 3POTB 2IPOB 3U27A 1S97A 2Z58B 5LM7E 4NCAA 2EXUA 2VFRA 3JSBA 1VQNS 2FHJA 2JEGA 4KQZA 3MPUB 3H5YA 3LGNA 2VU5A 1RU2A 3VGUA 4CT9A 1X4EA 1JQGA 1ZS6A 2B5JB 2XMTA 4ZPTR 2GIQA 3F73A 1VQ5S 2G4BA 1TV6A 3IR5B 1T9WA 2HS3A 3KXDA 4KJIA 4OI4A 3G8SA 2V67A 3QZ8A 4MKYA 2C2NA 1TUWA 3R5GA 2RAQA 2VFUA 4QIVA 4OZ3A 4A8MP 1RHQB 2FJEB 4ZVSB 1IBKJ 5D4PA 4ZCKA 3G6VA 2PO4A 2V4QA 3LWMA 1P9QC 3FSIA 4U96A 3HHLC 4YB7A 3C3LA 2QLJB 5D15A 4C7QA 2DRAA 4F0HA 2RUGA 2MQNA 4UUXA 5KG6A 4RNOA 5JVHQ 5K9FA 2UVVA 1FXRA 5G0RB 4YR3A 2IYIA 4LF7J 2F1FA 3L7UA 2V94A 3LA0A 3QT7A 2HK3A 2KHCA 1F60B 1FA0A 3MCNA 3NKYA 4UQTA 2GO8A 5HBMB 4QBUA 1CEZA 3QNWB 1F1BB 1RWKB 2BE2B 3DRRB 3EGVA 3QPIA 3SEOA 2ZITA 4ZVFA 2RKIB 3MI7X 2YWEA 5KFSA 4FBTA 3O44A 4O3NA 2CPIA 1LWEB 1S6QA 3W2VA 1U1PA 2UUBJ 4P2XA 3CB4A 1F5AA 1I5OB 3EZOA 2P6TA 1SC3B 4FPIA 5D0RA 1QAJA 4C3KA 4YFUA 1H3DA 1OSCA 2BW2A 1BQMA 2RILA 5A6WA 4CNYA 3M8PB 4WYWA 1X4GA 2ALYB 3K7RA 4NOHA 4ES2A 1MROA 1UAWA 5C24A 4P73A 1RA7A 4PXBA 1XNRJ 2BW7A 2DHSA 2EI5A 4RKUC 5BYSA 1JMTA 2ZVIA 2BUNA 1RT7A 1KOHA 3P45B 4KRWA 1HL6A 4AL6A 2P5VA 1D0EA 4DXLA 5J1NA 3LALA 1F3VA 4ANDA 1HNVB 3JTPA 1S0VA 2RB7A 3IWNC 4ZVTB 4K0KF 1X5OA 4IRCA 1KDNA 2DGUA 1X9MA 2HVIA 2HWTA 3KUHA 4C2MA 4IFVA 2PEBA 1HPZA 4PG7A 1C0TB 3F41A 2VPZB 3PY8A 2A0FB 2ASDA 1FKAF 2F8EX 2VA2A 3M1VB 3H20A 3OJSA 2VG6B 4YMEA 2DNYA 2LFVA 1QD1A 4B9LA 5KFNA 4GO7X 2YX7A 2DJWA 1NEEA 2BANB 5C42B 4EBDA 1SJ4P 2V68A 4C0OC 3MECA 1MWYA 4F26A 1DLOA 4X84A 3IRXB 2N7YA 4FYXB 4YDXA 2UVRA 3PYGA 3EPGA 2VODA 2YNHB 4HTJA 1DHMA 2DNGA 5HK4A 4ZN3A 3MUTP 1JLAA 1N0UA 1AW0A 4R8UA 1F0XA 1HBNB 2PSZA 2XM3A 5AE3A 5FLXU 3V81A 1F6TA 4RBTA 2Z56B 4BS2A 4DWIA 4NLGA 3GJTB 4DL5A 4PWDB 3GONA 2Z4PA 2WSEC 1LV5A 2ZDPA 3LF0A 2J76E 3H0PA 3LAKA 4PXEA 3J7ZT 3Q23A 1HNXF 4ILLA 2AYMA 9RUBA 2L3MA 2CIMA 2XYGB 5DZ6A 5CZVA 3LANA 1GFWB 3I5AA 3EPIA 4DR6F 4KH1B 3BN4A 2XHWA 3ZZ0A 5F41A 1RT2B 2DITA 2BJDA 3T9ZA 5B08A 1VOMA 4NE9C 1N36F 5L1IA 2EG2A 2CKWA 5K8OA 1XMOJ 3FCVA 3KK3B 4DR1J 4QWBA 3H5SA 4LJMA 2XG8A 4I6AA 4RNMA 1JNZB 1S1XB 3KLFB 3M2VB 2DEIA 4BWMA 4LF2A 1VQ7S 1EARA 2IFXA 3P6YC 