2LW3A

Solution structure of the soluble domain of mmps4 from mycobacterium tuberculosis
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
90
structure length
90
Chain Sequence
b'MHLTYEIFGPPGTVADISYFDVNSEPQRVDGAVLPWSLHITTNDAAVMGNIVAQGNSDSIGCRITVDGKVRAERVSNEVNAYTYCLVKSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative membrane protein mmpS4
publication title Discovery of a Siderophore Export System Essential for Virulence of Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Membrane protein
total genus 1
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2012-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2880 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2lw3A00
2LW3A
chains in the Genus database with same CATH superfamily
3U2IA 4KJPD 4X8CA 1KXTA 5J1SC 2HRPL 3LTVA 5DJDA 4X0KA 1HHGA 3EOAB 3QARA 4PRBA 3KEDA 5GSVA 4CJ0A 5DD1L 1Y0LA 5ELIA 1VGKA 3O9WD 5ITBL 5E00B 1JNLL 2E7DA 4U2YA 1HHJB 2VDQH 3VSQA 5DFVC 2IGLA 1JXGA 5BZDB 1E7UA 1KTCA 1I3VA 5CGYD 5LBSH 3VX0A 1JZ6A 1K85A 1MCQA 5C7XL 2I9LA 4CVWA 4MDIB 3QEUA 3JWOL 3I75A 2Z8VC 2GUOA 2F5BL 4WEEA 2GAZA 2OMZA 4X4XA 2CH8A 1AGEA 1P7BA 1U8PA 1ZT1A 3EFOB 3OXSB 4WUUD 3EJYC 5ADPL 1NLDL 5EEUA 5EC1A 3MLXL 1VFUA 1VFOA 2YWYA 1CXIA 3DUUA 4GS7C 4TVPE 3CVIH 5LCVH 3RDTA 3SO3C 5T3XE 4XVTL 2ADGA 2NZ9D 3FFDA 4O4YH 3I6SA 2Q10A 4JO4L 3TO4A 5BUPA 5GGVY 1TYRA 3L45A 3WY4A 3RE0A 5ITFA 2BM3A 3X3GL 3ZMEA 3WFZA 3CDFA 3QZLA 1UWGL 4QTFA 1OQOA 5E56A 3TYGH 3IAQA 2KS0A 1MJUH 4YSRA 3UTTD 3VD3A 2MIZA 3DX2A 2YBRA 1WV7T 3U4BL 3B34A 1JF6A 1IEAA 1G7QB 3F04A 4IU2A 4E9RA 3IB4A 4N2HA 1BECA 2X7LB 1YNTA 3AACA 5F3HB 2IH1A 1KPVB 2FWOB 4TUJA 4YZWA 2IAMC 1KLUA 1OZTG 3SCMD 1QEWB 3IS0X 4PW3A 2EVIA 2G75B 3BWUC 2XY2A 3FCSB 2P5ED 2BRRL 4ICWA 4KHTH 3T3PF 3PWLA 4QTIL 1IMHC 2EXWC 2MQ3A 4X80H 2WM0A 2JQMA 5L2JB 3QEQB 1JD7A 2DLFH 2VDRH 1XL6A 1P4IL 4FNTA 1W0YT 4L4TA 1YC8A 4UQ2A 4DGVL 2QVIA 1JPEA 2MRYA 3G5XB 4IQHA 4JDVB 4Z0XA 2ZUTA 1NL0H 1TTFA 5IESL 2PO6A 3LEVL 5DU7A 4FD0A 3QDJA 5JA9A 1HQRB 1QFUH 2EXYD 3JUYA 3MKKA 3MUGB 1CLOH 3L4TA 4ETQA 1LDPL 4NN7C 4DGIL 1KB5L 5E7FA 1ORQB 2W59A 3ISWA 1PSKL 3C60D 5GS3A 5EU6B 5FOJA 2DLGA 2GYSA 4N8VA 3L5IA 1MAJA 1KXQA 1KGCE 4LLYB 1TU2B 2YO3A 3TT3L 1QEXA 3FRPA 4J3XA 3ZKNC 4LPYA 5FKAB 3BRFA 3R0MA 5IVXB 1BIHA 1EZVY 3DIFB 4MMXC 4KKRA 2JLLA 1OM3H 4NHCH 1H9DA 4F8OA 2WSPA 4NCC1 1UZ6F 3GI8H 1M56B 3DIVA 3HS9A 5IT2H 3GXPA 1OAZL 3VI4E 2VRQA 1URLA 1S7SA 3ZK0A 1Q94B 4RRPG 2MHAB 2ENJA 1RL1A 2Z92B 2XWZA 4N8PA 1YPZB 4GAGH 4F20A 3MLVH 4HUXB 2DM7A 3FQUA 4NN5B 4ZX4A 5D8JH 3NIGF 1EANA 2APXA 4AGQA 5C0RH 2OPCA 1HEZA 2DKUA 1D2PA 2V6HA 2V0AA 2VLLB 3ARUA 1AQMA 1C5DB 3PPEA 3B9KB 2PPDA 3Q2NA 2BRQA 1HXMA 2X9XA 4HHAA 5DJCA 2J55A 1MVUB 1ZHBB 2OP4H 3LMJH 1ET8A 1IAII 5JTWA 4R7NA 4AZ8A 1FSKB 3IKCA 3MLUL 2Y7QB 3V4VL 2Q76A 1E3ZA 4J39A 2IIJA 2VABA 3FH8A 3N44B 1J1XL 1IC5L 2XIDA 3B8YA 1ZVNA 1G1OA 2JV6A 4MB1A 1UJ3C 4FZ8H 3H7LA 3VDCA 1IAOA 4P2CG 3GMOB 3FAXA 1BA9A 2OZ4H 3VI4B 3QI9C 3L13A 5AVZB 5PCYA 2DMKA 4WJ5B 4Y5XC 