2LW3A

Solution structure of the soluble domain of mmps4 from mycobacterium tuberculosis
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
90
structure length
90
Chain Sequence
MHLTYEIFGPPGTVADISYFDVNSEPQRVDGAVLPWSLHITTNDAAVMGNIVAQGNSDSIGCRITVDGKVRAERVSNEVNAYTYCLVKSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a Siderophore Export System Essential for Virulence of Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Membrane protein
molecule keywords Putative membrane protein mmpS4
total genus 1
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2012-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2lw3A00
2LW3A
chains in the Genus database with same CATH superfamily
1CS6A 1D9KD 2CJSA 2MMXA 1MOEA 4X98B 4OGQC 3VGDA 4ZMWA 4J3OH 3S6CA 2AP2A 4F7CA 5E70A 2FWLB 1HHGB 2B59B 2QSQA 4PV9B 3FQWB 4AXWB 3RU8L 4AH2A 4P2QE 1BMGA 2VRQA 4X6DA 3KYNA 3A6BL 1EEUA 2AK1L 2H0JA 2O5ZH 3VH8B 4XMZA 1A22B 1GJWA 4XB7A 3MV9A 5H37H 5DQDL 2C9RA 1DEDA 4NO2A 2EVIA 3FCGA 2CO3A 3PV6B 3TNNB 4WSKA 3GSRA 1QX1A 1EGJA 4DPCX 4WW2B 1DFBH 1EFXD 1JAEA 3LY6A 1H5BC 1EUUA 5D71H 4FZ8L 1IM3A 4AQEA 3GBMH 1HXMA 4X5WA 2CHXA 3HN8A 2K6ZA 3NEXA 1Q9OB 3IFPA 5JPNC 4JO8A 1GZQB 3U30C 4BWWA 2MWCA 4NO5B 5I28A 2CIIA 3E6FA 3U9WA 5FEBA 2E75C 5C0EB 5DHDA 5IHWA 1X9RA 2ZYIA 1IIIA 1WC7B 4M1DH 1LLAA 1M1SA 1SY6H 1TJMA 2VO5A 3DJ9A 3HNSL 1AR2A 4LSQL 2ATKB 4UV7H 2X6MA 2AK4A 5G5DB 3VWJD 3SCMC 4CVXA 4Y5XB 1USZA 2WXGA 4JFEE 3OKLB 3P77B 1FH2A 2CE6A 3WTTA 2BWDA 3QNZA 2VH5L 4WI0A 3BVDB 2X2YA 4R4BA 3VXSB 1Z0MA 3KBPA 3EOTL 2AMGA 1MLCA 1AY1H 3BZ4B 4L23A 3EO9H 1MCDA 4QTIH 3PL6B 3II1A 4Z7VE 3NCYP 4TUOB 1WUZA 3LN4B 4JX0A 4X9YA 3GINA 3L95B 3T3MB 1INEH 2COQA 2DIAA 3PNWA 3REWA 3LN9A 3U6XS 3BKMH 2CM5A 4J1UB 4ZW3A 1RJLA 2K6YA 1XGRA 3TYGH 4M7LH 5D7IE 5I0WA 1UZ6F 4L8SB 4M8QB 2QQNL 2NY2D 2YR3A 1NGZA 3D34A 3FTXA 4HWUA 4QNPF 2V5TA 1I8UA 3BUIA 5F7EL 4C83B 2O72A 4XN4A 1N9PA 4ZOBA 1TQVA 3QIWA 5DMIH 3HZKA 35C8H 3OJDA 2A4ZA 1J9CT 5F1NA 1MLBA 1NKOA 3AREB 2PWHA 4LGPB 4ONGH 5C0CB 1JN6A 4B97A 1QMUA 4FQQA 4NWTH 1S7UA 2OQJA 3EO0A 2V7HA 1HL9A 3TBVB 4LP8A 1AQKH 1DBAL 1ZTXE 2F58L 1R3KB 4EUPG 5BV7C 1FGNH 5FUOH 5KANI 5A7BA 1P4LB 3OAYH 4G9FB 4N1EA 2CUHA 3C60A 2LTQB 1Z5YD 3IMUA 4H26B 4G83A 1EEYA 2E56A 1JMZA 1B90A 1PFCA 2BZDA 2JLPA 2V3FA 4HHGA 1FVEA 5DHYA 4BFNA 1IC0A 2CDGA 4K23H 5AOMA 5CWSA 1A4KA 5ADPL 1P7KB 4P57B 2R0LH 1S7UB 1JWMB 3MV9E 1ZY9A 3ZE1B 5F3BA 5HVHC 4XPFH 4XOEA 4ODXA 3VXTA 4TMPA 3D52A 5FECB 3UTTD 2F1BA 3OBAA 4HEMA 5HP5A 4LOUD 4ORGB 4LPYA 4S1SH 4DP7X 3NZ8A 3I2CH 2ZICA 5M95B 1KCKA 5AVZB 1I3GH 3LKNB 2HT4C 3VD7A 3D3VA 4MCYA 4MD5B 5CO1A 5E99L 1F6LL 2A9CA 5JO5B 3GRWL 4Y8DC 3BH8B 4DEPB 5JW4Q 1W2KT 4G8GA 2A77L 1T6VN 4K8RH 2PW1A 4DKFL 4OIIL 3C60D 3ASOB 2UUDK 1N3NB 4JUTA 2NNAA 4Y4FC 2B0SH 5BVJB 5AEAA 1WD8A 4ACPA 2AK4E 4G5AA 5IQMA 5D1XC 4QTFA 1UXSA 4KNTA 4ZAKA 3ZQWA 2QGBA 1SM3L 4NFBA 5EUKB 1GXEA 4I18C 1SEBB 4HQQL 4OV5A 1DQQA 4BSJA 4GIPD 4BKLA 2ENSA 2OCCB 2F7IA 3RVVC 4NHUB 4I3RL 3LIUA 4M4RB 5DFVC 1X5JA 2XG5A 3K2IA 3BRGC 3BEWA 3ULVF 3TEWA 4E9TA 3H4HA 2XQ0A 2I9TB 3D05A 4PJHE 3X12A 4FX5A 2GI0A 2HKAA 2R7EA 2X88A 2BRRH 2WLZA 4J3OC 3N5AA 4N90E 5DUBB 2EUXA 4QHLA 3IE9A 4H26A 1XGQA 3BKYH 3L2LA 2IH8A 3WN5C 3PGCA 2HT2C 4MQSB 5C6TL 1IE4A 1WUNT 2XG5B 5IVXA 2EJ1A 4J6IA 5I1IL 5IEHA 1F4WL 2JJUA 4HU2A 5FUCC 3WGVB 2VDQH 4IS6A 3I9AA 3LPOA 5C6PB 4N2BA 5FHBH 3DIVA 1D6VH 3L5WB 5AOZA 4NWUL 3GBEA 3E6HB 5E1HB 1PZAA 4LVNC 4NGHL 5DRZA 4OZHF 5F72S 3RUGF 3WIFA 3P3UA 3LV3B 2PR4L 3ZGHA 4KJWC 4YO0A 1L0PA 2WK2A 5ISZB 4C4BA 1AXTH 5I0ZA 3TV8A 4PBWD 1IX2A 1S7XB 1KFAH 5JO5A 1MJUH 3HN5A 4OGYL 5I6NA 2KZBA 3BP5A 2C1PA 4EJ1C 3D3VB 4MD5A 4MCYB 9PCYA 1F13A 1BF2A 5A3ID 4AQ1B 3AJ7A 1NINA 2YUVA 4GXVL 5LAXB 3RURA 3RI5F 3QA3B 2VLKB 1E6JH 4I2XA 1LEIA 4WI0B 2X87A 3VXNA 4MAYA 2J4WL 4LL9A 3TT1H 1CICD 1OGAB 3FU7B 1MUJA 2VUYA 3O9WA 4NRXB 4QTHA 3T0AA 4OZGF 2IH1A 4L4JA 1GYUA 3P0VH 2G75B 2ADJA 4UIMA 5DJAB 4Q6KA 5A16A 1BFVL 4URTB 5C2BL 5GZOD 3KGUA 3VFTB 2J88H 3N3EA 4KPHH 1JV2B 1CC3A 1JRHH 4HUXA 5FC9A 3OLGA 3Q8EA 4LU5L 4G1MA 2WCGA 4AW4A 3DX9A 3QRGH 4RAVA 3C6LB 5I1IH 4FQQB 3BIKA 2FD6L 3QI9A 3PU7A 1MLBB 3TYGL 4LXFA 4NXSA 5BS0D 1QNZL 1P4IH 1TTBA 1I3UA 2VLLA 3T4AC 5KTEH 1IAIM 1JCVA 4TNWK 3JXAA 4ABUA 5ANMA 1K5NB 2ZP8A 3IGKA 4DF9A 2ZOUA 1BMZA 4KK5C 2QDWA 1Q38A 3MFGB 3HZVA 1I75A 5EA0H 2G3ZA 3GSNA 3VXMB 1JTPA 1YEFH 4RGNE 5BXFA 3NCJH 5HGDA 1UQSB 3HC3L 3CX5K 4DP8X 3MOAL 3BSZH 2WC7A 2BO0A 4Z77B 3CK0H 3QS3A 1NFAA 2AQSA 3EGSB 4TQHA 4ALAL 5E2UH 2V2TA 2JQAA 3PIQA 1MELA 2B5IB 3SYAA 4FG4A 2XC8A 4YGAB 2EDXA 1BOYA 4XVSL 1N6UA 3SKMA 4YJZL 1RU9H 2YGPA 1NDMB 3FQRA 3N04A 5DRWB 1KEMH 1CYXA 1QASA 2FEEL 4HXBH 4K5PA 2PCPB 1OM9A 3GQFA 1OSEA 4ECNA 4CVXB 5H35A 4XCCH 4F15C 1E5AA 4MMZB 2QTEA 3ATBA 4GI6A 4UIKL 3VGBA 4LT7A 4MNQE 2VCOA 2Q7NA 4XP1L 3PABB 1Q9KA 1VCBC 4AMKH 2YRZA 4FRWA 5IMKB 3LPPA 1EZLA 2DM2A 4ZO7A 1NWOA 2VT0A 5FYKL 1A6UH 1SQMA 5I8EB 1IM9A 2Q8BL 3BAIA 4WTXA 3RFRA 5M94B 3T2QA 4MQ7A 1M7XA 2P47B 1G0XA 4CC4A 2Z8VC 2JK5A 4L5FL 5IOPA 4LEXH 4HPYH 1I1AB 1RZ8A 4RGMC 4HP5A 4QXUH 1A9BA 2CD0A 5ANMB 4OGYH 1D5BA 5I74B 1KFAL 4EN2A 4DH2A 