2KKHA 1CULA 4A8WA 1K1QA 3TJ9A 5M2UA 2APOA 4CLKA 4LF7F 3NGUA 2MZQA 2FHOB 4MK9A 3VAIA 2QMUB 3TP2A 3IRWP 2Q6CA 4DPXA 3FQKA 3UN5A 4DSIA 2CQ1A 4DG1A 1PILA 4Q0BB 1X0PA 3K59A 1TMMA 2CZVC 2G13A 2GS8A 4Z37A 2DK2A 3K57A 3PG9A 3MAQA 5F8JA 4F4YA 2CJQA 3MD3A 1U1NA 5J1EA 1JLEA 1IXKA 2K3KA 1N8RT 4K4VA 2B6AB 4OLPA 5ETQA 1F9EB 4K4TA 3H2LA 3OVBA 2AJ4A 3WX8A 3HSDA 4DCOB 2XGPA 1EJ7L 4JI6F 4I1TA 2HFSA 2KZMA 2ZUAA 3JSMB 4QWEA 1JLFB 2V9KA 2M2BA 1DARA 2B7BB 2HHVA 4LUBA 3POTA 2BQ3A 2B0GA 4J91A 4DV3J 4CLZA 5EX3A 2VQEJ 3D4JA 2YKQA 3LP2B 1AFIA 3M8YA 4G6VB 2MKCA 4K59A 2B9YA 1VHIA 2CQ3A 2DNPA 3MEDA 4F36A 2B51A 3QGIA 4C0BA 1XR5A 3P4UB 8ATCB 3V6DA 2JOQA 3HF5A 4KKOB 1RT3A 3HK2A 3DXSX 4K8RA 1C1BA 4M5MA 1Q7YT 3J7Z5 3R5AA 2V8PA 2UUCF 2JSXA 2BBEA 4ZVGA 4R5PA 3CCRS 3LPEA 4B9TA 2K3IA 1YBTA 1LW0B 4C8LA 1RT3B 1UVNA 3QWUA 5F8GA 1NPKA 1TKXB 2DPIA 1PYSB 5B09A 4CO1A 3D66A 4ID5B 3FUYA 1JJCB 5IV3A 4YQWA 2ZH7A 2AZ1A 2FHJD 3L7OA 1IBMF 1FRLA 1ZPWX 3M2RB 1RBLA 1SKUB 1AROP 3UWTA 7AT1B 3RB3A 1J5OA 5HROA 2VDHA 1KEKA 4HACB 1XNQF 1RWWB 4WXWA 1EQ0A 4JBCA 2M52A 3AJ1A 4YR2A 4DV5F 4C4WA 5D3GB 3MR3A 1S7HA 5F8LA 4DR3J 1FRJA 1QLNA 1SC6A 4X4TA 1NUEA 4M95A 4UOFA 3BDEA 3BSOA 2PDAA 1MN9A 1S6UA 3GSIA 4JI3F 1WHWA 3BEGB 3PIPQ 4O3SA 1IKYA 1AB8A 4EFAC 2HFVA 4I2QA 2ZBPA 2OKQA 4X4PA 1IWGA 4J9OA 1RKJA 4C8ZA 3M2UA 3SZ2A 4FN5A 3CD5A 1BHNA 4RW8B 4ZVQB 1T02A 4J9UE 2CPXA 1CS4A 1SQFA 2G0JA 3LAMA 1Q78A 3T6JA 4DDFA 2CQDA 1RISA 2IJRA 2N4DA 2W4PA 4RNFA 2E44A 4NI2A 1NK7A 4N76A 3Q8RB 4ECWA 1FESA 2BRKA 3V81B 1JXEA 4FKXA 5BYQA 3BJYA 3NAHA 4LSNA 1PBUA 1VLYA 3QGHA 4DUZJ 1U0HB 3K17A 3V6DB 1IBLJ 1KRPA 3TUPA 2GQCA 1SVDA 1Y3JA 3BREA 3JTNA 3NG8A 2F8HA 5H9EK 2GMJA 3DLGB 2EEYA 2J5AA 2KJWA 5A0YA 3HVRA 1M5OC 2JEJA 1FDDA 2ZBRA 4RO0A 2DNOA 1NSPA 3PFOA 3MUVP 5I42A 1XMQF 2YNGA 3GZ7A 3NAIA 3ZNJ1 3AHPA 3HHLB 3ZTPA 3EUNA 4DZDA 2B9WA 4H4KA 1X4FA 1J27A 3WX4A 3NNAA 2GQQA 2ZBQA 1KVJA 4ITSA 3V4IB 4B3SF 3K5MA 3RBXA 1R6VA 4B9UA 2AEMA 4PRFA 1YZ7A 4NLPA 4O0NA 3NCQA 3UCGA 4I67A 2RMLA 3QYYA 2RDJA 2HGNA 5CCMA 5D6GA 1URNA 3HVTB 3PJXA 5HQ8A 2IA0A 1Z1ZA 4PG6A 4RU2A 