3IF1B 3PHOB 1ZTXH 4HS3A 1BSIA 4OLZL 4ATTA 1BMWA 1SJXA 1QSFA 3B7SA 4M43L 1EAOA 2OMTB 4AH2A 1FL6B 1R24B 4ONHA 2MOQA 5DD0L 3ILPB 2WLYA 2QFPA 3WIHA 1YNLH 5F1NB 5I16B 4ZUWA 2Y23A 3IJYB 2IXQA 4KNTA 3VAEA 4WTWA 4NKDB 4URKA 2PLTA 3QS2A 4UYPA 3RWHA 5LVEA 4KQ3L 3EBGA 3TM6A 2AEQL 1CPUA 1WK0A 5J56B 4GFTB 5DEFA 4ZQKB 4F7MB 2MCPL 1PLGH 1P7KB 3NAAL 3P9MB 4IJTA 3O2DL 3QIBD 4LEXL 2OMVA 1FWXA 4N6RA 4L0YA 3HS0B 4MQTB 3SJVE 4NM8H 4AQAB 4F15B 4FA7B 1U8MA 3QQNA 2AHIA 1VFMA 5A2JH 2WN2A 5F9OL 4N0FA 3UJTH 2BVYA 2NTSP 2O5YL 3T3PE 2NNAA 3H2WA 4TPRH 2D31B 3OF6D 5H35B 1RUAH 4X50A 3VQ2C 4MAZA 2OS7A 4XCEB 1WHOA 4G8IB 4QRPA 1DHKA 1HHHA 4Y19B 3U6XA 3NA9H 1OGSA 4BUHA 1RPQA 3MRKB 3ZT6A 5IIEA 1PIFA 4TUKH 2VC2H 2AERT 3GSNB 4OAWA 1FFPB 4OCXL 2J88L 5LG6A 5EF2A 4K55A 3O3AB 4WI7A 4FHBD 4DW2L 3QRBA 3U36B 2VLJB 1QSEA 4TTDC 2VXQA 4ABQA 1CGYA 3D18B 4PI0A 4ZBJA 4LBEB 2YA0A 1BGXH 1HT6A 1BVNT 1GMEA 2G2PA 1F18A 1WIOA 2ZPKH 3RDTC 1QUNA 3ZMRA 1ZHLA 3IMSA 1IL1A 1D5XB 4FKKA 3TO4C 2FJUB 1D6EA 2DQHH 2GC4C 2XZQL 5B3JF 4RMTA 1GYAA 4LSVH 1NC4B 4C83B 2DD8H 1NUGA 1WFOA 1K6QH 1QFWM 3K91A 3L7EA 1ZLVK 3W0WB 3ZUCA 1Q0EA 4BFBD 1OP3H 2FR4A 1KBPA 1RJZB 1IBGH 3T3PB 4MWFB 3VRJA 3G6JA 5CBEB 3NJXA 4CL7A 1GVIA 3P4MA 4JHAH 4ERSH 3U0TB 1NCBH 4PJ6A 4HH9A 3EW3B 1S9KC 1C1EL 5DMKB 2BCKA 4PMFA 2OTWA 2XTJD 3NEEA 3WLBB 1OSEA 4JY5H 2VDOB 2QSCH 2FO8A 2FJHB 3OKOA 1L7TL 3CQFA 3NIGE 4AGLA 4XBPB 3MFGB 4A2GA 4FABL 3UPAA 5IBUG 1JZJA 3MFFB 5GGRB 43C9B 2JB6B 1MIEH 4ZMNA 4XNMB 1DN0B 1I8KA 1M1SA 1N64L 1RURH 1L9RA 3FUDA 5IB4B 5L6YL 4K5MA 5ACZA 2ZOOA 1M7XA 1Y18B 4LVHC 4J5VA 3KPSD 5J1AA 3N43F 5B1CA 1NUNB 5T3ZL 1MCKA 1N4XH 5DGRA 3JYCA 1AQDA 4WEUD 1JPST 4HS8H 2EDHA 4XN5A 4NQXB 5AL0A 3EYQD 3HJEA 4P4KB 4PGCB 4IBUA 1PBYA 3Q7JA 1N5AA 3QBTB 2PO6C 5F7YC 5I2IB 4JFZL 1QW8A 5BPPA 1BJ1J 2DTSA 4XH2B 3NP4A 5FGCE 4J8RA 1S8DA 4FFZA 2IBZY 1L7IL 3PDDA 4RAVB 5C0CD 5I82A 5B7EA 1D5RA 1MCDA 1OSPH 3VI3F 1MDTA 1URZA 1G9NH 1O7SA 4QRRD 4H44C 4R7VA 3TJPA 4ELKB 1DSFL 4KTEH 3QUHA 4KY1L 4F5CE 3X14A 4A7QA 2WMPA 2YUWA 4UM9D 2ED8A 3DJ9A 4W6XB 1IBDA 2G2NA 1A1OB 3PF2A 1L5GB 2R1YB 5GGSA 3SPJA 1MFDL 3GXNA 5D9SA 4XHJC 1QR1A 4FQ2L 4BSWA 5E2UL 4LFHD 2CJTA 3P9WB 4MS6A 4P3WA 5D7HA 3EAKA 1FG2A 1WA2X 1W72A 1KNOA 5I6MA 3L48A 2OTPA 5BRQA 1KEML 1XXFC 3QS3A 4PR5A 3VXRA 4AYID 1TUPA 1OANA 1OVZA 4A7VA 4BZ1H 1F45A 3SBQA 4JG5A 4IIQA 4WU7A 4ZX3A 5FGCB 4JQVC 4NB7A 2ZYHA 1HSAA 3HNTL 1U6AL 2DMBA 1C5CL 3DPBB 1HSBA 3NRFA 3TWCL 1YMMD 5IJBC 1N0LA 1GIGL 3IWUA 3C5JA 1D6VL 1MRDH 2DKSA 3PXJA 4XMZA 4EN3A 5K5YA 3IFOB 1FZMA 3OX8A 1FNGA 4NXSA 1JGDA 2MQCA 4ICXA 2Z35A 4HJJL 4ACTA 5GGUB 4KU1A 1A4JA 4N6QA 4UT6A 2DM4A 5EU4A 4J3OF 1A3ZA 4ONOA 4AEHH 5C97A 1O0VA 4N0YL 3US0A 4NENA 2X3BA 3AADB 3FTGA 3LNDA 2XQYA 4DGYH 4EIUA 4GSDL 4ODVL 2HH0L 4XX1G 5I74B 2IO5A 1A6VH 2EICA 5JIPA 4UUJA 1LP9F 2A4ZA 3PWPA 1BJ8A 3B3IB 3H3PH 3Q1SH 3ULVD 1BZ9A 2XQBH 4B27A 4R90H 1I1AD 4JS7A 5HGAA 4F1ZA 1U8OA 3EG9B 4KRPD 3MA7B 2CCLA 3V8CA 1OCRB 2I07A 4ZMZA 2LT9A 2NSMA 3QULA 2HMIC 4RISL 4Y9GA 5HJ3A 3GMPA 3H4FA 3UBXB 