1OE1A 1NDGB 3L17A 1RI8A 1U91B 5EBMA 3K4DA 1U58A 5E94B 4HLEA 5ISZE 4IIQB 4FFTA 4ONGL 2YOCA 5IFAH 4XNUL 3TFBA 4KUZH 1RHHA 5BCAA 4HUWA 5TQ2L 2YD6A 1FPTL 4AM0A 3VFRA 2VN5A 1OSZA 5CILH 5I0XA 4K9JA 1NMAH 1Z7JA 2CALA 3BLBA 3GI8H 4W9FC 5IESL 2WN3A 3S5ZA 1U36A 3MLSL 3FPYA 2HYMA 4TNEA 5I82A 3BKML 3TU6A 1N0LA 3NJFA 4MZ3A 4WFHD 5E8NB 4UAOC 1CFVH 4XB8A 5DVKA 3IU4H 2RCSL 3L4TA 2FEJA 2DMGA 4WY7H 4ZAKC 5D1XA 1SJEA 3BE1H 3EJJX 4JPWL 5B1JA 1KXTA 3TF7C 2WYHA 1T83A 3HOGA 5DUBA 4UILH 3R4RA 1ET7A 5DO2D 3CVHL 3DMMC 4TUJB 3GIVB 4ZFZA 4HKXA 1NC4D 4ERSL 3ZE0F 1N64H 4X4YA 2W60A 1AI1H 1HVXA 4H5SA 4Q7DA 3TESA 2OM5A 3QH3B 4Z7WA 1XSOA 4K0OA 3S97C 3LRKA 3SCMB 1C5BL 2ZYSA 1H15A 2EDKA 4HGMA 3TM6A 3UTPD 2VR5A 1GGBH 1RUPH 2X2UA 5GGSB 2WBJC 1RUPL 3B2DC 1O6SB 3B9KB 2QMJA 4ZSOB 1BM3H 3IMVA 3TEYA 5F1SA 2JKXA 4BH7A 3CJJA 3D69B 1FE8L 4YHZL 1R9FA 4U1JA 4LOEA 1YNLH 3CHSA 1MAKA 2XACC 5ESQA 1HX0A 5J3HD 4G82A 4Q9RH 1UM4H 1MXDA 2A77H 4JCWA 2P42B 4DKFH 3W37A 4Y2LA 1NLBL 4R7LA 1J8RA 3OPUA 5HHQA 4L8DA 1DLHB 3F7LA 5ICUA 1EHNA 2VDRL 3KYMB 1KGJA 4J28A 1NIAA 3O2WH 2V17H 5HTSA 3MR9A 5B7MA 5F7HA 3EDFA 3FUMA 2AV7A 5H2BB 3VD9A 2Q1EA 5FECA 4NNPL 4ZS7L 1I1CA 1MF2L 3ZT7A 4ZW5A 2L8AA 4ZT1A 4TRPH 1ZVSB 2FEEI 4PTUB 4QNPE 1OARL 2VDNL 3O6KH 3FU6A 4FQ2L 3IM1A 4L8BB 2HJFB 4PJAB 3LVEA 2LU5A 1P84J 1J1OL 2QQKL 1UM4L 1OP5K 1NPJA 2OMXB 4DERA 3BUQA 3QC5X 4KROB 2XWRA 4G9FA 5C71A 2GTZA 2P5EE 1IFHH 2X6VA 3L3JA 3VQ2C 5JHLA 3OSKA 1GTNA 3NZUA 4TSAL 2UZYA 1ILUA 5L2KD 1HL8A 4J4PC 4YQXL 2YD9A 3H9SD 3Q6GL 3UP6A 5FF6B 4PRIB 2JV6A 2HX9A 5HHNB 1KB5H 1EZVY 5IBLC 3BUBA 3LKOA 1I7ZA 2BVEA 4HXAH 2VW6A 3FSVA 3FUHA 1WFNA 1NMCC 4PJXB 3T4YB 3NZ8B 4PGJA 1A6WH 4XP1H 4L18A 4D0BB 5IT2H 4TSCL 4IKNA 2H8PB 3BUTA 4TLUA 1JWUB 3EJTA 2AXFB 3HCVB 2GTQA 2WN2A 4HPOH 4R3SB 4HOMA 2SEBB 4NHCH 4CMHB 3WN5B 3CFKA 4Y4HD 2ZKXA 2ZWYA 5MEOA 4U49A 1JE6A 4YFLI 3RE0A 5SWSB 1KULA 2Z93A 4PTTB 4U1MB 1E7VA 1M71B 2F19L 4PY8J 3L9BA 4F8LA 5IMOA 3TVMC 4YX2L 5TFSL 3JTTA 5KEZA 3B4NA 3VU2A 3BO8A 4XBGA 4XX5A 2DKUA 4P2RB 2XLLA 3KCPB 2F8XC 5KSAC 1ASQA 1YLBB 2VM3A 4E9XA 5IW1A 3RL2A 4N2LA 5DJ2A 2FHBA 4R9HA 4TPRH 4XCFL 3S37L 2Q6WA 2WINA 2YC1B 2HMIC 4R7XA 3E2HC 1U93B 5LGJB 2D3VA 3NSDA 4HKJA 3BSHA 4FDWA 2X6UA 1AO7E 3ILDA 3QJHB 2FNWA 3MRCB 5J5EA 4FQCH 3EYOB 3MLWL 4N8UA 5JZ7C 2AJVH 3ARVA 2MOVA 2O1AA 5CFHA 2D7TL 4V1DE 1RPQA 4OVVA 1M2VB 3IDIA 4QYOA 1YVLA 4X8JA 3V4UL 2ZUXA 3PS6A 4D7BA 4XMTA 2AXGA 2Z31D 3T08A 3NIFE 4C47A 1UWXK 3QFJA 4HXBL 2VR4A 3C08L 5F88A 3B9KA 3GTNA 3U46B 5BZWB 5IKCA 3CHOA 2L04A 4G9FE 3SPVA 3EYFB 4PGZA 4P4RA 3WHXA 5DQ9B 1BAFL 4IOIA 5IUCA 3PCYA 5F7UA 2QVFB 5KYYB 1YC8A 5FGBC 4J6RH 3TH4T 1URLA 4AJWA 2X4RB 5EFIA 2BY2A 4AG4H 4KH2A 3NCYS 3RWFB 3FF8A 2FJUB 2RFXA 5DZNA 1ZT7B 2GSGB 4PJ8D 1ORQA 3D85A 2HTKC 4XBPB 4PP1C 2XWBA 4XTRC 4XCYB 5ADOL 1GGCH 1XSIA 3F7KA 4PJ8A 3DLQR 4N9OB 1F11B 1CGWA 1H5BB 1HFUA 5I1CH 2WZ6A 1T7YA 4D0CB 4ZG1A 3NABL 5H94B 2G5BA 2ZXWB 1BJ8A 2AABH 3BJ91 3FB7A 2WHVA 3UIYA 4Y8AA 4KVNH 5IOKA 3HG1D 2O5NA 4WF7A 1QQDA 1JXKA 3SDCD 4PRHB 3WMSA 4ODUB 2F1EA 3QXAA 2ZJSH 4U6VH 4AM0B 3O4OB 4K5LA 3CSYA 3WNPA 1DJXA 1EDQA 1A64A 1NOAA 4FQXC 1W8OA 3BVXA 2EZ0D 1X9UA 1IT9H 1J1PL 1GJUA 3QPKA 7FABL 3I84A 2OK0H 1F1GA 1KB5A 2W95A 3GXTA 3GDCA 3ELAT 5D2LE 3P11H 1N18A 3MQIA 3QBTB 3MRDB 4B95C 3FT3B 1ERNA 3TO2A 1BFTA 3WEBA 4H0LC 3FOLA 1N70A 2H4EA 1U4FA 2J4WH 1URZA 2YMTA 4ZUVA 3CDYA 4G71B 4LEBA 4XN9A 3DOIA 3E38A 1H0DB 2MH4A 3VRLF 4CAGA 4DW2L 4UOZA 5JW4R 1BF8A 4NUJA 1KLFA 4U0QB 2FUTA 3FQ1A 1X7QA 3D87B 2B4CL 2J12B 3ULAB 5C0IA 2AGJL 3ULUD 3H2QA 1MRFL 1BPLB 4YBLC 1H8LA 4LFHG 4R0LA 2X4RA 3DMMD 3LQMA 5EFIB 5JHBA 4LCYB 3TEZA 3X3GL 5D7JB 1JPGB 1ZT7A 3SDDD 4LVHB 1NC2A 4LEEA 5FFGA 4KKZA 2ARJB 5C07E 5DLMH 1O7VA 5LAXA 4GRWH 4YN3A 3OKNA 4P2RD 1XH3B 5HPOA 4W6WB 3NIDF 5JNYB 5MEND 4NQXA 2YRPA 5HJDA 1G6RA 5CN3A 3WN6A 3RPIB 4I3SL 5KYWB 1AGCB 3V6BR 5IW6A 1G7HB 1PZ2A 5EU5B 3TV3L 3X1GA 3LPFA 1B4RA 1IILE 1WBZA 5E00B 1KIUB 3DK2A 2OZ4A 2DJ4A 1YUHA 4PJHB 3HE7C 2K3TA 1MRFH 1TQCB 2NX5D 3NP3A 4O58H 1FVDA 4NQCA 5AQ0A 2YAMA 4IS6B 5I74C 1R19A 3GTVA 4OD3L 4JFTA 5IVZA 3OJ2C 2X28A 5AW1B 1FN4B 2HKFH 5J12B 4OVUA 2DV6A 1FZOB 3GSUA 1JTOA 4WAFA 2NY5C 4TLSA 5GGSY 2XBDA 3MBEC 3SDCC 1G7MA 2E7LA 2ITEA 3PF2A 5KYUA 2BP0B 1E27B 5K9OA 3QUYB 2B15A 1UD8A 2VIRB 3LKRA 1AD9B 4GW5B 1R24A 3UXFA 4YFEA 3R19A 3DX1A 5AZEH 2MNUA 3C2AH 2XG4A 2OXHB 3L3JB 4U3CA 3MV7B 5DJCA 4K94H 1YEKL 4IW4C 1M7DB 4UILL 4P46A 4NJ9L 4ZPVB 5IJCC 2BSRB 4ZJ9A 4DP9X 4OV6F 5DYOA 4S0HA 4WV1B 3U1QA 2NY1B 4P23A 1RVFH 4UQIM 4ENED 5FW6A 3RIAK 3O8XC 2WWMD 3DXAA 2B3IA 5HSFA 1F45A 3S34H 5AVUB 2FIKB 4LLAA 5DRNA 1KJ2A 4E42A 1WS7A 3BHBA 3Q01A 4QRRE 3TCLB 1AGBB 2GAZA 5IESH 3BUPA 1AKPA 5IUSA 1LGVA 1RIHH 1OAKH 2BY1A 2GJZA 3MLTA 4ZPTB 5EBWA 2GBVA 4PYGA 2H8PA 3RB5A 3SBPA 4IKIA 2XCMC 3QEQB 4P2OA 5FWQA 5CEZD 4N9GB 3BP5B 3QUHA 1DQIA 2XA8H 2YD3A 3H4FA 3LKSA 5IR1B 5G4OA 4FEIA 2YMXH 1DEEB 1B3IA 1KJ2B 3LXBA 2AANA 4E42B 1BAFH 3N0AA 4IRJB 2E74C 4MA8H 2D9CA 2Q3XA 4L8CB 3VX0A 3WG7B 3BAEH 3C08H 3D39E 2DQEL 4ZI8A 1DBKH 1AGDB 4CVZB 2F5AH 3CN1A 3G5ZB 4YMPA 5J06A 1CF8L 1XF5A 1KV7A 1SY6A 5ERWA 4BZ1L 3GO1L 