2DGOA 1N5TA 1B0PA 4ECXA 3MMCA 4OZJA 2CNNB 4NPOA 1DLOB 1RTHB 4MTPA 1NAQA 2FIUA 3ILOA 3QMQA 2R7VA 1BLUA 5C42A 2EK6A 4OZNA 3T5KA 2E5HA 2FVCA 2VZ9A 3QLHA 3SQGB 2F65A 3QRRA 5JMNA 2BR0A 1HW8A 4I69A 1NDKA 1YJNS 1G4CA 4DUYJ 3HHDA 2DY9A 3MM8A 2UUAF 4C8YA 4ES1A 2HHQA 2F9DA 4X4UA 3I56S 2BABA 4Z2XA 4LR8A 4KTQA 3VR1A 2NLWA 3UO0A 4NXMJ 1LW2B 1TKTB 1HBMB 3ZZOA 3BGRB 1P9YA 4RW9A 1YTYA 5KFMA 2HVDA 2VIHA 2E5LF 3MMJA 4KH0B 4XIUA 4JV5J 3HT0A 4CIOA 4DSEA 1JLFA 2GHPA 2OO4A 2FTRA 2MKSA 4OQJA 3OLBA 1KLNA 3BM7A 3D67A 3W65A 1NK8A 1N54B 2DY1A 1J5OB 1R8HA 1GX5A 4F67A 5A8KB 4HVZA 2RE1A 4O3QA 4ERDA 5I3PA 3OD2A 1OMSA 4G1QA 2EKNA 4OMFG 4USWA 3TUIC 2EKYA 5A8WA 3BKFA 1IKWA 1BQMB 3D9BA 3S1TA 1WI8A 3DI6A 4IG3A 1ZETA 2MHNA 2DNLA 1NNDA 1QJHA 3H98A 2HBQB 3TEHB 1U1OA 2G0IA 4K50A 2HNZB 1TUVA 4G1IA 2E1MC 4I2PA 4I7FA 2AMCB 4NX9A 4OX7A 2A6MA 1FF2A 3KLEB 2R2RA 1NKCA 3MOJB 2HGMA 1BUXA 5KFPA 3RW7A 1SC4B 1V6HA 1LK7A 2RNEA 1UCNA 1NZAA 2NXNA 1FNMA 4CH7A 2NZ4A 4JI8J 1CSJA 1RCOB 2V63A 4J9KA 1B7FA 2XMAA 3KLEA 5KG1A 3B4DA 3CWJA 1NJXA 1VQ9S 1MSWD 4OJHA 2VB6A 1JWWA 4YR0A 2FC8A 4NRTA 1U49A 1RWMB 2OPQA 1YBAA 3KKFA 4LR9A 1FCAA 2C3PA 4CTAA 3A3OB 1RK8A 3HHLD 1EZZB 1V3RA 4O44A 4FF4A 2BEFA 5LXYA 2MQQA 1DJ0A 3Q8SB 1ZAWA 2VJVA 3CVKA 2RQMA 2W7OA 4LIRA 3BYPA 4JI0J 1U2CA 1S4EA 3B54A 4OIXA 3HSZA 4CYUB 5GADI 4OI1A 3Q8UA 2IBOA 1U26A 1GMWD 3HHKA 3L4BC 3G82B 4B3MF 4Q0BA 4ES3A 1HBMA 3D6MB 2B9EA 1PSDA 3V6HA 2X1GA 1IBCB 4PWDA 1XK8A 1DURA 3KFWX 4DL2A 4EK2A 4ZCMA 2F4VF 3W66A 3G8TA 2V69A 5DETA 5CCLA 1QTMA 1AUSL 1HBNA 4TQSA 3HMJG 3IA0A 1NM2A 3WBZA 4X62J 1MU2B 3UDLA 3W5ZA 3PJ9A 4ECZA 4AYBD 1PAEX 1SV5B 4B17A 1XMQJ 2BANA 3CJ3A 3CCZA 2KT2A 3P96A 4DQQA 2UUAJ 4AE5A 3OT9A 4RLEA 4TY8B 1X31C 3GV5B 2CNLB 2VH7A 2LEAA 3TAMA 5B0BA 2IC3A 3H25A 1IKXA 1FKOB 4DF8A 2E29A 4FYYB 1M5VC 1H73A 2CRLA 1C0TA 1WC5A 2HPUA 2E5JA 2VHGA 1TMJA 4I64A 2OMOA 3HSGA 4WTYA 5F0WA 4CO2A 2MHEA 3FEYB 5KFCA 4I0WA 2F8MA 2NUHA 1U1RA 3DOKB 5IT4A 5HI7A 4QR2A 2R7QA 3LO3A 1BC6A 1KQKA 4DS5A 2CJAA 2ZNZA 1PJ7A 3BGOP 5HJXA 4O3RA 3ZZZA 1H98A 1R0BG 1KC8T 4WFXA 2QZ8A 3R5BA 3PO5A 