4WFFD 4ZTPL 1CDJA 2NY5C 3WXVH 3OLEA 2IALA 4DUWA 1DJGA 1NCOA 1PJ9A 1XIWD 3VGEA 2XNAB 1XGQA 1CFQB 1UH3A 2R2CA 2KLSA 1A8JH 3TBYB 5MHSE 4MS8C 1RMFL 1YY8B 2F7PA 3VFMA 4E41A 1AR2A 4ILDA 4O02B 1E50A 1T03H 4NKOB 4NC2B 1VGEH 4TSAL 4XPHH 1P7QD 1UM4L 5BV7B 4CNIB 3KWVA 4BA8A 4GW5B 1C8PA 1TCRA 2L7JA 4F7CB 4OLYH 5AUMA 5E8NB 5DXWA 3RY6A 1HNYA 3LH2L 3O4LA 2A6IA 1CS6A 3IDXH 1XZ0A 3MCG1 2VQ4A 4XMVA 3JQOB 4Z7IA 1F4YH 1JG9A 2EH7L 2W07A 4P05A 4MMYA 1HI6A 3CVBA 3KPMB 5FECB 2HPTA 1S2EA 3S5YA 3QAZC 4FKHA 3NTCH 4Z7UF 4NKMA 3M45A 5ID0A 1EHXA 4RWHA 1P2CB 4JPKH 4PEEA 5CCKH 3QORA 3P30H 4R4NC 3EYFB 4LASL 3K2IA 4FNLL 1MWAB 5EU7E 1S5IH 1B3IA 1FNHA 1MCPL 2Z91B 2PCFB 4AMXA 4PJXE 1MF2L 3KPRD 5J6HB 3GEWB 1XF4B 2CLZA 2GT9B 3AG1B 2O6PA 3GJEB 2FT6A 5D7EA 2CDEA 1G9MH 1KIQA 2R2HA 2WIMA 2ZE0A 5HYSB 2I7OA 3LIZH 3KPLA 3QDGD 4JFSA 3BP5B 2AMUA 4MJ4A 2VDML 4ODHH 2BSRB 3C5SB 2G9KA 3DETD 2BHFA 2BY3A 3NCJH 3BPNC 3LV3A 4LCWE 4K23H 3CHOA 3WFCH 3VB8A 6PCYA 1OGPA 1KTDB 2IPUK 4NWTL 5LNGA 3GNMH 4LEOB 3F00A 4U1HB 1J18A 2XDHA 3PUUA 2FGWL 4HIHB 4Q56A 3UDWA 4ABWA 2W0KA 1KY7A 2EDNA 2Y6SC 2VDNB 4JO3H 3NFNB 1V3JA 2HJLB 3CVCA 1UM6L 3GSVA 4NO2B 3V0GA 3UZQA 5IFHL 3BCDA 1RZQA 2VITB 2X1WL 4N2FA 1FGNH 3U7AA 5D2LB 1E4WL 2DS4A 3EH4B 3NSXA 3TO2B 5F6IB 2V2WB 1ZSDB 4PRID 4BEIA 2YQ2A 1SLVA 3KGRA 4PJXB 4KXBA 3ZN6A 5E8DL 1T5XB 5ANMA 4HKXA 2NY5L 4YHML 3IJHB 1XQ4A 2MNUA 3CXHJ 1T4KB 3FQWA 1D9KD 2ZD0A 4I5BB 4A2DA 4Z1PA 5KBLA 2WXNA 5EV7A 2NSQA 3AMLA 3WTSA 1N6UA 3FN3A 3ISYA 5B38A 5B1AB 5HHME 1M71B 1T2QL 4P2YA 3EOBA 5C07B 2OX5A 2NQCA 4LLVB 4Z3GA 4MJ5A 2EKJA 4XC1L 2F54A 2ICEB 1SZNA 3LS5H 4PV1C 3LH9A 4WGWB 5ILTL 2R29A 3WTYA 5FW6A 5IMKA 3OAUH 2HG0A 1UXSA 1IQDB 4ZMAT 2ZKXA 4ZUTB 2YD5A 5F7EH 4UTBA 1MJJB 4Y4HA 1U58A 1J9SA 1T1XA 3S96B 1EJOH 1K8IB 4QTHB 4P2RE 2E9IA 3E6FB 2OJZH 2R0KL 2JKWA 3L2MA 1LP9E 4G70B 1JNHA 1LLAA 1NC2D 2EIBA 3CFKB 4O58H 5FUZL 4BE6A 2K9FB 1A25A 4NO0B 3ATBA 5MENE 2D03L 3E8UL 3T9WA 2YWZA 1GZQB 5L2KB 2BC4B 4LO9A 1JVOA 1TENA 3MLRL 4LKCA 4ZDHB 5CGMA 4A6YH 5IQMA 4YSQA 3B2XA 1Q9OB 2Q7AA 3AWEA 3I9GL 4OCNC 3T0EA 1MCWW 1I9IH 4F8NA 5D1QD 2Y5TA 5TQ0H 2R23B 2AJZB 1UQSB 3IJ7A 5HHMB 2Z1KA 3VNYA 1IJNA 2C9XA 4IOSD 4PJ7A 1X9LA 3WHE0 2G60L 4GO8A 3RWDA 2VXQL 3BOVA 3P0GB 3EH3B 1SY6A 4PJBF 3WD5H 2P7TA 4IIQC 5A1AA 3SE3C 1IGMH 2OXHB 1QP1A 3QCTH 2FWUA 3ARTA 4MLSA 3SODB 3K3QA 1X5XA 2DM3A 3ZDXB 4HYTB 4PJCA 5E9DB 3T8XA 5BVPL 4KKLC 3TESA 1PAZA 4LDCA 4NQCA 3PIQB 3NCYP 4BXSV 3H2QA 4EN3C 2IH3B 4P2RB 5CZVL 1OTUD 4RGMC 1LP9B 1Z7JA 3TN0A 2OBGA 3L95A 4NQVA 2E7CA 3FU5A 2FQDA 5HPOA 1S7TB 2GJ6A 5MENB 2FL5A 4NNYA 3SKMA 3SE8H 2FX7L 1R5WA 4V11A 2WTOA 1XH0A 1NGPL 1Q9LA 3D39B 4B3EA 4OGAD 1WZMA 1M2OA 3MR9B 1N6VA 4K2UL 2XSKA 1DN2A 5EB9A 2CBTA 5HHPB 4FYQA 5GS1B 1N10A 2AVGA 4CVZB 1KELH 3GLAA 3KW7A 5ESAA 1UA3A 4WJG3 1K8DB 1QFPA 5E6UB 3HZ3A 4M7ZB 1T22B 5K39B 3EDJA 1WAAE 2PYEE 3MGAA 4HJ0C 2X4QA 1AZCA 4RZKA 2VIRA 1ZE3C 3EHBC 3L4ZA 4XP9H 3V95A 4BIKA 2R7EA 3DGCR 5D70H 3QPXL 2BLFA 1ITCA 3CFJB 4G6AC 4GQQA 4P48A 3GDBA 2HFGH 3DGDA 5HDWA 