5IF0A 4PIRF 1G7LB 1HINL 2V9UA 3GMQA 3OQ3B 5KN5B 2KZWA 1OTUD 2YC1A 2CLRB 5LCVA 2Q6WB 4HUMB 3EO0B 3KNBB 1HXKA 1UWEL 3WD5L 4ZYKA 3KLAB 1UUNA 1HKLL 3SPJA 5T3XD 4ADGA 1UHVA 3H7BA 3IFNL 4G11A 5FO2A 1HILA 2EH8L 3HFFA 3OR6A 2B3RA 4KTYA 4CUCA 4ZMYA 4PTUA 3TN0D 5FHAL 1U8QA 4P9HC 5T1LD 3N43F 3TZVA 5TTRA 1YEEL 2YZ1A 4PUBH 3RTLA 4YDLC 5E4EC 3GPSA 1V5JA 3DPBA 4YLQT 3UTSE 3GGWB 3QYCA 5F3FA 2R2BB 3TASA 2Q0ZX 4I7ZC 4X6CF 3WTSA 1RURH 1RK0A 4YAQB 2SEBA 5LAPA 4HPHA 2R69H 3EH5B 4FMKA 4PI0A 4YDIL 2QSVA 1EHAA 1E0OB 5EIIB 1DBJH 4XNZB 2HVKB 3D2UB 1YMMB 2HUHA 2AJUL 1E3FA 2D7QA 3W1ZA 4FQPA 4YZWA 2EUZA 4OF7A 1KCSL 1XFPA 4PCTA 2WXPA 3VSTA 4Z7UB 3V0WL 4JFYA 1LQSR 4JPSA 2DWTA 2R69A 5LBGA 5EU3A 1SJXA 3MCKB 2Z31B 2GC4C 1G7IA 5GGTL 3QR0A 2WLKA 5GISL 2V5MA 4GB9A 3MJ6A 3U1PA 1KXHA 1CK0L 2Q7AA 2Z9TA 3ET9F 1GOHA 5GRUH 1HE7A 5CKAA 2NT1A 4L37A 1FFQA 2DIBA 3K1DA 3P3RA 4OR1A 5HHOB 1C12A 3TIEA 3FZUD 3NCWA 4GEJA 2CHZA 4M3JA 1CDYA 1BEYL 2X3BA 4GKNB 3KEHA 4QRRA 3VWKD 4XE0A 1YECL 2EVFA 1DVZA 5B38G 3BAXA 4YXLL 3DX7A 4KVNL 1D2PA 3QUXB 2X3CA 4R5XA 5GIRA 5MEPB 1QW9A 4MNGE 3BKCL 4DOHB 5E8NA 4KKCC 5KAQG 1YNKL 3MRGA 1PLCA 1K9TA 1J0ZA 4HHWA 5A2BA 5T1MB 5CZXC 1JN6B 3FBKA 2ZWNA 5D4HA 1G7MB 3J2PA 3QIBA 5DZJA 1B0GB 2J25A 5KZCD 4G3YH 3L3OA 3DROB 4UINL 1REIA 5JUEH 4BFFA 2NCMA 3T0XA 3KD4A 1VHPA 3T5WA 4AG4L 4OKVB 5I6XC 1A7OL 2EKSB 9CGTA 1YEGH 3N55A 4WFGE 3FU0A 4MJIE 4B9KC 3PL6C 5IJDC 3UO8B 1IBGH 3O3BA 2XTJB 4ZUWA 3BUYA 3PL6A 5F97E 4QRFA 1EO8H 3LYRA 4UTCA 1YN6A 3D5OF 4MBRA 3R06A 5CU5A 5SX5H 4ZW8A 2DWDA 2GFBA 2ZIDA 2PLTA 5CZVL 4OFYD 4DQAA 1IGJB 1JI2A 2JTYA 3FBQA 1W0VB 4ZDHB 3DSFL 1IQWH 3U36B 1MFEH 4OJAA 4DGWC 3OKLA 2KLSA 4RVBA 1AJ7L 1T6BX 3SKNA 4BHUI 5I24A 4KJPD 1E30A 2BS9A 2VXQH 2R0ZH 3QQ3A 2ED7A 2UV3A 2F7OA 5KBLA 5CGBA 2E6QA 1F4HA 3LKQB 3WI9A 5J6GB 1FYTB 1YJDL 4AIEA 4ELMA 2EQDA 5I1CL 5KBDA 2J44A 2DQTL 2WLIB 3VG0L 1OM3H 4Z7UF 3KPRD 2DIJA 4WTWA 4EI5C 1IM3B 3D07A 4KXZH 5FV1L 3NGBB 2DLFH 4ZTPL 3QUZD 3INUL 1R1CA 1OSZB 3K4AA 1R0AL 3AXLA 3VNZA 3C8DA 3P4OB 4YSTA 3SPIA 5K1VA 3B3IB 4ZFOA 1U30A 1CL7H 1AOZA 4JO3L 4S1RH 1PY4A 4OIFA 5CJXA 5BXFB 3INOA 2GY7B 1A21A 4OLVL 3IJYA 4OZGB 2GIYA 2H5UA 3JWDL 4Z9KB 5L7XH 4R26L 3ZL4L 2MQ0A 4OI9A 2UXTA 4AIZA 2NNFA 2D4FA 2VZVA 2E6PA 5DRZB 3V4VL 3UJTL 3NJXA 4JRXD 1NFDB 3PWPB 4MNGA 5JIHA 3ZKXC 3DTXA 3MRIA 1JI1A 5ENWB 1YEHH 5EU4A 1TF4A 3CIQA 4KOCA 4AL8H 2CKBA 5D2LF 3RX8A 2K7PA 2UY6A 3L9EA 4LCUB 4YHLH 1AZUA 4OIBA 4NB7A 5LWYL 1OGPA 3C9NB 4MDIB 4N0YL 1NEZA 4JLRB 1ORSA 1HINH 4U6HA 3L4ZA 3MYJB 4JRLA 5JORB 1IEAA 2CKBH 2VE6A 3N91A 4PJ5E 5ILTL 3SOTA 3BQUB 2I9TA 3FO0H 3I74A 2O5YL 3B9VA 4IRZL 1OPOA 1QLEB 1Z0NA 4NO0A 1AG6A 4RBPK 2A6IB 5AL0A 5GRXG 3TPUB 4OZHE 2IV8A 5FV2A 2XV2A 1ZA3A 1KTDB 3F7VA 4J8QA 1KMGA 1F4XL 3D25B 1G7PB 1KGCE 4GAFB 3BSZA 4FGMA 4JDTH 1IKFL 4J3OD 3SYQA 4BINA 1RUMH 1CG9B 1BBDH 1WT5C 3EHBB 5AVVB 5DFAA 2VZOA 3VH8G 3TBWB 2N7BA 2GBTA 1P5VA 3T71A 1JPSH 3MNZB 1BEXA 3LZLA 3GBNH 3MHZA 5JPMC 4JL1A 3S3SA 4PJAF 3C2SA 3PDGA 4LF3B 4U3HA 3B3IA 4ZOEA 5DJ0B 4NCDA 1NA8A 1INEL 4GUCA 3WAJA 2LT9A 4HBQA 1HOCB 4BGLA 4L3CA 4Z5RA 1BJMA 4DWHA 3HS0A 4DPRA 4G80B 3JYBA 3CFEB 4AVKA 5AD0B 2YUXA 1G9EA 1MCSA 4L05A 2WVUA 4A7UA 2J6EH 3QCVH 5C97A 4HF5L 1DR9A 1QHQA 3O6FC 3IJ8A 1KCRH 1TQUA 1QLRB 5KZCB 2EDDA 4FLHA 1AS6A 2NYZA 1JOIA 1BBJB 1N2RA 1U42A 2CO7B 4XXDA 3NK4A 3TZVD 3LDBB 2HLFD 3HI6H 1QRKA 2EIBA 4PSRA 2X4QA 3TN0A 5DQ9A 3TX4A 3BFWA 2ADIB 2CQVA 4D8PA 1MHEA 2ICWB 1J86A 3GLDA 4UIMB 3WEAA 4XNYL 2DYRB 5CEXB 1ZV9A 1N4XH 4EIZC 3GPEA 1AIFA 4YDIH 4WI8A 1JF1A 5EDXA 3ABKB 1W0VA 2QT6A 5BQ7A 3OGOE 1MIML 3O0RH 1RMFL 3O3DB 4MVBD 2DPKA 3CVHH 4GAAA 5DMKA 5I1AB 1A3QA 1U3JA 1G43A 3HR5B 3MUUA 4N5UA 5FA4B 4P05A 4U6TA 3UCRA 3ASNB 4E9SA 3FKUS 3QISA 3QIWD 2FX9H 1LJMA 2A99A 3IKCB 3IFNH 2B7DT 2FX7L 2ADYA 4UM8A 2BNQA 2FTAA 1IBGL 1LTXA 4L8SA 1IGYA 4JHAH 4CGTA 3JWNC 1OD9A 1MCFA 1J5OL 1NBVL 2AK1H 1EBPA 4DUXA 1PEZA 4O9HH 1RUQH 2RQ8A 4QD2E 4LCIL 5DD5H 4ZUTB 3FQ2A 1NGWB 2EDLA 3UDWA 3I9GH 5F89A 4RIRB 4U1NA 2OW6A 5DJ2B 4NAQA 4OUUB 2F5AL 4UBDC 4KY1L 3ISWA 1MIMH 3O0RL 4TYUA 3UPCA 3DO7B 2ICEC 2QR0A 1DQLH 4BXSV 5LNDA 1P2CA 5IM7B 3G9AB 1W8EA 2CK0L 3CD4A 1WEJH 1T1YA 4DIXA 4ODSH 2ZXCA 1A4CA 3P3SA 4B0MM 1EEYB 2ZXAA 5DA4A 2DQHH 1ZLWH 1XD1A 1IRAY 3CDZA 3SGDH 1M3IA 4YHOL 5EU6D 1TMQA 5GRJH 2AXFA 2CA4A 4P99A 3QNYA 4FXKB 4M61B 1LO2H 4Z7VF 4N6RB 1BQUA 1D5RA 2NNXA 5F71A 1MZZA 1OLLA 1KDIA 4NQCE 2V8LA 4JY5L 4KK9D 1CK0H 1U92A 4Q6YA 3U9PL 1E9QB 1OTTC 4R4ND 1WA0X 3IU4L 5HVGB 4P2OB 4PJBE 4XP9L 1T5XB 1TZIB 4LBAA 2I7SA 2N56A 4MA3A 3Q6FA 2DJUA 1SOSA 2QVIA 4MCNA 3LKOB 1FO0L 3O4LD 3RTQA 3VFVA 3APCA 5FM8A 1KTLB 4N8CH 4MSWB 3GXFA 4QHUB 1KCSH 3EOBA 3D2UA 2VKWA 1UH2A 3D4YA 3QJZA 1U95B 2WM0A 4X6CE 4RFNB 1UJTA 3OHXB 1TCRA 1T5XA 3SHSA 2D3JA 4OLWL 3D69A 2XUWA 4NEHB 3W39B 5AG8A 2UXGA 3KS0H 4TF4A 2EINB 4ODHH 4NP9A 1P6WA 2W80C 3ETBF 4YEFA 2H32B 2EUWA 3D50A 4MDJA 1ZA3B 1H9DA 4Q2ZB 3U2SA 2NY2C 4K8RL 3LZQA 2V2WB 3O6MH 4F20A 1CGVA 1QBLL 3HBZA 3IAPA 4ZTOH 1A7BA 2Z7ZA 1A9EA 2X1WL 4JZOA 3W9DA 4G9DB 4N2GA 1V7NH 4KHXH 4LPUA 4R5VA 3DRQB 4R96B 2OJZH 2Z8SA 2FEDC 4N1HB 3VXSE 4F7MB 5AOJA 3IU3A 4O58L 