2FGCA 3MM8B 1VQYA 2LA6A 1CJUB 4LFCF 1VDHA 2IDLA 5HN0A 1T9TA 3NRBA 4ZMMA 3KNAA 1IM6A 5B7WA 4X66F 1IVZA 2XZDB 5L9XA 3IRXA 3O2IA 2QLXA 2I5JB 4PEOA 1S5ZA 1Q81T 2XSJA 1GT8A 2XCAA 4IOBA 2H65B 3MEEA 3GB0A 5K5MA 2LVWA 1RKIA 5A2QY 1RTJA 4JI3J 1B64A 3ITHB 1S6QB 4UW2A 1YX2A 4LBPA 2ZH3A 4AL5A 4F02A 3RJMB 3KJFB 4ZVPB 5KFZA 2MXYA 3IM8A 1IJFB 1U2RA 2LXUA 4NASA 5FD1A 2W2NP 3PV8A 1HR0F 4IRKA 5CHCB 2YPYA 3JYTB 5IM0B 2IAJB 2E5IA 2KL8A 2BM0A 2D7SA 1J2VA 2PE8A 4JI5J 1SJ1A 1Q53A 1M1HA 2JWNA 3MDFA 3Q86A 5JJBA 4P72A 1M1GA 3RBEA 4RL1A 1IBMJ 2NUUG 2YBVA 4Y2KA 4PWUA 4ECUA 2EFQA 3B78A 3ITHA 5IFMA 3CEDA 1H38A 4PG8A 4N5SA 5AE2A 4WFBQ 3ZZPA 1CBKA 3QIPB 1Q8KA 2GW8A 3CIMA 4YDDB 1N4LA 2JHEA 4P71A 3OTCA 1RT5B 4L3NA 1N52B 5DRKA 4AT1B 4A8YA 3AOCA 3R27A 2JLEA 2C2DA 1DTQB 5CAAA 3GFZA 1H7WA 2LEBA 2YTCA 2FJDB 4Q8EA 2KDOA 2YWGA 4J7CA 5DS7A 4CTAB 5HMZA 4HI1A 1NJIT 3W2WB 1L3SA 1VRTA 1SUQB 4KHPJ 3Q8PB 3HXMA 3JQMA 4N77A 2W9CA 3KLGA 4C8OA 4DX5A 5L46A 4DV3F 1S79A 2XWYA 1XTZA 2FZGB 2YKPA 4Y28C 4LF9F 1WC4A 1C4AA 2FB0A 3THTA 2BJ3A 2DXFA 3AXMA 4FXVA 1FXLA 2XWXA 3M8WA 4DOZA 1HNWF 2D1CA 2UUBF 1UEKA 1LWFA 4B3RJ 2XY6A 4U67Q 2ATCB 2ASLA 2UXBJ 3TAMB 2AJFE 2ADCA 2NQPA 1U2FA 1K0TA 3E8OA 3E3XA 1AZSA 3BH6B 2F9JA 2WVBA 3G96A 1F2GA 5HVGA 2LYVA 2VDIA 2L9NA 4QJVA 3DI6B 1UTAA 1YK9A 4PR6A 5KG0A 4K4SA 3N9UC 4USUA 2ALZA 1RAGB 1R8BA 1OYEA 3FZBA 3J7AN 3U1MA 2BJ9A 3CDBA 2LU2A 4PPDA 1I51B 1WC3A 1S0NA 1HI0P 4LF8F 1FRXA 2NSCA 5I3QA 3WIUA 1YIJS 5D8HB 1JLBB 3M8ZA 2G1DA 4ZCIA 4ZLLA 2E1AA 3G82A 1VQ4S 3W7BA 4OI3A 4QIEA 3KLIA 5BJRA 3E01B 1N5QA 3TA2A 4B3TF 3SXLA 1SKRA 1LFWA 3EZUA 3L9ZA 5KG4A 1RDRA 1A0OB 2X3DA 3I0SA 4P74A 4S0MA 2OLWA 3V4IA 1N5YA 2JDJA 3VAJA 3FSXA 3KYLA 3KUGA 5H9FJ 4KAIA 4NXNF 5BXIA 4C9DA 1DQ9A 3BSAA 4BHQA 4QWAA 2QO3A 1RZMA 4HR2A 2IHR1 4FPRA 4ZPDA 2V34A 3DRPA 2PA3A 3CJKB 3HT3A 3KHGA 1RLDA 3A1YG 2GJ2A 3SV3A 1SJFA 3R7SB 3SQGA 4PXDA 2ZH1A 4EBEA 5GAGU 2CQHA 1SKSA 1ZZFA 1VYAA 2HNDB 3BH7B 3NWRA 3UD4P 3GYXB 4F2RA 5KG7A 1FO1A 3JQKA 5GVQA 3UN3A 3C66A 4R0EA 2QA1A 3JSYA 2RVJA 4W4MA 5F0UA 4JV0A 1U45A 2E9TA 3H8YA 3IN5A 4YOEA 2MJNA 3LQVA 4LSNB 3K5NA 4FXWA 4ZVHA 5IWAF 5F8NA 1FRMA 2FD2A 4M63A 1WOOA 2V8VA 3NLCA 4A8XA 3MEGA 1W26A 2YNIB 2XMJA 5CD4A 4PAAA 3AFGA 4A8FA 3A4TA 4OYPA 3CJSA 1ZM4A 4L72B 3W60A 1SBRA 4OHVA 3DHWC 3VTIA 4N41A 3MM6B 3RTVA 3QJJA 4G1QB 4Q5VA 2GCFA 4OJ1A