3UGXA 5GJSH 5DRXA 4FFZL 1WHPA 2WLLA 3KS0H 2WO4A 3MCLL 5F0PB 1XGPB 3GHPA 1ZXKA 1AOZA 3TPUA 3APNA 4GAAA 3MRMB 3SBPA 2DYPD 5DC2A 1IM9A 4K8RD 3F7VA 4CKVX 4MMZA 3CZLA 4JG1H 1JYVA 5IQ9A 1U3HA 2VRAA 5KJ7E 3D33A 5FYKL 3IPFA 3KBFA 3RY6C 4GXVL 4PBDA 1ADQA 5IFJA 4OKVA 5E6RB 1KB5B 2VZUA 2WY3B 3P11H 4PRPD 4XNXH 3REWB 1I7TB 3RURA 2W80C 1L0XA 1YQVH 5AB2A 2W0PA 3RFRA 3TC9A 1W72L 1ZV5A 3NIDB 3MV9B 3US9A 1SLUA 2VSDA 5DEGA 3WXWL 4QWWD 1CL7H 2NZIA 4Z8FH 5JIIA 2IAAC 3I2CL 4U0RC 4RSVA 3QORC 4K3JH 4AKQA 1FL5B 3U1QA 3MOAH 5ECJE 3MNDA 1A3LL 2KL6A 3BYYA 3Q3GA 1A6ZB 3ASWA 5DS1A 2QHRL 2CPUA 1QUPA 3Q2CA 4DCQA 4M03A 4D9RD 1D7FA 1LO3H 3PNRB 1Q0YL 4OF5A 3ALXA 4PJ8A 4AXWA 5F7FA 2W38A 2G5UA 3A22A 1OSZB 4RRPM 1FFOB 5EU3A 3TFKC 3FFOA 3U9PH 3ML8A 1UWXH 2HA1A 4KTDL 2ATKA 4L37A 4UT6L 4N8UA 4WSGA 2EVHA 2YGVA 4NC1E 4GS7B 3SO3B 2JCWA 2HTKD 3PDOB 4HFUL 5FYJH 2AEOA 4AMKH 1CFMA 4PBVC 5G4MA 5D93C 1YEDA 2WTRA 3V4VB 4DVRL 3UDWC 2J6EA 4C56D 4PHZA 4ENZA 5C86A 3FCGA 5D7JA 4JKPH 1JZ4A 1QKZH 2ZSVB 4P46A 5G55A 4WWKD 1WZKA 4ZUVB 1JGEA 4LLDB 1JPSH 2DQFB 3PHAA 4PJBE 2DL9A 4LVOC 4L18A 1FAIH 2AXJA 1R75A 3OB8A 4QRTA 2IAMB 3D6GA 5HJGA 1AP2B 1J5HA 1UKTA 1A7QL 3WFDH 3GRWH 3IFNH 4TNEA 4TVPH 3GHBL 3BSZA 1A7PH 3VXUA 5F70A 5KSVB 5T3XH 4S1DC 1EXUB 3HFFA 1AIZA 1TQWA 3JWNC 4NZTL 1UA7A 5B39G 1BP3B 1O9WA 3OR7A 3NSJA 3CG8A 4MJIB 2QR0A 2MNJB 3O2WL 2D7TL 2XWEA 5DHEA 1KCUL 5JW4Q 3UBGA 2ZWNA 4YDJA 4F7TB 1I7UB 3DBXB 1AKJA 1BQUA 5BQ7B 2FLBT 3LSOB 4NN7B 3TV3L 5C6WH 4U4BA 2KQMA 2DQUH 1AGCA 1MJ8H 1NAKH 2A9NH 2YMXH 5CJQH 5IZ7A 3ISRA 4LAQH 4UI2A 3H55A 4X99A 2Z31D 2DIEA 3BEWA 1HDMA 1B6UA 3QO1A 3VFTB 2YQGA 4YGAB 4P9HH 5I71C 3ES6B 3UABA 4PJBB 2NCMA 3T6VA 3VWJA 2PCXA 2PW2B 2QTEA 3MA9L 3QZWB 1XF5A 3W11D 1RZFL 4U6HB 1R5IA 4V1DA 3IETB 4MMXB 2CU9A 3CMOH 5C08D 5INDA 4CADB 3VVWA 5JUEL 1DBKH 4H8QA 1YDPA 1NIBA 4KROD 5IB2A 4IMLA 3D4YA 1CICC 4Z95L 3T0EC 4M5YH 5F96L 3ZDYE 5CR1A 3MZTA 4ZMTA 1O6VA 4R0LA 3UTSA 1JGUL 4GQ9H 1RZ8A 4G7QB 4TL5A 2FJFA 3BVVA 3K8KA 5DQ9B 1NGWA 2ZTBA 1CDHA 1D5MB 1LJMA 2H47C 3QEGL 3D0VB 1FCCA 1AOHA 3U7WL 1SLWA 2W0FA 3DVGA 1GA2A 2P80A 4PH8A 3LRLA 4MCMA 3GINA 3HI6L 3Q9QA 4YUEH 1KCRL 4Z77B 3A0OA 4TRPL 1JS4A 3EDKA 1OPGH 2C9RA 2NDFA 3BX7C 5DR5H 3S8FB 4ATWA 1RK1A 1VPOH 3MUY1 4C57C 3KBEA 3TN0C 4PJHA 4UQ3A 1IM3D 1ZV9A 5DHMC 1MH5A 1NOLA 1YYMH 1NWPA 4HSAC 2YN3A 4U31A 5T3ZE 1EUUA 3OZKA 1DSYA 4RZCB 3S36H 4QXWA 5KS9B 1UJ3B 4YHNB 2WXMA 4N2DA 1AR1D 1H6EA 1PCXA 3QDHA 4QRAA 4WUKH 3ZDYB 3BUYA 3V55A 3CH1A 2H3KA 3SDCA 1PZ3A 3FONA 1MEXH 2OCFD 3QI9B 5CU9A 1TOXA 4A2HA 2E8ZA 4RDQF 3CIQA 3RL1A 3SQOL 1IBZA 3L4XA 4Y5XB 3R19A 3ZW3A 3DO7B 2V2XA 5DK0A 1RD6A 1MCSA 4JFFB 5FYKU 2VE6A 3ZHDA 2G5BA 3RVUD 3FL7A 3IMRA 4KDVA 3ECQA 4Q74A 4U1NB 5C9JB 1QLEL 2VO5A 5GRJL 2R29L 1NOAA 4AQZA 1SJHB 1M57B 4RNRB 5DMYA 3D3VD 3BHBA 1CT8B 1HU8A 4UTBL 4TQ8A 1LO2H 3VE0B 5H37A 1QFOA 4X6DA 5KSBB 1B0RA 4FRWA 4MMZC 2F5AH 2R0WH 3QFDB 1CD9B 1U3HC 1F6AB 2ZWLT 3SDDA 1RIVL 4XPBH 3EYVB 4W9HC 1LE9A 2H1PL 1DDTA 1D7BA 3FO9B 1NBYB 4PJAF 2C7UB 4XMKH 1ZMYA 4NZ8A 