2AEQL 4KI5E 3TTSA 1HEJC 3G5YB 2EEAA 3US1A 1ZT4A 3DGGA 4B9GA 4BZ2H 2IF7A 3MC0A 4HOXA 2B77A 4G8GD 3AM8C 3ZT5A 2ICWJ 3IKKA 4ISVB 1M4KA 1GC1L 1I8MB 4G7SB 2JH2A 1IQWL 2ZAIA 1XF5B 3UBXG 5L6YL 2VYRE 1OT4A 2J8HA 4WW2A 5SWSD 4X7DC 1YEDB 4HMDA 1MNUH 2QSCL 2Y72A 1R3LA 4LVHC 3VXRD 4HFWA 1MCWM 3IVKA 5ABZA 1MJ8L 5B3JE 4QXWA 4UOW1 4XVTL 3S3DB 5F3HA 4XNMB 3PP3K 4F2EA 4I87A 3KVQA 4X99B 5GGSA 1IVTA 4M3KB 1YEGL 2E3VA 1GPOL 4FNRA 3TO4D 3IS1X 2QPUA 3MTXA 3REWB 3D39B 3EJYD 1U6AH 3G5XA 1QSEA 3GMLA 3OKYA 4WTQA 2GJZB 3RA7H 4KK6D 4WO4C 3CFBB 2JJTC 2XVKA 3BHBB 3TCLA 4KTDL 2H3NA 1AC0A 2ARJA 4MFHA 5I1AA 4PJHF 2CHDA 4FQXB 4KKCD 4JBSA 5A16B 2D0FA 2FBOJ 3OZ9L 4MMYA 4PRID 3KLLA 4Y5YA 5DJAA 3RY6A 4JFPA 4AQOA 1V8HA 3UTSA 4X6EB 3RLSA 5A2LH 1A6TB 3HS9A 3WE1A 3ZE0B 1MKFA 2JXMB 5C9JA 4OCRH 4M6NH 2AERT 2OSLB 2VZ3A 1CFQA 3KAAA 3E0GA 4TSBL 2H3NB 3FQNB 4HH9A 4IRSA 2OKMA 3QEHA 2BP8A 1XR9B 3ARZA 3BOVA 5T5NF 3OL2A 2WO3B 4OD1H 1T2QH 1RHHB 1CFNB 5TF1H 1B4JH 4HWBL 4A6YB 4NLHA 2R8SH 1QFWL 3K80A 1HXMB 3D4CA 3U9PH 4GSUA 1E8YA 1TZHB 4X4XB 2HX8A 3CZGA 1QSED 5DLLA 1AR1B 4YDVB 1K4DA 2PPFA 4I13B 3T0EC 1ZTXH 3U48A 2PYEE 1HOCA 1DQJB 1HTYA 4PQXA 2MJWA 2Z1PA 4RSVA 4FULA 2X1PA 4EBQH 3TWCL 4XI5D 5C1MB 2ERJC 5TDNB 5EOCL 5EDSA 3FQ4A 2AW2A 2JKRM 1OTSD 3T3PB 1S3KL 1ZS8A 3AU0A 4RMSA 2DMKA 3QWOB 3TFKC 3NQIA 4Q0XL 1BXVA 1MFNA 5BUAA 2OL3L 4G6ML 2NTFA 2AXHA 4M43H 3A4AA 5ICZA 4OZGE 3F83A 4HYTB 1KEGL 5HGHA 4OIIH 1D9KC 4HUCA 4B9YA 1CFTB 1NCGA 1VGKB 3MA7A 4XT1C 5FO7B 4KQ4L 1N8OE 5J11B 4O4YL 2AQ2A 2N0KA 3BFOA 2IDQA 3VMOA 1KOAA 1LP9F 4NWUH 3P2BA 4TV3A 2H7WA 1TKWA 5KVMC 5JYMA 3PAZA 4JJHA 3ENEA 2R9HD 3U2IA 3F2LA 5CHNB 2F54B 3F65A 2PO6C 1YY9D 5E4EB 2ISDA 4CDGC 3L2NA 2YZ8A 5I1GL 4HCRL 4L1BA 3A24A 2EE0A 4IRZH 2FX9L 1DFXA 1TTAA 2UWEE 1ZHBB 5DUML 2D3LA 4BH8A 2VMJA 1INDL 4W4NA 3F7PC 2NY3D 5GRUL 2GVYA 2QZ5A 2DM7A 1H3GA 2OTPA 3SDYH 1NPUA 3IMWA 3QJRB 5DUPL 4Z6AT 1TLMA 1RUAL 4E9VA 1ZANL 3UTOA 4CU7A 3CFMA 3QFJD 4Q9RL 2EC9U 2N1KA 4XZUA 4CADB 3OXRB 3QQ4A 1CXLA 1W16A 1SHMA 3O4LA 3FT3A 3RTQD 1AQKL 3B56A 1JGEA 4BK5A 2VQ1B 2HLEB 1F6AB 4XNYH 2VM9A 5JOPD 3UO1L 4NZ8A 1U93A 1QSFA 4LFHD 4DP1X 1HXYB 1OTTD 4R4NC 3VXTB 1ADQA 5KYNA 2P80A 3G08A 1TFPA 1AACA 2VLRE 3QO1B 4JY6B 3HE6C 1OL0A 2BSDA 2LVCA 4KFMA 2DBLL 4QRSB 4WU5B 3QQDA 4AIOA 2DMBA 3KPMA 4I48A 3V95A 2EEBA 3FPXA 1KLUB 5AL8A 5GGUB 4UQDA 2P24B 4U4BA 2QGDA 4P2CG 4HC1L 3EFFA 1OOAA 4M29A 2AVFA 4MXVF 3MLRH 4PWJA 5EN2B 1L7IL 5IBTH 1TYRA 4LLDA 1HZKA 3MBWB 3S35L 4ZFFA 5F0LB 5INDB 2PYEA 5E8OA 3L5HA 1FC1A 1BQHG 2J43A 1AMYA 1DVQA 2BIIA 3RWIA 3ZLQC 1CE6A 5EIIG 3GBNL 4XO9A 1F4YL 5GRJL 1ROWA 4CBZA 4L1DA 4R3SA 2E59A 4HCGA 4RGNB 5DVPA 2EXWD 1QI5A 4K3DL 2Z4QB 4LLQA 5CJ5A 4WTZA 4HFUH 4FG6D 4JFYB 4Z7UA 3ARBA 2JCCE 5DZ9A 4M8QA 4ACTA 1I9JH 2WZ5A 5F8QC 4PB0H 1NCOA 2DQEH 3BPNB 3K5RA 4XTRD 1AJ7H 4KNUA 3KJ6L 4PYHA 4Y16A 2VB5A 5IHHA 3V52H 4Y4HB 2V7NB 3MCYA 4U1HB 2YD8A 4L5FH 2VN3A 5ILTH 1PZ3A 1EEZA 4XC3H 2NUPB 2ZUSA 4OCYH 1JPTH 5DHVB 3BH8A 4NM8L 4PHZA 1JP5A 3HG0A 2ZCLL 1K3ZA 3O3EB 3HB3C 4NKMA 1MWAA 3JV4A 2C3XA 4FI6A 3TZVB 3EOAB 1B4LA 4S2SB 1CFMA 2JKLA 5CD3A 4JFOA 3VXUD 4XWOC 3DC0A 3T2NH 2J57A 1XF4A 4UTBH 5E7FA 2ZYRA 3UZVB 4NKDA 4PV1C 2G9KA 4ANWA 5I16B 2W5PA 1PDKA 4GUQA 4P2AA 3V6FA 1F5WA 4KO6A 2WLYA 5I6LA 4DUWA 4NQEA 1M9WA 4P4KC 5I0DA 5GS2D 1AO7B 5BRZE 4GUPA 2BSRA 2NXYB 2VABA 3ILQC 2ROXA 3OHMB 3DYPA 4IOFD 3WKYA 4A1RA 1UZ8A 3S5LB 1FRGH 3UZVA 1BZ9A 3RNQA 3B1TA 3LHAA 1U8OB 2YAPA 4NQDE 3ZSTA 3EDDA 3WE6B 2PPDA 3S0PA 3Q43A 3ZDYB 3VXOB 3GKWL 4LB8A 4M4PA 4YHZH 3COOA 3MNWB 5HDBB 1K6QH 4YHIB 4IU3B 1PDKB 4TUKH 1RCYA 3NP4A 2BP0A 4FZEL 4XRCB 1S7VB 3KWXA 5DRXA 5A3IC 1AZCA 3CCHB 3CHQA 3H42L 5AENA 5FYLE 3MFFB 4K7PH 2VISB 1XGUA 5E6IB 1BD2D 4KRMB 3AAZB 1NANH 3C87A 3K8KA 3TZVC 2FBRA 1ETA1 1SGKA 4JE4B 1UFUA 5DJ8A 4JGJA 4ODWB 4Z76A 4KNSA 4HCRH 2YKLL 4Y4HA 3FU3A 1TTRA 4F92B 4ODTH 2WO4A 5EWIH 5JPMB 1DUYB 1USQA 1WV7T 3BVUA 4U6VL 1T1XA 4LVOB 5C70A 4D9RD 4BUQA 1BOGA 4WHTB 3L3GA 2W88A 1WCBB 3RWJB 2EIZB 3ILPA 4GKZB 1EHXA 1FL3A 4QHNA 1U8LB 1ORSB 1T4KB 3LEYL 2I60L 2IDTA 4TQIA 4R83A 3UGUA 2UY7B 2ENYA 1LM8V 3TBVA 2PNDA 7TAAA 1D5XB 2YPLA 4KC3B 3PQYA 4DZBB 4KKNA 3EJUA 1HCYA 3QUKA 4R2GB 4E9RA 5BRQA 5D5ME 3RWCA 2ADFH 4H8UA 3IFOA 2JKIS 4NPYB 3IDMB 4BE5A 1C08B 3GUFA 3EFOA 5AOKA 3WIIH 3ZOAA 3RFZC 1NLDL 3S96A 3RA7L 1UURA 4AIZB 3KLHD 1A14H 3O2DL 4YS4A 3PV7A 1CD1B 2NW2A 2GK0B 3WNJA 3ZE2E 4N0YH 4APQA 4YWGL 1MI5D 4HUNB 4NKQB 4X5XA 4EDWL 2A74B 2QVKA 4GNKB 3SJVB 2AV1A 3WOVA 2GJPA 2X5PA 1FL6A 1JIBA 3HHMA 4IBLT 5C7XH 5J6HB 2P28B 2WP3O 3FMGL 2HN7A 3T8MA 3MJ8B 3NCEB 3RY4A 3JV6B 4HDIA 4NQVA 2MSPA 2WV3A 4PJEB 1RUKL 4UIKH 1U3HC 2DQIH 4UF7C 5F0PB 4EOWL 3NH7H 1S4IA 3H56A 4JY4A 4FADA 4DCQA 1KC5L 5LDUA 2VSCA 7PCYA 3BMWA 3OMZA 1NBYB 4Q6IC 1QFUL 1TJHH 4MS8C 2VXTL 2ADGA 1OW0A 3GXMA 3O6FB 4OCWL 4UAHA 5CHNA 2XV3A 4HIXL 2X05A 3VGHA 1T5WB 1FZKA 4QWWD 3UBXB 3K72B 1ZTMA 2JB6A 2D4DA 5E23A 3GXDA 3DHPA 4JO3H 3LH2L 2A6IA 5SWZD 3P30L 5BS0A 4BH8B 3QVAA 2ESVE 2Y24A 1FGVL 3VXUB 4NJAL 3J8F7 3FXIC 4PN6A 3HUJE 3MLZL 4YGVB 4E9YA 3MBEA 1F11A 3TTYA 4JCMA 3I9IA 5FW7A 4XCYA 4YDJB 2W9DH 4IBQA 4AEIL 5A6IA 