chains in the Genus database with same CATH topology
1YJ9S 1BQNB 4EZ6A 1XBWA 3GG0A 3HZGA 4MIBA 4OZ0A 5A8KA 2CYYA 2FLNA 1Z2ZA 1OO0B 2YNIA 2D41A 4KFBB 5HMYA 2OIHA 5E7OB 4F3MA 4UQGA 1MWZA 4HTIA 3NMRA 2HRYA 3ENVA 2DNQA 4AXJA 1U1LA 4AUKA 1DRZA 4GKKF 2R7OA 2J7UA 4TLRA 3RB6A 2WB1D 5GAHI 5CXTA 4PUOA 3M8QA 4ICLA 4CT8A 1XEZA 2LA4A 2P9CA 3CDAA 4KBIA 4N8NA 1TKZB 5GAHU 1WEXA 2ZH5A 4FYDA 4FVMA 3QLHB 1IR0A 1K0VA 1MMDA 3CD6S 2ZHBA 2EG1A 3ZZRA 2C42A 3DDKA 1S76D 2V5HG 3SSRA 2C3OA 5M2PA 3M2UB 3VAFA 4OV1A 3SDEB 4RUHA 3HVTA 3BS9A 1JLQA 1SH0A 4LSLA 5FLXY 2LQBA 5AXKA 1PC5A 1HPZB 2RQCA 3I0RA 3IBWA 1RQ0A 5EWEA 4K2XA 1FDBA 4PQUA 3N5BA 2KB2A 2CVEA 3OHAA 1DBDA 1R0AB 2LMIA 2QE5A 3QJPA 1VGYA 1TAUA 2GFFA 4R25A 2J6SA 2CJBA 2MKIA 1S9EB 2AGQA 2HNYA 1U8SA 3MGJA 2VC0A 3M6XA 2JJ4D 3PEHA 4NL5A 3LOUA 1JB0C 3HKZD 3DLGA 3WDOA 1DQ8A 2W9AA 2BE2A 4ZP8A 4P6QA 4MMOA 2MQPA 5EHHA 2VBXA 3H5XA 5KFKA 1ZZNA 3DRYA 4TN2A 5D4LA 4I56A 3BGUA 4HH0A 1QSLA 2ZE2B 5I3UA 2MY8A 4NLTA 3UNGC 3OL7A 1YJWS 2AX0A 2CJ9A 3T19A 4E98A 1LQ9A 4TXSA 3MM9B 3ZZTA 4JV1A 3UI3A 1SJRA 2CJKA 2ADBA 3CCVS 2MZTA 4O44B 3PO4A 4YUDA 3CDEA 2B4PA 3PX0A 4QIGA 3CC7S 1N56A 3C6UA 3OV7A 1YHQS 2VUGA 3MTKA 2R8HA 2MB0B 2C2RA 3PW0A 3MM9A 2QA4S 2KH9A 5CYJA 4CCHA 5KG3A 3TNVA 2A1BA 4FF3A 2ZD1B 2HMIB 4JI7F 4RU9A 5A6PA 3M6UA 3QAUA 4TLQA 3I5BA 3QWPA 4QCLA 3J7YI 1U1KA 3G71S 4H4KC 3EGZA 2HLUA 2ROPA 4KHPF 5KFGA 2CQCA 5KFRA 2A2CA 1OWXA 1HI1A 5T7LA 1M5PC 4O3PA 2KI2A 2RU9A 5E3PA 1SQEA 4KKOA 4X4QA 1G2EA 4AFFA 2VG6A 4NCGA 3D2WA 4JI1F 1TK8A 2GIRA 3RB4A 2ZUGA 4B3OA 1QSSA 2X1FA 2OMLA 1Y7PA 4RNNA 1D1UA 1AXQA 3O6QA 4F4ZA 5B0GA 3CT9A 2D3OR 1FKPB 3CMES 1JLQB 3K8VA 4TU9A 4QYRA 4RW9B 4PXCA 2Q66A 3J80Y 4WYLA 3I32A 1OPZA 2B6AA 4NLDA 1SKWA 2HVHA 4DL0C 4QIFA 2ZBCA 2DGTA 1S6PA 3CXCR 3G6ES 3LH2S 2KVIA 1S1WB 5BR8F 2OPRA 4LFBF 2HHTA 