4ODTH 1SYSA 3I6GB 1E42A 1V3LA 4HUMB 3C6LA 4AV0A 2R69H 1FLRH 5C0BA 4FXTA 3VACA 1GZPB 2C9VA 4UNVA 3MYJB 1CD8A 3KS0J 2HRGA 4N2BA 4N2EA 1YVLA 1SDDA 4XCNB 2HX8A 4PPTA 2APBA 2K8MA 1BYOA 1KXTB 2ZX5A 4QT5A 1DEDA 1LQSR 2DWEA 5DJDB 1FN4A 4X0KB 1HHGB 1BIIA 4PRBB 1S7RA 1SY6L 2BS71 3KZ8A 5GSVB 4WO4A 1Y0LB 5AL8A 4L9LA 2L3BA 1AGDA 4KK5D 3RX5A 3Q2WA 6FABL 1BOGB 2V4LA 43CAA 3UIZA 3TEZA 4GAFB 2HTLC 3KPOA 3O6FA 3GIVA 3MBED 4HWZA 3QEUB 3I75B 4PJ8C 5FO7A 2GUOB 4EF3A 3KL3A 5CHNA 4KFMA 1KN4H 2GAZB 2OMZB 4UINH 1SRDA 4X4XB 2UZXA 3HI5H 1U8PB 1ZT1B 1LXMA 1ZWIA 5EC1B 4W9FC 1V7NH 3V0DA 1F4XH 2CLVA 4NT6A 3DUUB 4L4TE 3RDTB 2BJMH 2I26N 2AGJL 3FFDB 1OV8A 3LAFA 1R34A 4KK9C 5ITFB 3TO4B 3CN0A 3BVNA 4G8GA 1YG9A 2CIKA 4HIEB 3TCLA 3VDAA 4TM9A 2UY7A 1UATA 2Y25A 3HNSH 4NJ9H 5D7JC 4Y9FA 1V3KA 1S9XA 3TNNA 4BWWA 3VW3L 4P46C 1YEKL 2AK4D 2YBRB 5CM1A 2YRZA 3WAJA 3AXLA 5A3IC 1CURA 3TBWA 4IU2B 4OZFG 4KUZH 4F9PC 4NZUL 1FZOA 1KXQE 4OF0A 4YS4A 2YD8A 2EDKA 2EYRA 1YNTB 1DANU 5IKCA 2IH1B 4BHUI 4Q58C 4TUJB 4O9HL 2ZX7A 3SGEI 3BGFC 3T2NL 1Q9KA 4AE0A 1N6QH 3LQMA 3PWLB 4DT2A 3B6SA 1U0QA 4N1EA 2V5RA 4LVHB 2QLYA 3CN3A 5BJTA 5MEOA 4L4TB 4FNUA 4UQ2B 3VXQA 4Z0XB 2PO6B 1MZYA 1NLBL 5IJVA 3SBRA 3QDJB 2YGNA 4WU5B 2J4WH 3LRMA 3MJ7A 4V2CB 4I0PD 1RZJC 5DUPL 3APFA 4N8VB 2NYYD 4J3OG 3PPSA 3TJEL 1J0JA 1NMCC 4NUGH 1K5WA 4ZUSA 4NM4H 2CKBL 3VWJC 2ENSA 3FRPB 3ZTNL 2YUVA 1JVLA 2CDFA 2Q9OA 4N8CL 1NMAH 4M7JL 5EWIH 1KWKA 1UOVA 5K9KA 1O5PA 4PRHA 2BVTA 4AVHA 4AENA 1Y7VA 4NHUA 4PYGA 3GBDA 1CIUA 4N90D 3QRGL 3MDJA 4E5XA 4FEIA 1S7SB 4R0LC 3WKNA 1I9RL 3VXSD 4KXDA 4JPSA 2CGRH 1TIUA 1UCBL 2B9BA 3FQUB 3QJZA 3QPQD 4QHKI 2HT2D 3NH7L 2OL3A 3IMVA 4LSPH 1HEZB 5E51A 1QSFE 1EMTH 4EI5A 4HHAB 1M05A 1OIOA 1HXMB 3POCA 3ZJAA 3OKKA 8FABA 3AXHA 5DJCB 1KYOK 5LDSA 2YAMA 4PJAE 2X41A 4WI0A 3BWAA 3GJFH 4NUJA 4R7NB 5D1XD 3IKCB 3PJNA 2XWXA 4GINA 2EUWA 2WKGA 1JWUA 1OL0A 4HKZA 2Q76B 4KBPA 2HB0A 5KTEL 5HGBA 2J6EL 2AJXH 2VABB 2WVSA 4UB0L 4MNQA 3WG7B 4ONGH 1OT1A 4OCRH 5D96C 2C1PA 2VDMB 3QCUH 5EHFA 4F58H 5LWYL 1PGRB 4KK8D 1IAOB 2D8KA 2E75C 5BQDA 4AK1A 2O30A 5AZUA 2V5MA 2Q3XA 2NZ1A 4LOUD 1RXLA 4M7KL 4I3GA 4M6AA 3V9FA 7FABH 2PTVA 3NCBB 5HDBB 4HS3B 3ZSTA 3QUMH 5HYJD 3KH4A 3CK0L 1QSFB 3N1QC 3BSZL 3QHFH 4JG0L 1UD6A 1JDAA 2F74A 4QNPF 5EZLA 4AT6A 4X6CF 1U3NA 1XTLA 4ONHB 4WI5A 4QRPE 3CV5A 4J7RA 1JTPA 1TZ8A 2NY3C 2K7QA 4ZUWB 3KH3A 2OSLA 2Y07H 2Z7WA 4JB9L 1MKFA 2IXQB 1GTNA 4FXGA 4XNUL 1QAWA 1S9WA 5FUCC 2ROXA 3FQTA 1QWHA 1INEH 4JE0A 5MP6L 1CN4A 1RZJL 3AU1A 4YE0A 5GSRA 5C3LD 1BM3L 5JHDE 2O1AA 4WI4A 4NPYA 3SDDC 2D7NA 1T7VA 1S78C 3LN5A 5DEFB 2FATL 2W95A 1AHWA 1NM9A 1S3RA 4YDIH 3SYAA 3NZUA 1DR9A 2OMVB 1J8SA 3MLWL 4N6RB 4KJYA 4B3VA 3C6LC 8PAZA 1FRGL 2K1MA 2BIMA 3NJJA 3SDXA 5LLIC 2YAFA 2WC7A 1U8MB 4H8WH 3FU9A 1AH1A 2JFCA 4HFWA 1G1KA 3CFDA 3AAZA 2Z4TA 4M48H 1H15A 3S3BB 2RIKA 1RZGA 3BIKA 5D72L 3FOLA 4OI9A 4HIQA 2NNAB 4AEEA 5A2KH 1I82A 3QAZB 4WO4C 4L9LC 4QRPB 1L0PA 4Z3IA 1EHAA 1HHHB 2VJ8A 1UXLA 4XVUD 3RWEA 4R4BA 2AJSH 3T0WA 2EUZA 3O6FC 2DY2A 4ONFH 5IIEB 