3L1GA 2WBKA 3ZUNC 1IAOA 4LLYB 2LTQC 1ZLUK 5I19H 2CBTA 4A66A 4E41D 3GSVB 3VGGA 4PEEA 4Q9QL 3L9RB 3STZA 1TJGH 3BKJH 1NUNB 1W72H 4LNRB 3A23A 4YHKL 1G0YR 2P8PB 2Z8RA 5DJ0A 5T5FA 4CJ0A 4P48A 4PRDB 5KYUB 5D7JD 1YEIL 4NI6A 2F1AA 3MRIB 1OCZB 1EXUB 1HKLH 3PFQA 4GOSA 4X80L 3DX2A 2VXSL 4NUMA 2IWKA 5HGDB 1T0NB 4WHDA 3HZVB 1DQMH 5C0CD 8CGTA 4XZ4A 2DI8A 1CYGA 4G6FB 4IJTA 4QRPD 1UB5B 2HRHA 2XN9B 4XGZB 4WWPA 3EOYG 1MREL 1JPTL 2BSED 2NR6A 1TETL 2FNBA 4NRZA 3FN0L 1TZHA 4X4XA 1OPGL 5E6YA 4QJ5B 1F6FB 1IGML 1IC4H 4HHAB 4DKTA 2FL5B 4QOKA 2FAUA 4N85A 2EAEA 1CDHA 4F9PA 3MRGB 4Z7NE 2ZSVB 4JPVL 5KVDL 5DD3H 3IXTA 3UIZA 4CW1B 1QWHA 1YEJL 5D1ZD 3T2PA 1FBIL 3UAEA 4LVEA 4U1KA 2XV6B 1KACB 4UNTA 4WUUB 5EC1A 2C3GA 3PGDA 2FBJH 3SGEH 1ZA6B 2Z31C 3LXAA 4LOVA 4QF1A 5D1XD 4NYLA 1C8QA 1VB9A 4FF9A 4KHXL 1OCWL 4AOFA 2X4OA 5TE6H 2VN6A 1OZTG 4KROC 5B8CC 1Q9KB 1UD3A 5ACMA 4P3DB 3T2OA 5BS0B 1NFKA 1PG7X 3BAEL 2J56A 1N0XL 3PWUB 1G5AA 2XIBA 32C2B 3MJ7A 4GPVA 2H32H 4AT6B 2X9YA 2VC2L 4MJJA 3QZBA 4GBXC 1X5KA 1NBQA 5AAMA 1OSPL 3BAKA 1VF5C 4KJQD 4MAYD 5LCVH 1HCZA 5EIVA 5FGRA 1H3PH 1JBJA 1IGJA 2DRUA 5D7KE 2CRYA 5ETUB 4FQXA 2R29H 1IBYA 5JLZA 5DJ6B 3PIQB 4NUGL 1KT2A 3SPGA 1U8HA 1IJNA 3UYOD 3CDCA 4OCXL 1NCCL 1CICB 1N26A 1S78D 4MJ5B 1SFHA 5F96L 3WKPA 3MJWA 4W93A 3BPCB 5C0FB 1E4KC 4PB9L 3P0GB 5D8JL 1Z5LB 3S3PA 1LK2A 1JZ3A 2CIKA 1BQLL 4FP8H 1QRNB 2MQ3A 3QJHA 4KJPC 4JRYB 2V9RA 2F2HA 4DGUA 4NC1C 3RDTA 4OLEA 1JDDA 3F5WB 2GUOB 4YFDB 3RL1B 3LN5A 4RETB 4KJYA 5IEHB 3IVKB 5E08L 4XP6H 2JJSC 3VSQA 3OMNB 4WNJA 1BJ1J 4DAGH 3PWVA 1WF5A 4U7MA 2Y7QB 2BSSB 1ZV5A 3Q6GH 5CCGE 1CBVL 1J8SA 1U33A 1I9RH 2HJKA 4ALAC 2J2ZA 2XKNA 3SJVE 3ROOB 2VDLH 4OCXH 4Y9GA 1WIUA 1AI1L 4NERA 4JQIL 3V6ZB 4J8RA 4F5CE 1MFEL 2WQAA 3B9KC 4BCXA 3IGAB 4G7YH 1KENH 4QJ3B 1UC6A 3PDOB 5I1EL 5E8PB 1DVSA 4G70B 4ZS6D 3OB8A 2IBZY 2WLLB 4JZJB 2W65A 2G2NA 2PXYA 5DI8B 3GTTA 1NZRA 3OXSB 5BVPL 3FU9A 1ACYL 3P0VL 1IAKB 1E67A 2WWOA 2I9LA 3MREB 4JFZH 3HMXL 5SWQB 4OBSA 5DQJA 4IBSA 4I2XB 1LEIB 4LCVA 1T5WA 1GMIA 5BV7B 2R29L 4LCWE 1KGXA 5IKCB 1GZHA 1NMAL 4YSCA 1HIML 4RWYH 3RX7A 3N1GC 1NEPA 1ZLVK 4BXVA 2YEZB 2YPVA 3KYMA 1I85C 3HAEH 1CJYA 1S8DB 4OKDA 1CGXA 1R5WB 1JK9B 4EN3B 4FLOA 4QCIA 2IGLA 4U0RC 2P45B 1AHWB 2XIIA 4OF8A 2N59A 4N2EA 4APXB 3WIFB 4IMLB 5JXEA 4LPWA 4MJHA 4XHQA 3WIAA 4E9QA 2KC0A 5L4FA 3QUYC 1HN1A 4AMXA 1J9QA 4FNLH 4L3AA 3VFNA 3JWOC 2BVYA 2K1MA 3NACH 3BT0A 3ARPA 4QKXB 2DLEA 2EDNA 4J4PD 4LQ1A 2NXYD 2B14A 1V3MA 3B2PA 3P0YL 4IMKC 3TEUA 4AMWA 4ISVA 2QPDB 2WZAA 1HEZB 3KWWA 4NNYA 1KTJA 2H9GB 3L7FB 3P9LB 3V5HA 3NZSA 1MAML 3IDMA 5BRPA 3IFOB 1N12A 3LNDA 4JPIB 2HJKB 5HHPB 2RALA 3RILA 5EZOL 3H7BB 1HH9B 5HYJD 1Z9LA 3K6DA 3T65B 3NFSL 5CIPA 1E27A 5K9OB 3PWJB 1P7HL 3ZMNA 3FQXB 4KK8D 4NKDB 1JVOA 2QGCA 1UD2A 2X4NB 3H3PL 4LLUB 5GQBA 4F15B 3WNLA 4XMPL 1AQHA 4TOYH 4U2YA 4JJOA 3L13A 3VWJA 4CNIB 3SDAD 3BH4A 4DO4A 1KUMA 4HKBA 4XR8C 5DCCA 5EOTB 5CINL 1URIA 4EUPA 4QXVA 2H32A 4LIQL 3UBXI 4RRPG 3G6AB 3STBA 1UOLA 2DMCA 2DICA 4W9JC 1OWRM 3C8HA 1YMMA 2XX0A 1ZLSL 1XGYL 4X0NA 1N3NA 4KWUA 1FYHB 2VDKL 3C12A 5ECJE 1BJ1H 3MUZ1 4I1PA 4JFDA 3JT0A 4TTDD 4TUUA 2EYSA 5C08E 2J8UA 3BCDA 1O6SA 2WSDA 5DMGD 3G6AA 3BEVB 5EO1B 5F1IA 1KIRA 4XX1G 4C55A 2A38A 3GHEH 3MODL 1PW3A 4RMUA 1IBDA 1LEGA 2A4CA 3MV7E 3CGTA 4JG0L 1GHFL 4XPTL 3IDGA 2HJLB 4PWHA 3FFCE 3SDYL 4H8WL 1ZHKB 3FTUA 5A40E 4JCLA 4LRNL 1CU4L 4RRPM 3QG6B 5ALCL 5IB1B 3WUZA 3FB5A 4YSSA 5C7XL 1SOQA 4F8NA 2GTWB 1NCWH 1C5DA 4UOW0 3VXRA 1KY6A 1HEHC 1XXDC 2XXFA 2A6DB 3U83A 1QUNB 2DJMA 3DECA 5B38B 1R5VA 1T1WB 2D31B 3QXDB 3VI4F 5KS9E 1HHJB 5D7LB 2H0FA 5DVOA 3WFZA 4E0RA 4JNXA 3ABMB 5GGUA 1BV8A 2I24N 4H0IA 4ZAKD 3G5ZA 5IVXF 3ZUCA 1SBBA 5E5MB 3ZRSA 4DP4X 2CO7A 4QRSA 3I6KB 5DEZA 5INCA 4A7QA 2Q20A 3LRHA 2QR0B 3OX8A 4XWOD 1IAMA 4WJKB 3UGEA 2OR9H 3ABLB 1T0MB 1FL5B 2VL5A 1JNLL 3PWVB 4F7KA 1FG2A 2YMOA 4IGBD 4KTEH 4NRZB 2A73A 5BZZA 1CL7L 3PHQB 4QXTB 4JM4H 5I1JH 1LWRA 2XBTA 3MGTA 1HL4A 3UEQA 5E8EA 2AGJH 1XGYH 3OGCB 2KS0A 5IQ7L 5J57B 1NANI 1VEPA 3HJEA 1N59B 1NFIB 1EJOH 1ES0A 1QSVA 3KPQB 2VAJA 2ZUUA 5TGBB 4F9PC 1UACH 2IGFH 4YSDA 1ZPLA 2ZG1A 1WWWX 3BGAA 4PS4L 4E2OA 3I3BA 4LCCB 3BWSA 2L7EA 2D03L 3MJGX 5KJRL 5LXVA 3ZKSD 1CWVA 4UQ3B 1I1AC 1VPOL 2WQWA 2F54A 2H26A 3KHOA 3ZU8A 1V3LA 2XWBB 3UX9B 1CGTA 4X7EC 1T2JA 2JIXB 3ARDC 5FO8B 1T2QL 3BIKB 4BZ2A 4TNVK 3V9EA 2X0UA 3FW6A 2ZWKA 3KPSE 2KPWA 4NQQA 5C0BD 4XXCC 1KB9K 4PJCF 3EYUH 1ASOA 4XWGL 3G04A 4JFHE 1NC2B 4H20L 1IV8A 4KO7A 1UB6B 3K72A 3HN3A 3P54A 4OF6A 2BRRL 2OMWA 3CUPA 4PRPE 5HJ3B 4S1DD 3SDDB 1A6WL 1C16B 4BCZA 4MMXB 2J8UE 1LO0H 4WW1B 2IGFL 5I73B 3NQKA 4KX9A 2RBLA 4KHTH 1UXLA 7CGTA 3GJFB 3MJ9L 3NRPA 4Z77A 5LKNA 3KH4A 4P4KD 5EF3A 1J8KA 1QBMH 4HIHB 1H6EA 3MUGB 2GB2A 2X4TA 3O3BB 2FQFA 2CCWA 5DHMC 1YN7A 5CD5C 1QVOA 4JFXB 2A9NH 4XNXH 3US0A 2ODHA 2XN9D 3S88L 2VLME 4HBCH 2IVFC 2ZUWA 3AQZA 4I85A 3WNIA 5J7CC 3QP3A 5EZIL 3TFKD 3TO2B 3ME0A 1CFVL 3CWGA 1QSEB 3GMLB 5D72L 4ZX5A 3MRDA 3QORC 4L1SA 4MTMA 4MLIA 4D94A 3A4DA 4HJJH 4B5ZA 3L3OB 3CDGB 1V05A 2XOTA 3S4SG 4FJZA 2XJKA 2KZKA 3QEUB 4ODVL 1E3ZA 3U4BH 5GGRA 3FT2A 4NFDA 2ZX9A 3WKQA 1U3HA 3S96B 2BVPA 