2V8HA 2GNKA 2PA8D 3G9CA 1RP5A 2I9SA 2PN6A 4RWWA 2B4VA 3MMCB 2UUTA 2KYXA 2RF2B 5J2MB 1GXTA 4U7UK 2MGZB 2MJUA 3MEGB 4D3HA 4NA1A 3OW2R 3CC4S 2IM1A 2FPHX 3RAQA 1R6YA 1P6TA 3RR7A 2HQ3A 2XLIA 2LECA 3N6LA 2R2SA 3RZAA 4MFBA 1VIOA 4O4GA 2R7XA 4NLYA 2Z2LA 5D4OA 3DYAB 4I4BA 1H2UX 7FD1A 4WE1A 3IAS9 1X4HA 5J2NA 2MSSA 2YNGB 5DGAA 1BQNA 3DU6A 3OTOF 1QSYA 1TR0A 4WF9Q 5HO4A 1VC0A 1R31A 3T1AA 4QZVB 1L3UA 1CQNA 5KFDA 1TL3A 1XC9A 4LT6A 4IO1A 3TQ1A 1VFJA 3D5MA 2LCWA 4NLWA 3B82A 1VQLS 4HT5A 1TK5A 1HNZF 2XCPA 4IDKA 5DLGA 2VD3A 4YB5A 4NA2A 3D1HA 2DT9A 2OP5A 1XR7A 3QIDA 3P49B 2JL9A 3QJLA 1R89A 4EZ9A 3R3TA 4ZLPA 4UY85 1IQTA 4Y34A 1U6BA 2PD1A 4J9LA 1X7VA 4DR3F 1FXDA 3CJKA 4U9RA 3B4MA 4DFMA 2XI2A 4KGMA 1P1LA 4C11B 4F25A 4NRUA 2JRSA 3AY0A 1QM9A 4BC7A 2QT7A 4ED5A 2ROEA 5IS2A 3BGRA 1HWJA 3FZ2A 3PACA 1N33F 1U6FA 2ZHOA 1S1VB 4E8UA 1XERA 4ETXA 1LXJA 1BWEA 4IG0B 3HM9A 2W8KA 1OS5A 1X8DA 3KG1A 4JUZA 5J1EB 3I9V9 4DL3A 2R7UA 1HWUA 2I8EA 2P9EA 3D0GE 4BC9A 2J8AA 2BRLA 2ZBIA 3DDNA 1WELA 1D8YA 5F3ZA 1TKZA 4OX9F 2R2TA 1S4FA 3LP1A 3CCUS 2Z2MA 1FEHA 2W4CA 2B43A 4FS1A 4M8LA 4ZPBA 5E3RA 3KLGB 2MZ1A 2DVIA 1UVKA 3ICLA 4HHJA 2JLGA 4RX6A 4ZPAA 3K2YA 5KFIA 4OLOA 2W9CB 2ZJQQ 2QV6A 4OI0A 2AW0A 4WU2A 3VQSA 2PC6A 3MM7A 4RW4B 3NCRA 1CC7A 3AAWB 1RT2A 1YJRA 1AFJA 2AGPA 4HLBA 3UR3C 3Q22A 3CULA 1NH8A 2WCXA 3THVA 4J9RA 1R0AA 1Y5LB 4ED1A 3EXYA 3ZC4A 4PKDB 3LP0A 4K5SA 4MK7A 1XMOF 3OL8A 5LJ3Y 2BZ2A 4ZK7M 1OQ6A 4Q7AA 4P2SA 2OD6A 3M8SA 1HNIA 3DYAA 5KFFA 2HHPA 2HFZA 5IZHA 5HP1B 2LQ9A 3MM5B 4DQRA 3NP5A 4DF4A 1UJ4A 1HBUB 1N48A 1UFLA 3TAPA 3BR9A 3BGLA 3GIMA 4Y2IA 3GV7B 2J6TA 2YWHA 4DQIA 3DOMA 3KK2A 3MEEB 4F4XA 2YX4A 3RW6A 1HWIA 2DNKA 3BQ1A 3G4SS 2DPJA 1F9FA 4LVOP 2M4MA 2KFYA 4F3OA 1ZTWA 1NK5A 2PGCA 5SZTA 3D0HE 2WOMA 2OFHX 3FFIA 1BD6A 1SJ3P 2JH3A 1UEUA 1H6KX 5M2RA 5C25A 5KFAA 1FJGF 3F56A 1FKPA 3M6WA 3TA1A 5E3CA 3RYLA 2VONA 4AL7A 1RJJA 3MMBA 4EUVA 4XO0A 1D3WA 2R8KA 3OTEA 4I68A 4X4RA 2FLLA 4C0HA 2UV8A 2VA3A 2AF6A 3HLUA 4HT7A 4X4VA 2VPWB 2IM0A 2DTJA 3Q2SC 4NCGB 5E0OA 2GX8A 3MMAB 4K4UA 4NLVA 2HIQA 5CZXA 4CH0S 3FDSA 1KONA 