3O45A 2EDJA 2O72A 2P49B 4JM2A 4WLCA 5DD5H 4Y4KA 5I1LA 2AQNA 2JKSA 3MHZA 1PX4A 1ZJAA 4NNPH 3WN6A 1OARL 1QSEB 1NFAA 2RALA 5C0ND 2ADIA 1DO5A 5E2VH 2XYBA 2H2SD 2XG5A 4FQXA 3UP6A 2EDYA 4JFHE 1KN2L 2X3CA 4JQIH 4AYBA 4OIIH 4XO4A 1QUNB 1ZHLB 3VFPA 3FF8A 1IL1B 1S9VB 1HX0A 1D6EB 3BPNB 3VXMA 3WE1A 4XXCA 5CIPH 2FQEA 1OGAA 3ZZSA 2ORBH 5F7DB 3L7EB 4JZOB 1X5KA 4HVBA 5E4EC 5KYNA 3K2KA 4UIKL 3W37A 2F7OA 1KLGA 2FR4B 3GF8A 1IGCH 1L9NA 5AW9B 3SY6A 3G6JB 4YHOH 3G5ZA 3P4MB 2J2ZA 4YX2H 4HH9B 3EXJA 3LNFA 2BCKB 2WV3A 3QEQD 4WI6A 2VLRE 4MFHA 2Q87A 3OKOB 5FYKE 3RZWA 1TZGH 5AKTA 4XPFH 1DQDL 2X4SA 4UZUA 4JDTL 4QRQA 3NFPA 4R4FH 2UZYA 4K94H 1I8KB 4ZRGA 3WNOA 1GTFA 3JVGA 5ACZB 3SKUD 2WZ0A 4E9SA 3SE9L 3BAIA 5J1AB 1OAUH 1CG9A 5EU6D 2HKHL 1OD7A 3DLQR 1AQDB 3JVFC 2WQ8A 1GJWA 3VXRE 2IADA 2Q1EA 2BIOA 4OZFH 1GC1C 5IROA 5I1JL 3ZL2A 1N5AB 5KW9H 1EAQA 5FA4B 1PW3A 4HULB 5FXCH 5AZEH 2G0KA 4J8RB 2N0MA 1S8DB 1USQA 3FC8A 1FHNA 5FK9A 2FEEL 2FSEA 3C08L 3BZ5A 4LAJH 2GPZA 1A64A 1KCBA 3S34H 2F19L 1ND0A 1RHFA 1U8LA 4XN1A 3HLKA 1EQWA 4MXVF 4LMQI 3RL2A 5LGJA 4YFLI 3LKOA 3O6LL 4HAFA 3X14B 3RU8L 2WMPB 3DX4A 1AAJA 1A0QL 4MX7A 4Z7NF 1AXTH 1J88A 2KI6A 1KXVA 3DYOA 3M46A 4XGZB 2OMWB 5AYUL 5EIQA 1T0PB 5GGSB 2YBGA 4Z7OE 4JO1H 5D9SB 4QNPE 4X8XA 3MJ9H 1NCCH 1QR1B 4BSWB 4KRLB 2UV3A 3B9KD 3BEVA 1RJYA 1UM5H 3EJRA 3FUNA 4HALA 4X6CE 3THML 1FG2B 3Q2LA 1W72B 1KNOB 1JNJA 1FVCA 4S2SA 3SPIA 1IGIL 3VM7A 3P73A 4I4WA 1I3GL 4CMHC 4E9YA 1Z0NA 3VXRB 4PR5B 2R8SH 1CZ8H 1IVTA 4YSTA 4RGOL 4FQ1L 4IIQB 4WU7B 4ZS7L 4HUNB 3EDEA 4EI5C 1HSAB 2HVBA 3UTOA 3FN9A 4HUUA 4HUVA 1FQ9C 2EIDA 1HSBB 2GIYA 2FZ3A 1HINL 1N0LB 3RJOA 1IFGA 3C5JB 2EC9T 3CFIC 3TA3A 4OD3H 1WEJL 4AZUA 4EN3B 4OCSL 3PV7A 2D0HA 1FZMB 3NABH 3OX8B 2HN7A 1JGDB 4RGMB 4X7DC 1G7HA 1T0MB 2Z35B 1J8HA 3N40P 4BWUA 4H20L 3EH1A 1J8RA 4NZJA 5EU4B 4XN7A 3P1VA 5TPWL 4Z7OB 1YAZA 1B88A 2F15A 5T1DL 1F5WA 4NENB 1B2WL 1ETA1 1ROCA 3QAQA 3FTGB 4S0HA 4OF3A 1X5AA 1WTLA 3Q05A 4UQEA 2JTYA 4TNWK 2Q8AL 4ZW8A 4UUJB 2QQQA 5I8KL 3PWPB 3QR0A 2GW5A 3SGKA 2FX8H 1HYSD 1BZ9B 1SLXA 1S4IA 3GYRA 2J12B 4HIPA 1VIWA 2JK5B 5HGAB 1U8OB 2IFFL 2W9DH 4YDVA 3V9EA 3WDHA 1OP4A 3EHBB 3OMNB 2I07B 2AXFA 3QULB 4AL8H 3MRHA 1CE6B 2HLAA 5HJ3B 2QQKH 4FOMA 3GMPB 1GC1L 5DC4B 5E5UB 4QJ4B 1AC0A 3GSOA 2I32A 2IALB 2DBJA 5GRVL 4WHDA 1ZIBA 1H3GA 3BAJA 1GKEA 1HCVA 1RCYA 1XGQB 1XH3A 3EDDA 4FXGC 4K7PH 1K3IA 2D7OA 4LHUA 4W9CC 1XAKA 4EBQH 9PCYA 2LGNA 1V54B 4E41B 3BC9A 3VFMB 1WWBX 1KYAA 1A6UL 1F6FB 4OU3A 2WGXA 4NNXA 5CD3A 3IXAA 2BVQA 3OG6B 2Y3NA 5CJ8A 1AHWC 1OTTC 4D0CA 1TCRB 4P23A 3P4NA 4H1LA 1MREH 5AUMB 4D8OA 1MHEB 3O4LB 4ZOCA 1ZLWH 2FB4H 3OAWA 1XZ0B 4Y19D 4P07A 3TJHC 5IHWA 2CA3A 3OGCB 4OCYH 5FS5A 4RETB 2W07B 2Y1YA 4N0CC 2XKUA 4MMYB 1H3UA 1HI6B 3IDNA 4EUPG 5K9QG 2HKFH 4AYEC 2VLJD 5EBGA 1G7LA 4H5SA 5IGXH 1RUKH 4R7LA 4ODXA 4NKMB 2OL3L 4D7PA 5ID0B 4FG2A 4U0RB 3WO4C 2BSBA 3AS1A 3QORB 3G7TA 3QDMA 4LCCA 4PCYA 3DVFA 1S7XA 5EN2A 1RK0A 4HGWA 4HJGA 4HHGA 5E1QA 2C9QA 4JM2C 2VZ3A 1K2DB 1FLTX 3ILEA 2E59A 3IDMA 1E8XA 3KLHD 3HEIB 