1IEHA 3CLFL 3DNKA 3ME0B 4HSCX 1OHZA 2F53E 3UCQA 1TSRA 3GMPB 1TQTA 1IGCH 1JPGA 2EIMB 2IPUG 5E9DE 3EJYC 3TJHD 3KPPA 4KI5F 4ADIA 5JR1L 1C8PA 1NCAH 2H3KA 4MX7A 3ATFA 2BOCB 2VDLL 2IFFH 3WY2A 2DZEA 3BKYL 2MHAB 5FGCB 4RQQB 5LGHH 4NYLB 5EU6B 1P9MC 5JORA 1RIVH 3S5LG 4WFED 4WUUA 5EC1B 3RIAF 2EADA 4QO1A 4NZRL 1NLBH 3SE4A 1YQVL 5CUSH 1RAMA 1E9OB 2VWEE 3BPOB 2HJLA 1I82A 2EDOA 4G7VL 2AHIA 5FYKH 2WNKA 3UFIA 4GG6B 4A2EA 5LDSA 1CTMA 3AS0A 1R46A 2X44D 3CXHK 2E27H 4N26A 5EU3B 4EXPX 5KSVA 2LLNA 4M62L 4OSUH 3R8BB 1BWWA 5ESAB 1U2CA 3PWLA 5IB3A 5IWLA 5IBTL 3GSXB 3NFPB 2XN9A 4OB5L 2GC7C 5F96H 1T03H 2J5WA 5IHUL 1VEOA 2EDWA 1QTSA 1LWJA 1VZIA 3REVA 2KLRA 1AGEA 2R2HB 3QUMH 1QI4A 3O3UN 4Y2OA 1CICC 2VLKD 2QQNH 4RFOH 3SO5A 3O4OC 3ECUA 5HVFB 2OPCA 4YXHH 3ULVD 2BLFA 2HFGH 4TLKA 1FPTH 3L9RA 4WWID 3STZB 1TJGL 3BKJL 3E80A 4YHKH 1HI6A 4CMMB 3OKMA 3CVIH 3AUWB 4PJ7F 4KZDL 4F33A 4X5XB 1SN2A 3UAJC 3PHQA 1PYWB 4ZUUA 5FGSA 4YDVA 4ELMF 5CJ8A 2IANA 2XY2A 1R3IH 3NFSH 4NOFA 3W0WA 3PWJA 4F7EA 3QDMA 4A63A 3MLZH 4HPYL 2XIDA 5ADPH 3DJZA 3FONA 1T20B 3M17A 3IE4A 1JHTA 4TL5A 1NBZA 2NY0D 3TJEL 3QQ3B 1MFVA 1FZKB 1BA9A 1NEUA 5T8IA 3BMVA 4N22A 5KVDE 5BZWA 3KMDA 1IEBA 2FECL 1G7IB 1W80A 1MCQA 3RVUC 4X7SL 2KZ1B 4KGLA 3FOMB 3EUUA 4HSAC 2DQDL 3DK0A 4JRYD 4U4IA 2O6PA 4LKCA 2A6KB 5IB4B 1VFAA 1E65A 1M05A 4Z3FA 2APVA 1AVAA 1T1XB 3GZQA 5D71L 3KBEA 3UJTH 2HN7B 5LGYA 2WCSA 2F53A 4HGKC 3O6KL 1DUYA 5HYSA 5IB2A 4Y9BA 3UTQB 1EO8L 3O2VL 2F8IA 2D9QB 4JG1L 4XNBA 5I1GH 1WPCA 3FAWA 4V11A 3MYZA 4TNWF 4OTXL 3SY0B 3CN4A 4LRNH 3O2DH 1MDAA 2WYIA 1JXFA 2NX5B 4DEPC 5JIIA 1BVLB 2ARJQ 4UT6A 5FDWA 3MNMA 4K2UH 4P57A 4BBWA 5GS2H 3T0DA 1JV5B 3NDYE 2OYMA 1L5GB 3FT9A 4WEBH 4KVPA 3LSOA 1S7VA 8FABB 4NFCA 5EOCH 1B88A 1CCZA 3VRIB 2N7SA 1D3CA 1A3RH 3KNBA 4FQJH 3HHRB 4MCMA 1WLHA 1JF1B 4I18A 2OL3H 2TSBA 2VDKH 5HDWA 2Y9RT 2RR3A 1AP2B 3EJRA 3ZIYA 1E43A 2HRPH 5A2FA 3S8FB 4WK2B 4QRRB 4FYQA 5D2NB 4FLQA 2GUYA 3LB6C 1JHTB 3ZDYF 3CFDB 5C09A 3DX4A 3CXDH 4ERSH 2PTTA 1TCMA 1VA9A 5KS9B 3BWAB 2WKOF 3WEOA 4D7PA 1JK8A 4WTZG 4FG2A 2DTMH 4KXBA 4X5WB 1EFQA 1KGYE 1J87A 4JPWH 1INDH 4DKAA 2H6UA 3OG6B 5D8JH 5M7QA 4JRXB 1ZRUA 3MCKA 4FXGC 2FJGB 4AYFB 4H8HA 1MPAL 4YEEA 5JTWA 1A1MA 4L8DB 3P3YA 5DUJA 1G9NH 5E1GA 4N0UE 1E6JL 1K4CA 5FKAA 3U0TB 5DJ6A 1PX3A 4Y19E 3T0EE 2NSMA 1A14L 2ORBH 2NYYD 1G6RB 1AQ8A 2XWJA 4TSAH 5B3JF 3BGMA 2ZF8A 3BP7B 3QUMA 3AY4C 3DUSA 1HK6A 4BK5C 5GGQH 5T33L 3MUJA 5HHOD 4BFRA 3DX6B 5B8CB 1VKXA 1TTGA 2OA9A 2OR8A 4GKLA 1ZAGA 4L8BA 1DJIA 3SE8L 5K9QG 2M2DA 5E95B 1WRFA 6FABH 1RZ7L 3W2DL 2B08A 2YPKA 5EU7C 4AQEB 4ZYKB 1HWHB 5CU9A 3BH9B 1PYWA 4WSGA 4X0KB 1RJZA 2XN2A 4JFZL 2AEIT 1FN4A 4AYID 2VJ8A 1A8JH 3OKMB 2XWTA 4JR9H 3NEOA 4MDRA 3Q8CA 4MYWB 4P9HL 2GQHA 2QKIC 4FXGB 1EHLL 3N6YA 2WGXA 5B7EA 5MHSD 1YAIA 4PLNC 1D6VL 1E5CA 4GRMB 2CO4A 5AUMA 4PS3A 1E5BA 5IVXE 4BFOA 1CIDA 3DYOA 1BZOA 4M7JH 2F74A 2GUOA 3RL1A 5ES4B 3C6LD 3OJVC 4OZGA 3MBED 2YQ2A 5D6DC 1S7QA 4PY7A 4U6YB 4AENA 4FZEH 2F54D 3MCLH 1HSAA 1QPPA 3WMPA 5DEGB 3K2UH 3TF4A 3SCMA 3PNWB 1SF5A 3B34A 3IT8D 5DXWA 4LASL 5E1IA 3CDFA 2QHLA 4XO8A 1K2DA 3DHMA 5L8LB 1AGFA 4HUXB 1NIDA 4LSVH 2QHRL 4NCC1 3HE7B 5C09E 3AXIA 1PBYA 4RMVA 2Q86B 2J6EL 4HV8A 5ETUA 4AX3A 4PUBL 5KWYC 1A6TA 4IMKA 2CLZB 5AKTA 5KSUB 1RZKL 1KCVH 1N0LB 1NJ9A 3GM8A 3NGBC 4Y5VA 4PRBB 3QDGA 2AK4B 2GITB 1QRNE 2V37A 2WB1A 1FO0H 3IS0X 4HS6B 1RZJL 1QYGL 1J1XH 1MNUL 2QSCH 3KL3A 3K46A 4PD4J 3SSGA 4S1SL 5KSBF 1LNUB 4C4KT 1NUGA 2FT6A 4U1KB 4YBLB 3WLBB 5K9JL 5I73C 3Q5YA 4KAQL 1OTSC 3TP4A 4GQ9H 5E8DL 5EEUA 1DDHA 3UMNA 1KBWA 3FOLB 4ZXBD 4DP2X 2G2RB 4LOFA 5JMRA 1S7RA 2VLRA 5AUMB 3NIGB 1E5UI 5DFWH 5DD0L 5L0QC 4KY1H 4GRMA 1ZANH 2JJTA 1F00I 1IKNC 1WG3A 3O6LL 1VFBB 3ZKQD 2GBAA 3A6CL 4G6JH 2VITA 5AW6B 1ZJAA 1RUQL 1WEJL 1RSYA 4NENB 3K6SA 1ETZB 3K81A 2Y7OA 4HKZA 3GC3A 2X89D 4NWTL 2LV4A 3VD0A 1DVFA 3OJMB 4FQXD 3M7OA 1I9EA 4XNZC 4Y4KA 3MZTA 5JNYA 1L7IH 5E9NA 2WZPD 3K8LA 3PHAA 4FFZA 4G6KL 4PJ9C 4NO0B 5D5MF 5KVGL 2W9EL 3W9DB 1P4BH 4MS8D 2FDBP 4LAQL 2WZPA 1IEAB 2VLJD 4GSRA 3CHPA 1EZSA 1J0IA 4GS7C 3JWDH 3H9HB 4BKLB 1FFOB 2X89A 1DQQB 3NG5A 3QDGB 5MEOB 1HSBA 3D85B 4XBPA 3V4LA 1KJ2H 4XOCA 3ZZQA 3E8UH 1FH5H 3NPSC 4D3CH 4N0RA 2N3JA 4FQLH 2IDFA 3QUXC 5ICXA 3NZHL 3EO9L 2GTWA 3VXRB 4X6CB 5T3ZD 3GJEB 1KWGA 1BVOA 4FD0A 1OP3H 4RAUA 1EDYA 2WTRA 1E4KA 5FR3A 2DKSA 4GRLD 3WHXB 1J7VR 1YJDC 2DTSA 3GSNB 3VXMA 5C0AE 4E5XA 2J1WA 1A6ZB 3VW3L 4XODA 4BFBD 1QSZA 5F7WC 1EAQA 2R1YB 3Q1SL 3BWUF 5JW5B 4TM9A 4ZTEA 1KB5B 1RFDH 1YZZA 4C59B 5IP4A 3GMMB 4FJYA 1Q9LB 5T1MA 1GS8A 4PB9H 4W9EC 3V8CA 4M61A 2NY2B 2XTJE 1BFSA 2EXWC 5GSRB 3VFWB 4BGDA 1DYZA 1GKEA 1R47A 3DMMB 1A4KB 1BGXH 4FABL 4O5LH 1NAMA 4I3SH 4PJ7A 4ENEC 2EIDA 1J1OH 2DBJA 2P1YA 2QQKH 3I3DA 4YNYA 5BO0D 1N5AA 4FZ8H 4PWIA 3TBCA 4N5ED 3I75B 4FQIL 4PRNA 4UB0H 4NZDA 1OAQH 2XFGB 4AK1A 1OARH 2VDNH 4HKBB 5ICYA 4WY7L 1MY5A 3QZWB 5IEKB 4RX4D 1MF2H 2YIHA 1T80A 2CRIA 1TDQA 5E1AB 4KJWD 2PP8A 3G5VB 4PGEB 2LFGA 5ACLA 5CGYD 4YL4A 3O11A 3S36X 2FX7H 4P2RA 2A83A 4FFVC 1JPSL 1RZ7H 5KBNC 2W8CA 2LAGB 3SYCA 3ZYZA 1XCXA 5DZOA 2A9AA 1LEGB 1UKQA 1RP8A 3FYEB 3MI6A 5FM5M 5ALBL 4D0BA 1BYPA 