3OSPA 3OUYB 1QVGR 2QMXA 4CNZA 2XY5A 2KRBA 2M0GB 4XPEA 3PZPA 2EPIA 4X62F 3CCLS 1A6LA 4EYHB 1KLMB 2V2KA 3S01A 4K4ZA 3KLVA 3H2VE 2WBRA 1FTCA 2PIIA 2WK4A 2L9DA 3TVYA 1CLFA 1LWFB 4FS2A 2WRMA 1NJWA 4LMZA 2MMYA 3DLKB 3NCPA 5GADU 3THPA 1H7XA 4DFPA 3PM9A 3Q0AA 1SI9A 3MR5A 4NLOA 2JX2A 4YP3A 1VHFA 3OR2A 1SIWB 4O23A 2W8LA 2XULA 2P9GA 3DXBA 4FNIA 3N5FA 4P7VA 1VQPS 2DHAA 4KGKA 2QA2A 2VQFF 2FJBB 1T3NA 4IG3B 3CE8A 3MPWA 4L6V3 1J5EF 1TL1A 3PNIA 2AGOA 3HFKA 1TV6B 4IOAQ 3OPKA 2CPYA 2LXIA 3VF0B 3P3DA 2NPIA 2NR0A 2E66A 2XZWA 4ZP6A 3M9MB 4EYIB 1RWUA 2MYFA 4RW7B 4ZS6A 3DOLB 3HDSA 2IMWP 2HLTA 1GXLA 3WC2A 4DEZA 1U47A 4W92B 3FNNA 2CPDA 5T14A 2DB1A 2GV1A 3CJ4A 2J0WA 2XS2A 2YH1A 3HJFA 3ZZUA 4TNOA 4ZKAA 4QU6A 3SCJE 2XMUA 3DLEB 3OFEA 3TVZA 2UXDF 3I5CA 2YVSA 2FHMA 2O3DA 1VQKS 2XBPA 2N7CA 2RU3A 1RTHA 5B0DA 1DTQA 4WZQA 2YX1A 3OL9A 3I82A 3TO8A 5H9EJ 1SB6A 2K1RA 4Y2AA 3R1LA 1N6QB 1S1TA 3DM2A 4ELVA 2RRBA 4X64F 1D9FA 4ALZA 2OTJS 2D9PA 2EW9A 2ZE2A 1T03B 2I2YA 3C46A 1D9AA 4PG4A 3TRGA 1YI2S 2W25A 3KMQA 5A8RA 4AXIA 2YWFA 2UVUA 5IM0A 3FEZA 1VK3A 2RQKA 5EDWA 2B7CB 2BM1A 3OTDA 1LK5A 2V4JB 4IO9Q 1FKOA 5DJBA 3H4BA 4F3QA 2FJVA 1HYSB 5IQ6A 2W9BA 2HNYB 5KG2A 2R9LA 2AJ0A 2LLZA 3AH6A 2DR5A 2R7RA 2IA6A 2SXLA 2C22A 3PXGa 1NB7A 5EGYA 3LWLA 2DO0A 3MMAA 1M0SA 2CZ4A 2RSQA 2CFXA 3I4HX 2VBYA 5KAKA 3NL0A 3MTJA 1FVSA 3H2UB 3W2WA 2GHWA 1TL3B 2J9EA 3AJ2A 3GMGA 4NWBA 3K5OA 2Q79A 2I5JA 5LMNF 2XNQA 2J9DA 5I42B 3BR8A 4XDCA 3LPYA 3IC1A 1R8PA 2N82B 4ELTA 4LF6F 2PI4A 3BF4A 4URSA 3GYNA 1DFDA 1FVQA 1LKZA 2IC3B 3NGKA 1FE0A 2BACA 2MPUA 5KFQA 2CPZA 3VQTA 1RTIA 2UP1A 1VQSA 2CQ0A 2DCLA 4G3IA 4DPOA 4HKQA 2QYCA 4Q45A 2ZM6F 4QU7A 1Y0HA 2ACYA 3FGVA 2DIVA 1YRXA 3AB4B 3JYTA 3L09A 2JEFA 4ELUA 1NK9A 3GE9A 2IVYA 4NCBA 2MZJA 3PW4A 1N88A 1RTJB 2LDIA 3PIOQ 2HYIB 1FDNA 2HNZA 5DG7A 4I2QB 1XNRF 4B9SA 3CIZA 4OZ5A 4GMKA 4WFNQ 4MKAA 3CCES 1SJQA 2XO7A 1YWXA 2DIUA 2KXFA 2DH7A 5EN1A 1C1CB 4QWDA 3G8QA 3O3LA 2VPYB 4DMZA 2DR9A 1BY9A 2FVRA 1WD6A 3DRXA 3U02A 2DRBA 2MSTA 1JX4A 2FVPA 1TL5A 5EX0A 3ZFVA 5KFEA 4V19J 4CO3A 5AXNA 2WAQD 2VKRA 4NLUA 3SV4A 