2ZUWA 1ACYH 2CLZB 1NC4D 4K9JA 1VLXA 2WQWA 3CLEL 3BFWA 1H3WM 4BKTC 3UROR 2CDEB 3W0WD 4CDGC 5FLVA 1KIQB 7TAAA 2R2HB 4PGEA 1YEIL 1MPAH 2UVEA 1NCAL 3KPLB 1ETZA 4FQXC 4K8RH 4G72B 5F7AA 2FBJL 2VM9A 4KI5C 4OZHA 4P8QA 3HR5A 4Z7NE 3JWNE 1ZT7A 1YEJL 5F89A 3LV3B 3PQYA 4X7FC 4XXCC 1HOCA 3CFBA 4JFVA 2WXQA 4ZO6A 2XXCB 4EPSA 2CR6A 5ERWA 3ARWA 4NZDA 5LBSA 4ZFFA 5D93B 5I76A 4TUUA 1EFXA 1HOEA 3HAEG 2X3AA 2ZICA 1EWHA 2W60A 1ZK5A 3U1SL 1QBLL 3E0GA 5I5RA 1I4FA 3KL0A 3GSVB 5IVZA 3IRZA 3UZQB 2WLIA 1TJIH 1QX1A 5DJ8A 5HHVH 3PHQA 3T71A 2L04A 2ZX6A 5LCVA 4XPGH 5DSCA 2M26A 4LVOB 1EEZA 4P4KD 3SYPA 5IB5A 2E5EA 4YLQT 2B2XH 1HC1A 4HG4J 3QQ9D 3IFPA 4MTMA 5I1KH 5ANMB 1XD0A 4HKXB 2B1HL 4IEFA 3JVGC 2Z3FA 3FQWB 3L4VA 4JFDE 5JOEA 4FXLA 1R3KA 1ACXA 4LARL 3HJ0A 4J1UA 3BH8A 5B38B 2DQCH 3PL6D 5EF0A 4DAGL 3EOBB 2OX5B 5IROC 5HDRA 1Z3RA 1X9QA 4K3DH 2F54B 1CDUA 1JWMB 2ZNWA 1QLEB 2XA3A 1QPXA 4DVBA 4AGPA 5BO1L 3KR3L 5IMKB 3RYMA 4PJIA 3NOIA 3PNWA 3R1GH 2K3HA 1U58B 4K9EH 1T1XB 3FNKA 4NQCE 5EZIL 2VMEA 4BSVA 1KIRA 3V6OA 2VXTL 1CD1A 2F8VA 1F58H 4AUYA 5FGSA 1JNHB 1M2VA 1B3JA 2DMGA 5I71B 1FORL 1AY1H 2CUHA 2VDLL 3OLDA 1T7XA 4PBWD 2X2HA 2MCG1 5HI3D 2V7NA 3K6FA 4WZ9A 2N4IA 4KZDL 4OGQC 1HFUA 4LKCB 3R4DA 1DVZA 1PZDA 1RUPH 2DQGL 2AW2A 2K6WA 3D25A 1CICB 3T0EB 1V7ML 1JNNL 2Y5TB 4RDQG 5DGQA 3OKEA 2K9UA 5E2TH 1KOAA 1Z3GH 5AVUB 4PJ7B 4Y9EA 1BVLA 2VDPL 3OXRA 3RWDB 3N1GC 4OB5H 4XMUA 5E4OA 2IWFA 2P7TB 3L5XH 4JLRA 3GS4A 3HC4H 4PJGA 4XWOC 3TEUA 35C8H 5KZCB 1IKFL 4LKXA 3FW6A 3TP4A 5GS0H 2Z8WC 1QZ1A 4PJCB 1HAWA 5I23A 3T8XB 3C6SA 2DI7A 4WV1A 4UTAH 3O6MH 4DN3L 4NQCB 1GYWA 3TA3C 1BF2A 1OAKL 4XAWL 4EZKA 1MQKL 2F1AA 4PRDB 3TN0B 3L95B 3CTTA 1A02N 4GBXA 2FL5B 4NNYB 3SKMB 3VA6A 3WEAA 5EOTB 3MYZA 2XA8H 1IRAY 3EH5B 1R5WB 4MHHI 5SWQA 3D0AA 2JI1A 3TZVA 1AD0A 3QHTC 1Q9LB 5K9OA 5B3NA 4XC3H 4M3JA 5AKSA 3B83A 5DHXB 2NLJA 1BHGA 4HAGA 2BFVL 5ESAB 1IEHA 2AC0A 3I50L 4WGKA 1ZAGA 2QVKA 2ZT9C 3SGKC 4PHXA 5GGVL 1SN0A 1CF8H 4OT1H 1UWEL 1ZVSA 2DMCA 4R8WL 2BIPA 3TLRA 4Y7MA 2X4QB 5DJAA 2VM3A 2VIRB 2R7EB 3R8BB 4CAGA 2PMZA 1BW8A 3ZTCC 1CLZH 3MI6A 1A8ZA 4Z5RA 1UACH 3P4OB 2B0SL 2DQEL 5BRZA 3LB6D 1T04A 4NS0A 5KVEL 1WVZA 1ZJBA 5DRXB 2X6UA 4K7PY 5BS0A 5AVYB 2DTML 3HMWH 2OZ4A 1T3FA 2CR3A 2WLLB 3NACH 5IUCA 4DTGH 4XPTL 1IE5A 1IAIH 2JB5L 5JO5A 1F11B 5CEZD 1X3DA 3TPUB 3RGBA 1CGSL 3DVIA 5DLLA 3GBML 1IM9B 3UJJH 5FX3A 3F7VB 1BXXA 3L3GB 4YHZL 1FIEA 1WISA 1ZEAH 3ELQA 4MMZB 4MYPA 2EKSA 1U3HB 5G4OA 2XIBA 5IQ9B 1N5YH 4P23C 4U6VH 5C09A 2KUTA 4O5LL 4OY9A 5IFJB 3ZKMC 4OKVB 5IHUL 3OL2A 4MB4A 4G42A 5EDXA 1A5FL 2WOYA 4LCUA 1BQHG 4FQCH 2ADYA 3L1FA 4PM1A 5CJBA 2AJYL 2CKBB 2TSAA 2ZAIA 5DZJA 2G4EA 4XP6H 4JHZA 3OG4B 2NW3A 2I5YH 3SPVB 1EGJH 4LCCC 2FO4A 3NIFE 4HIXL 4M6ML 3ARFA 1MCIA 3NK4A 4XI5D 4Z3HA 3Q3GB 4DKFL 1DQLL 1RSFA 1V5JA 2B9AA 1LYQA 3KYAA 4IRZA 2QDVA 4LCVA 3BGMA 1BX2B 3VD2A 4DCQB 3ECWA 1SEBB 1J1OL 2ZUQC 4QHMA 4PJ8B 3ILQC 4AXWB 2EIZA 1KJMA 3DJTA 1RU9H 2ZAGA 4EUPH 1QABA 4LSUL 3T3MB 5EU3B 4Y2LA 1S5HA 1KJVA 2ATKB 2UZPA 4L37B 4NQDE 3QNXA 3VXUE 