2EIZA 3ILPB 3U2SB 1GPOH 1HL5A 2H3XC 4O02L 4XOAA 5DSCB 2FH6A 5AOLA 2X3AA 3QDMD 3TJHC 4K71C 3BUDA 3VM7A 2ZSWA 3UAJD 3W0WD 2YS4A 5BOJA 3AREC 4Z7WE 3GI9L 3MV8E 4L0YA 4RMRA 1TSHA 2ARWA 2F53B 2E9WA 1OTUC 4QHUA 5K59F 3BRDA 3BW9A 1BZ8A 1GGIH 1I3VA 1NOLA 3A47A 4DETA 1JWSA 4Q4EA 3KXFE 1Z3GH 3HPJA 1EO5A 1PAMA 1ZMYA 2X9WA 3MRQA 5L9DH 1XHHA 1QYGH 3CU1A 3ATDA 4WWKD 2GSMB 4L8SC 5MI0C 2H1PH 2ICCA 1X5ZA 2ITCA 1KG0B 1BX2A 2LW3A 1UM5L 4OCRL 5C09B 3PQYE 3S34L 3L5JA 4WU7B 1I9IL 5FYJD 3BE1L 3QDJB 2I5YL 2DM4A 3LNHA 4H0HB 3FSAA 5AVYB 3DO3A 5D1XB 3VD1A 1R0AH 2MTAA 5DD6B 4PS4H 3ULSB 1F56A 1IKOP 4HT1L 3WJMA 1OW0C 3SB3A 1FVEB 3NUKA 3MODH 4QHKJ 2MEJB 1IGFH 3I75A 1X9LA 4KQ3L 3H42H 5BW7A 2L3BA 1H6UA 2ZF9A 3HKFA 2X10A 2P8LA 3OZLA 2WQSA 2YAFA 3OKOA 4DGYL 2DF3A 1FFTB 3NZHH 5E2UL 3BGMB 1KY7A 1MFBL 3EXJA 1WAEA 3CZLA 1TQBB 2WANA 5CP7B 4M1GH 4M1DL 1XXFC 1JZ8A 2DQJL 1KBGH 5F89B 2X40A 3RUGA 5L0QB 3EYSH 5CEZL 4X6FA 1ZK9A 3QIWB 2HB0A 4FXLA 2C4XA 4LAQH 2CLVA 3ZGIA 2AMUA 4ZX3A 2IANE 2XVBA 1PZDA 3D1MC 4R7VA 3U4KA 2V5SA 4H8PA 4HJ0D 2CWRA 3MPCA 3HS0C 4X98A 4OJFL 4FHBD 5D1QD 1N6VA 5MP6H 4NN6B 5F1IB 1SHWA 2DAVA 4KRPB 4QI3A 3UTZA 5HHME 5JQIB 1KLGB 1SXSA 3B7RL 2R0ZL 3HZMB 1QP1A 3MREA 2NLJA 4A6YH 2IFFL 3M45A 1BQHA 3BZ4A 3X1EA 1P4UA 4WWKA 4P2OD 3TBYB 3DIFA 1VACB 5B4MC 5D4QA 2EH7H 3NTCL 4LRIC 4X4ME 3LH9A 4PRHD 4Q8BA 5E5RB 5HI5D 2BFVL 4CGUB 4NO3A 5SWZB 2YAQA 2ZQKA 2D7NA 1NGQL 4L4VE 3TWYA 1FV1B 3T8VA 1CDCA 3O6FD 4S1DC 1JUFA 1CDJA 1EFXA 3P2DA 2JCWA 3SQBA 4FKHA 4WSJA 4C56A 3NJJA 3KLAA 1HHKB 1T66C 1EA9C 1Z1WA 4FC3E 4LLDB 1UWXH 4H44C 5TQ0H 4JQXC 4OLWH 4OZIF 4YE4L 4XP4L 1SYVB 3MUHL 2K6WA 4MYPA 1MRDL 2QVMA 4DGYH 4WDIB 1U3HB 3GM0A 3OV6A 3W0WB 3ZQXA 4BQ6A 4PRNB 1S7TB 3W81A 4WVRA 3PGDB 4KOBA 1I7UA 3FZUC 4HUKB 3FO2A 3HG5A 2J1ZA 3OMAB 4OCMC 4PJIA 4Z78B 2E7CA 4RSYA 3L4VA 4Y9EA 4FG6C 1MIEH 2PWFA 4Y2OB 1OGAD 2B2XH 3CBJB 4Z0XA 1NDTA 1OGTA 1MI5B 1O6VA 3P9MA 4M7KH 2P52A 4MHHG 1OQXA 2YAEA 5F1OB 3WNMA 2V5YA 1MLCB 1UUSA 4BFGA 5I71C 3AABA 5CJOH 2X42A 4A39A 4LKXB 2OYKA 4WJG3 3IF1B 5JHDD 2FD6H 5F9WB 3LB6D 4ZMNA 5I1LA 4WFFD 4U1JB 4FABH 2B1OA 4ZPTA 5EBWB 3U1SH 4TVPD 2Z65C 2GAZB 4Y4KD 5CBAA 3LKQA 3U30B 2AJYL 4MJIA 1KBKA 1DQVA 2R0KH 3D7PA 1JXJA 4YK4C 5E5UB 3V7AG 2ZX5A 3LJ3A 4Z7NF 4F7TA 4JDZB 4HWNA 4U1LB 3TCXA 1A7RH 1ZIBA 4KKQA 4UDUB 4X8GA 1SDDA 3VB9A 2XV0A 1AQDB 3BQUA 2A6JA 1MCJA 1KCRL 1CO1A 4BM7A 2DL2A 1G7QB 4IEFA 1QEWB 4YDJA 8PAZA 2JTDA 5IFHH 4AGMA 4GQRA 4DKDC 3DDGA 1A4JB 4FTVA 1YPZF 1C1EH 1KYFA 1EHLH 3RBSA 2AQQA 2CMRH 2OXHA 4PWKA 2FR4A 5C0AB 4P3CL 4XAKD 3PV6A 2UZIL 4N0UA 4W9DC 5B4MD 1MCEA 1FNSH 3GKZA 1X44A 3WMQA 3QEQD 1PF3A 4W81A 4ZS7H 3KZ8A 1SN0A 2BXZA 1FWXA 2BCMA 1EUTA 2IGTA 2VDKB 5D7EA 5HGAB 4FFVD 3VFRB 3FK3A 6FABL 1H3PL 1WP6A 1UB5A 3BJLA 1W72A 5TDPB 1OHQA 1TEFA 1EGJH 3ARGC 3C5SB 1M2VA 4JM2F 4QYOB 1AYRA 4FFYA 3D2TA 4PRPB 3QDGD 2EZ0C 3FCTA 4YXKL 4ZNEE 1N6QH 2R9HC 3LS5L 2EXTA 4AW7A 2NQCA 1BIIA 2H1XA 5D72H 4IBVA 5BJTA 3SJVA 4N8VA 2D3NA 1TYEB 5E4AA 2VE6B 4UDTA 5EEZA 2BY3A 5A7EA 2K7QA 1EAPB 1UGNA 1I8IB 4MNQA 4ZBJA 2VXQA 1U8MA 1WQVT 3D3VE 3MYJA 2ALWA 4Y1AE 5BO1H 4AZ8B 4K3DH 5D7LE 5IQNA 3RAJH 2X2HA 3L3OC 5E08H 2RFXB 3FB8A 2BOBB 2G60L 1MPAH 2IBZX 4LL4A 5DD3L 3SDDA 3SE9H 1YO4A 2C3VB 1SDDB 3M86A 3WO4B 1ITBB 1ZTXL 1S5IH 2BS8A 5FOJA 4F7TB 1BM7A 32C2A 3ARDD 4UTAA 1G5GA 3QA3A 1KIQB 5T3XL 2XDHA 4H20H 2OMYB 5F88B 3V4VH 2BOBA 3G6DH 2FGZA 1FH5L 2IPUK 3C09B 3DETC 4J3XA 2YA2A 4LMQE 4IBUA 5I76B 5DR5H 5BRZB 3DX0A 4HV8B 4UTAH 3AQXA 4OF3A 3EUDA 1PD0A 3RWHA 4BA0A 5IMMA 3EGSA 2CUIA 2H6PB 2V3EA 4OLUH 3CMOH 3FC8A 2CUMA 1E4HA 2XQBL 1FL6B 1AD0A 3CFCL 1S7SB 2IDUA 2Q87A 1AXSA 1OK0A 4IDJL 2HKHL 3E6HA 4FXKC 1U92B 2M83A 4K7FA 2YRLA 4U33A 4XPFL 1JF5A 4JN1H 1G6VK 3ZYJA 2PW2A 1S7TA 4YO0B 2QPFA 2ERJB 4UZUA 1MJJB 1EAJA 4S1QH 3RAJL 1JFHA 3MV11 2PWDA 3LIZL 3WTXA 1YEDA 4H1LH 2WKGA 3MV8B 5IFJB 3BT2L 2L7QA 1IQDB 3CFDA 4KRPD 4WO4B 1EWHA 4OCNC 3SEPA 4LHUA 2WMPB 1C7SA 1PKQA 2JELH 3CZKA 1INQA 1WIPA 2MRYA 1J9SA 2R56H 1JZDC 1QFUH 1TJHL 2JIXD 4ZXBC 15C8H 1P1ZA 1PSKL 2X09A 2IDCA 3LX9A 4JFVA 3WNNA 4ZD3L 1IFHL 5I66B 5JZ7D 4RAHA 4Y5XC 4JK0D 3BH9A 4X0KA 4XO5A 1ZGLA 5I75C 3F64A 1JRHL 3QCUL 3ECBB 4JREC 2WMPA 1AIZA 1T21B 2ADJB 3MBEB 1WHPA 4OCSL 4AV0A 3R7QA 4WK4B 1YMME 2OSWA 4BWTA 4P07A 3QZLA 1AHWC 2DY2A 1XB6A 3H9ZA 1WHOA 2BHUA 5HI3D 1LDPL 1Q8MA 5HYIA 3W5NA 1KYOJ 2O4EA 3OSVA 3AY2A 4PJDA 1BX2B 3C5ZA 4FA6A 3QDAA 5CLWA 3JQOB 1KB3A 4J1UA 1NGYB 2NUTA 1RZKH 3WIHH 1X5LA 3KH3A 3JV4B 3SPCA 3VMNA 4KZEH 2PF6A 4N28A 3KBHE 2C9SA 2IV9A 3C8KA 3N50A 3NA4A 3W11D 3S88H 5HHVL 3EOBB 3B9DA 1B0GA 1JHLL 4O02A 2NXZC 3F04A 2XJLA 5EA0L 2FSEB 3TBTB 2NZ1A 5J6SA 4IRSC 3QNFA 4HX1B 2UZXA 4C4KO 3V79C 1G9MH 3OX8B 3ABZA 3WHE0 3HZYB 3O41A 4PGBB 4GSDH 1YJDH 4WHYH 1GW6A 2F19H 3IJSB 5FYKE 1XR8A 4I0PB 5DT1H 4DVBA 3UPRA 1QNZH 5B1BB 5SV3A 5GS0H 5GGVL 1VEMA 4L3FA 3AS3A 3RY6C 3ZQ9A 2P5EA 3T65A 4OLZL 4UUJB 4J3VA 5A2KH 1FFPB 4GQQA 1P7KA 2HFEA 4HU8A 2OMUB 3JWDC 5E2VH 1WBYA 2CDGB 1JPEA 4ELKA 4GBXD 4P23C 2V9TA 1Q9OA 3IFPB 2AFNA 3P11L 2VZSA 3MROA 4UAOB 1Z6JT 5KJRH 1BQLH 5I2IB 1BVNP 3PJLA 1F58H 4P46C 3OWEA 1N7ML 1LO2L 5BW7C 3MRNB 