1JLBA 3I9ZA 4WK3A 4DS4A 3M2RA 1WNEA 4QYZJ 1C1CA 3SI8A 1M90T 5B0CA 5KTQA 1UETA 2IVMA 1TKXA 3M32B 1TVRB 2DO4A 2BV3A 2ATLA 4DR2F 3IR7B 3MPYA 4MAKA 4ECYA 3ISNC 2EWHA 1UEVA 1Y00A 3KG0A 3KHLA 3MZIA 1UJ6A 2BJEA 2D3ZA 3UQSA 1UVIA 4DQSA 3E01A 1NK4A 3S7RA 1KNZA 3I6PA 1FTRA 3X1LB 1S1TB 1N0VC 3PR4A 3IWXA 4IH5A 4GC7A 4OHYA 2BDPA 3MMBB 3OLAA 5KFJA 3MOZA 2JFDA 5ITHA 5KFHA 4IH6A 1VC5A 2Q43A 4ED8A 2AU0A 1SXLA 4ZPVR 5DQGA 1JLEB 1HFEL 2DBBA 2EK1A 3TANA 3BDPA 3RAXA 4C8MA 1C0UB 3TARA 3BSCA 2B56A 4A8OA 3CCTA 3IO1A 5K8NA 2R7SA 2A2DA 3CD0A 3EGNA 3VWSA 4B9MA 1TP7A 4WZMA 1E6YA 4O3OA 5IQQA 4IQMA 2YH0A 1R8AA 3QIPA 4ILRA 4NXMF 1T3OA 5AE1A 3KG4A 2DNNA 3OXGA 1M5SA 3UE2A 3OFFA 4KB7A 2VFSA 1DTTA 3TVKA 2NS1B 3GIKA 3GFHA 1RT1A 2KXHA 1FJEB 4JI5F 1X4BA 1S77D 3DMJA 1VRTB 3EYZA 4LFAF 1G6BA 2YY3A 2KFZA 3TAQA 2ZFHA 1FEEA 2AV5A 2FJWA 1UVJA 4FBUA 1EETB 4KV8A 1TL4A 5DM7Q 2K7KA 1RT5A 3IS9A 2Y1JA 1SH3A 2HS4A 2AD9A 2KG0A 1HQEB 1SL0A 5L1KA 3CPWR 3PRDA 3GR0A 2RT3A 3KJVB 1QUVA 4IFVB 3CD7A 1JIHA 2DNMA 2OAUA 4DSJA 2Z8QA 2VC1A 3DLKA 4F4WA 1RYSA 4M94A 2ZHAA 4I6WA 5HMWA 2VOOA 4IYQA 1NHUA 1K1SA 1GQEA 1VC6A 1H0HB 1RT7B 4DV1F 2XS5A 1S9GB 4OHZA 3K5LA 2WONA 1LXNA 2VG7B 2LXFA 4Y00A 4C3MA 4D3GA 1X0FA 4ECSA 3OFHA 3TYTA 1R8CA 3R5CA 5CQGA 3S8SA 5CH7B 4Q2LA 4GKJF 3DHXA 3I55S 5KFVA 1IBLF 2IM2A 2ZH9A 4WJBA 3KMSA 1X4CA 4EGLA 2AJ1A 2B4UA 4EWTA 5DG9A 1C1BB 2DNRA 3SFGA 2BVZA 5KOWA 2OPPB 1VJWA 4OHWA 2POKA 4OX8A 1HNIB 4YB6A 5HP1A 1S99A 4YY3F 2IBKA 4FF1A 2F7VA 1N6QA 5K8PA 3FVYA 3VAKA 4WFYA 1X9SA 2K7JA 1Q8LA 1DAXA 2Q6BA 3CJ0A 2KZZA 2D74B 2JC1A 1VQ8S 3J7A1 5HROB 2CQ2A 3DLBA 5D78A 1HMVA 4K5RA 4URGA 2E7XA 4DV2F 3CDUA 2V8DA 2XSFA 3ENQA 1QVFR 1KS2A 2E5GA 1PGZA 1KQFB 5LJ5Y 1K73T 2DR8A 2GA7A 2Q1LA 1VQ6S 1KHWA 2ZNYA 5D77A 5D3GA 4WIIA 2M3DA 3MXHP 2CPHA 2DNZA 2JVRA 1MU2A 4JOUA 2OPQB 3CJ5A 3AQOA 4AQYF 3UCZP 3V6DA 1M5HA 1RT1B 1VI7A 1SIZA 2U2FA 4RUAA 3G6YA 1UA0A 3I96A 1V3ZA 1VS3A 5G4DA 1TAQA 3V6KA 4ECTA 5HBMA 1RA6A 2CQ4A 1V3SA 2IRYA 3TR5A 3M05A 4JI8F 1ELOA 2RD5C 2AJQA 3OVSA 2IYGA 3LGMA 2WSCC 1S0OA 3VALA 1OSDA 2DGXA 5KOXA 1YRUA 2WHOA