5I5IA 1MAMH 4UANA 2WQ8A 4TVPL 5AVTB 1UASA 4RBPH 3V0GA 2BP5M 4HD5A 2GSIB 4LSSL 3SO3B 4R2GD 4H0GA 5EEYA 2R4SL 2G3MA 1CFBA 4M3HA 3Q3GA 4OFVA 4RFEB 1U8KA 4KTDH 2AQPA 5F1NB 2Q8AL 3U79A 2EYSB 3V4PA 1E40A 3VG9B 1HYRC 3DYMA 5JW3L 3BPCA 5TDPA 5IBUB 5TQ0L 4Z76B 5JHDA 3D08A 4EUPH 5BUGA 2A9DA 1G9ML 1SLUA 5EU5A 5FOBA 3OHXC 3CZSA 4M5YH 4UWQB 1ZVHA 2R1XB 3AM8A 4Z8FH 3Q5TA 1KTDA 3QRFM 4OGAC 5I9QC 3V4PH 4JQVA 1FYTD 1HQ4A 1D5BB 1T7VA 1YMHA 1YNKH 2AXWA 2P7TB 4G5ZH 1U8IB 3NDZE 3LPWA 2HLFC 3BVNB 2E7BA 4RH4A 4JN2A 1EERB 4J6RL 4FAAB 3RWEA 1JGLH 3O3AB 4KU1A 2Q8BH 4UQ2B 2X4NA 1W9XA 1U21A 1A4JA 4W4OA 4QO1B 4IK7A 4OTXH 5EBLA 3RJOA 4X7TB 3NN8B 4K3JL 5GS1B 1QLFB 3GMOB 2MTPA 1FIEA 2W07A 3VQMA 4MJ2A 3NMEA 3KYAA 5DS8B 4XAWL 1MREH 4I4WA 4GAYB 4F37K 3MV8A 1AO7A 1P5UA 2AJVL 3QJQB 4MKMA 1JMXA 3QO1A 4JY6A 4QLRA 4Y16D 5D4IA 1ETB1 1FORL 1FJ1B 5LBVA 2BVPB 4HJGA 4NZJA 4ZX6A 1GYCA 2OP4L 5I1LB 3HBQA 3QHZH 4KNQA 1IQDA 3QJSB 5I1KL 2CHWA 4QWWC 3C5SA 3VE0B 2XKUA 4JAMB 3FH8A 1CBJA 4W70A 3F7QA 1JNNL 1XGTB 2UYLB 1ZHNA 4HIIB 5K9KB 5A2AA 1ESOA 1AZNA 2ODIA 1WO2A 4PLKD 1XGRB 2WXJA 4KX7A 3TO4A 4BE6A 5DRNB 4BZYA 4MRCA 3BXNB 3VGEA 5MEQA 4KROD 3W82A 5ESQB 3RQ3A 2HVJB 4HUUA 2WAQA 5IJKA 2KDGA 4W9ZA 2E8ZA 5DGRA 2C9XA 2XN0A 4I1RA 5F7DA 3QCTL 2RCSH 5H4YA 3CN2A 5DGQA 4OLYH 1DL7H 2AI0H 2EACA 1QKZH 3L81A 2PXYB 5DI8A 5KTEL 2AS5M 4ZXBB 5JLZB 1X5YA 3E1ZA 3PWLB 1HSBB 3APFA 5GHWL 5CJQH 1WTGT 4K07A 3VI4E 4TQEL 5F7AA 1CFNA 1UWGL 4OIAA 3NJGA 3V0EA 2FLMA 3G6DL 2OXGA 2A83B 4L3ED 4U1LA 2YLKA 4X42A 3UDWC 1OAYL 1XH0A 5KJ4A 3VYPA 2J6EA 2B1AL 1OF0A 2MPAH 1QEXA 4FLRA 4GRLA 4MVBC 3CMGA 4YHNB 4Y9FA 1WAAE 1V27A 3HKZA 1S9WA 3FULA 5D96B 1HESA 5E6ID 4K71B 3RPBA 4WWOA 1E8WA 3IDIB 2IIJA 4MNQB 3QFDB 5EU4B 2NDGA 1NAMB 4JVUA 2W92A 4KI5C 3WFDH 4YQXH 2J5LB 3EYQC 5E2TH 2BSTB 2EDMA 4I0PD 5LWYH 1PEWA 1F02I 3IBEA 3QDJD 5C2UB 1UWGH 4KKBD 4JPVH 4B7LA 2FGWL 3QJVB 4X4MA 3G6JE 2CJUL 1EDHA 1KGIA 4JHAL 1CT8B 2DYSB 4M7LL 2A73B 3CDGA 5CMAA 5K9JH 5F3HB 4AXWA 4XHJD 2VDOL 2YKKA 2X4SA 4EZMA 1IKNA 1J11A 2BNUB 5E9DB 4PG2A 4C56E 4AVHA 2GKIA 4AQ8A 4LLVB 5DLML 2RQEA 5E2WH 4NZFA 5HYQB 1YNTA 4UQBA 2GPZA 1F3DJ 4NHCL 4JDVA 3ZDZF 1B0WA 3X3FL 4HG4K 3KM2A 4ELDA 3GMRB 1JFQL 4ODTL 3KEDA 4UV4L 4U1IA 1P69B 5K69A 4Y1AB 1KCLA 2EP6A 4PREA 4MAYB 4Z7QE 3HNSH 5D70H 1S3KH 1NSNL 5FK9B 4YDMA 3U4AA 4AUUA 2ZUYA 3AG3B 1FNFA 5ACZB 2KMWA 5DJXB 4YVNA 1G4RA 4HXAL 3QR1A 5JPMA 1UH3A 4X5PA 5AZ2L 3EKCA 1AZRA 2BSBA 1CDUA 1F58L 1B2WL 1OALA 4Y5VC 4ZDHA 1MHHB 1E2ZA 2WOYA 2VSMB 4PP2B 4UCFA 4OV5B 2CK2A 3X13B 3VD2A 5I8CA 1EBAA 3H9SA 4J5VA 4V2BA 1A6VH 2BDNH 3WKML 3ESOA 4BSVB 1J1PH 3QO0A 1RSFA 3B6SA 2HVKA 5E5LA 2JJVA 4WGWB 4L0PB 1BXUA 4RZCB 2VZTA 1PZSA 5EZJA 3VI4A 3HZMA 4I0CC 2AF2A 2H6OA 4YHPA 1X7SA 5F2FA 4PGCA 1G1CA 1G94A 5E6SB 1BDYA 3SE3A 3BPLB 2NY5L 4Q52A 5FYKD 2NY4B 3GSOA 4Z0XB 1BZ7A 3CFJB 5KG9A 1PZBA 3AGWA 3VYNA 3I9PA 1VGEL 1XWVA 4ONOA 2XZZA 2VC2H 1U8QB 5IROC 3V4PL 3VXMD 1U3NA 3ZDZB 1RQ5A 1CD1A 2PR9A 2XWDA 2YD0A 4HZAA 4KDWA 3LNEA 5EORL 3Q8BA 5CP7A 3Q44A 3BX7C 4EVNB 3HLAA 5HHVH 1NOFA 3HNTH 4GUPB 3X1FA 1FNEA 2Z7WA 5E4IA 1OIOA 3IN2A 4K3EH 2QPSA 5IEKA 1HHKA 2H9GA 3L7FA 2C4FT 2V2XB 1VADB 2QKIA 3P9LA 2DQ6A 2OTUA 4NM8H 2X2IA 3OKEB 5EO0A 3DX7B 4IIZA 1FL3B 3WFEL 4LSSH 4XN2A 4Q74A 4NSKA 3T3MF 5EUKA 3ZHKA 1R5IA 1SJHA 2UX7A 2XRAH 4U3SA 4DQOH 1J05A 1YPZA 4JFPB 3KM1A 1YMMD 4AMKL 1HCFX 4HX1A 4ZNEA 3GIZH 3LQAH 1GZPB 3EJPA 1QSFD 2NUPA 1CI5A 4QCIB 1R5WA 5LHDA 1HZHH 1KTLA 3DV4A 3EHBD 2A9ML 1GY2A 1BQHB 4R2GC 3ARXA 3AAZA 3FUIA 4XMUA 3QEQA 1ET8A 1U8IA 2DH2A 3L45A 5DEJA 1CMOA 2FJFB 4TQ8A 3UOAB 4OI7A 2IH3B 4M48H 4YHMH 4O2EB 3UZEA 4DO6A 4HUVB 4H13C 1G84A 1NIBA 2WTRB 3L16A 1E9PB 5ID1B 3SKJL 2UVFA 4JHWH 4HIPA 2YA0A 2YWYA 2BVOB 4KMQA 1WS8A 2ATAA 2WINB 5DJZA 1JGVH 3AITA 2BNQE 1A0QL 3CXFA 3ULVH 3AB0B 1L7TL 2DQCH 4AWJC 3JZYA 4FXGA 1MSPA 5GS0L 5E1AA 1AOHA 4JFEA 4YHIA 4WEUD 1UTDA 4TTGA 4ODHL 4FYRA 4NXKA 4OM1L 1HYSC 2WBJA 4I18B 5CSBA 4JM4L 3RZWA 2J2ZB 2XKNB 3B9AA 3DBSA 4HALA 4NRYA 1HILB 3BCFA 4OZHB 4PFEA 3N42F 2VXUL 4D8PB 3CVHB 2LU7A 3B2XA 1IUZA 4BD4A 4AGLA 2E9GA 1WC7A 2J21A 1L6ZA 4PJ7B 1WBYB 2YOAA 4FA8A 4I9XA 3M17B 1NICA 3DMMA 4NQEE 1OE3A 4OLXL 5HVHB 3WFBH 4HT1H 2OFQA 1FP5A 2WVVA 4L3EB 1S3RA 3P1VA 3ARGA 3EFDH 3EJCA 4ODWA 5D7IA 5DJ8B 1AMXA 1F97A 1FDLL 5C0DA 1ZHLA 4Q89A 3P73A 4DESA 1SVZA 4MDJB 5HI4D 4XMLH 2AV7B 5AYQA 3P4NA 3VFGL 1EX0A 5F0JB 2BNQB 1DFBL 4B6ZA 4B60A 3PGFH 4PJXA 1A6UL 3T4YA 4MAZA 4NLAA 4U1HA 2NNAB 3SGKA 3DSNA 1QZNA 3J7HA 2PXYD 3TV3H 1NCWL 4EDWH 4NUQA 3OAZK 4NO2B 5E00A 5E2TL 3MNVB 1O5DT 2LR4A 2IALA 4H8WH 3RWHB 3ZRCC 4XC3L 1KGUA 1VFAB 2Y5EA 3N44F 5B39B 4GG6F 3REVB 3HR6A 2E4FA 2YEZA 1SPDA 3E2HB 3MNWA 1CG9A 1XDTT 4NM4L 2QDVA 4FFZH 3VYOA 2WXRA 1DBAH 1EO7A 4UT7L 5JOFB 2WIIB 3KPNB 4L0ZA 3EHBC 1FFOA 3QDGE 2WVSA 1DDTA 4F8TA 3WEXB 5DK0B 2CXKA 4PMEA 1V7ML 4H25A 4H8QA 2DYPB 1KWKA 3IJEA 4HIJA 4K3GA 3EO1A 4TRPL 1F8TH 1F4YH 4QR7A 5ICYB 3CBRA 4WIQA 1CFTA 1VGKA 3MA7B 3QEGL 3V5KB 1FFRA 1DO5A 1ZA6A 4UTAL 1N5AB 2Y4SA 4NNPH 3TLRA 2BIQA 1LD9B 2E0PA 3QEQE 2EO9A 2NY0C 3QQDB 3CZFB 1CZ8L 4QYAA 4WU5A 2V2TB 4NENA 3V9CA 3R0NA 3IRPX 2XQBH 4YSEA