5DEZA 2Z1PA 3D07A 3OMAB 4I18A 4E9QA 2VXUL 5DT1L 1U9KA 5IF0A 4ODWB 1OTSD 4FHJA 1FHGA 1HN1A 3MV01 4X5WA 5CSGA 3VFSA 4MJ6A 5FCSH 2WTRB 4GIAA 4LSQH 4DNLA 5I1GH 4JM4L 3TPKA 3BVUA 4HGKC 5D7JB 4P46B 4P9ML 1LO4L 2D4FA 3HC0A 4HOZA 1WWAX 1JGEB 5F2FA 3NIFB 1KENL 1WD9A 2O5XH 4F57L 4HWUA 5SWZD 5C07D 4ZMXA 4KDWA 1NCWH 4YE4L 2GJJA 4Q2ZA 4QRTB 4WK2B 4GFXA 4V1DE 3OKNA 1YHPA 2NY1D 2J8UF 3L9YA 3FT2A 1EHKB 3FQNA 2BOLA 3BGFB 1QFWL 3ULUD 4FN0A 3VRLF 4GG6F 3MRQA 4FQLH 3GMMA 4G43A 5I6LA 2F8IA 3GMLA 4NQDB 3UTSE 4TYUA 3VXUB 4EE2A 2M1KA 5TGBB 5F88A 1PZUB 4WTQA 4C54A 3OR7B 3ZE1F 4DP1X 1E4XL 2QR0B 4Y1AD 4NO0D 2RD0A 4X7SL 1CC3A 1QQDA 3P3SA 4ORGA 2E0PA 5L2KD 4YDJB 5GJTH 3EJQA 1AKJB 4ZMLA 5FO8A 3AREA 3RVXC 1MAKA 1AGCB 2D0GA 5EOQL 2EP6A 4A2LA 3V6OC 2VQUA 5K93A 4X99B 1QSZA 3BEWB 5DO2C 1HDMB 5T8IA 3QO1B 4PJHE 1DFBH 3ATFA 3RG1C 5HHMD 1NMCB 3FMGH 4HMEA 4LSRH 3VWJB 4ADGA 4CU6A 1KYUA 1GKOA 2XQ0A 1XF5B 4G7YH 1VHPA 4JRXE 4MD0A 4RGNE 1R5IB 2VJXA 4V1DB 3RWIA 1MY5A 3JXAA 1KSRA 1ZLUH 1R1CA 5INDB 1GOHA 1R46A 4XTRD 1YDPB 5IB2B 4L1HA 4IMLB 5E9DD 1JXKA 3QXDA 4UQDA 4G3YL 4ENED 4R0LB 3H3BC 4TNVF 5ACLA 3UTSB 1Q90A 4YXKH 2HLFC 4HJTA 2DAVA 1RZ8B 1CFSA 2FJFB 4GXFA 3M8OH 4FLOA 5LQBL 1NGWB 2W81C 4AEIL 3VWKA 5DWUL 4OZIA 4HHWA 5MEND 4JFWA 3DVGB 4YEFA 3H0TA 4BDVA 1JPGA 5EEYA 4WV1C 3D39D 4DPBX 4EI0A 2ICWA 3LQAH 3LH8A 4HP5A 1P5UA 4H7VA 4NCC2 4XMXA 1NMBH 5CEYA 4W9KC 4ZW6A 1RK1B 2VDQL 2CGZA 5LBSL 4PJHB 2YZ1A 4UQ3B 5EFIA 4HT1H 4N24A 4GBXC 3BW9A 3K6NA 1MH5B 1OCZB 2EXSA 3L1GA 1AE6H 1AQHA 5FUCE 3T0BA 3TZVC 3O2VH 5F7HA 4X6DE 2DQDH 5C0EA 4BZ1A 2FNBA 2EO9A 5D96B 3O3DA 3N42F 4HJIA 4N2KA 1O7DE 1MSPA 3BUYB 2GCYA 1YYCA 3CH1B 5LCVL 3CVIL 4ZMOA 2V9UA 3FONB 3ZYIA 4X4YA 2AS5M 4O4YL 4GH7B 2PKDA 5C0BE 2BWQA 2JJSA 3VYNA 4AG4H 5I0VA 3N40F 2AQPA 2LVCA 1TJHH 4W9EC 5D5MA 4JHVA 3RL1B 4RRPA 3WL9A 3TYGL 2V2XB 5I1CH 2ZP0T 5DK0B 1MJUL 3BESR 4L4VA 5K69A 4F7PA 2ITCA 1NIEA 1RLBA 2RQ8A 4JKKA 2VAJA 1MVFA 2VE6B 3FT9A 3G04A 2G5BB 4YFLF 4QOKE 3NJFA 5AOJA 4ZS6D 1FIGH 2ESVE 4A63A 2NY3B 3ESPA 3L08A 1S7VB 3TBBA 3BHBB 4C58B 2FH8A 4A7TA 5I1EH 4A1RA 3VG0H 5IB3A 1TLKA 4GIPD 3DDFA 4QCIA 4X6DB 1A1NA 1C7SA 1B0RB 4KHTL 2IEPA 5HPMA 3MV9D 4X80L 2XQYK 4XCFH 3SDDB 2E47A 1UZ8A 4PTTA 2DLFL 2Z0UA 1BREA 2VDRL 1LE9B 2F7IA 2XETA 5F9AC 1CYXA 4DP5X 3ZU8A 1SYSB 1FJ1A 3MRGA 4JPVH 1NL0L 1JFQH 1ETJA 3C6LB 4XMLH 5C0BB 2VR9A 1L9QA 3QNYA 2ZCHH 4MB5A 1IC1A 1QFUL 4LCIH 3S37X 4HEMA 1CLOL 3UEZA 1SDDB 1E4JA 1G0YR 2J8UE 3PXHA 1WYJA 1OAQH 3RKPA 5KSAA 2RJMA 3K0WA 4QT5B 2DWEB 2EDWA 1MHPH 1FN4B 3VRLE 3WNIA 1BIIB 2Y7NA 4GG6E 5L4IA 4WO4B 4BFOA 2COVD 4L9LB 2J1YA 1TSHA 3EJYD 1NEUA 5TE4H 3ARFC 3WV0A 4CN6A 3KPOB 3O6FB 2ZIDA 2YLKA 1OM3L 4NHCL 3GIVB 1MI5A 3GI8L 3LY6A 2MPVA 4OJCA 1DLHA 1SMOA 3T65A 1DQTA 4QLRA 5FO7B 1NKOA 2PWHA 5IT2L 3QSKB 1BD2E 2UZXB 3CHPA 4MXWH 1I53A 2ZOKB 5C0AA 1ZWIB 4M6OH 3WFHA 1WGVA 2CLVB 4GAGL 2X0WA 5LGHH 3MLVL 4NT6B 4I18C 5D8JL 1HHKA 5C0RL 1XF1A 3SGDH 1T1ZA 3U30C 3VG0L 5KG9A 2BDNH 3DSFH 3BVNB 4G8GB 3RJQB 2CIKB 4PD4K 3TCLB 4F2ME 2J8UB 5E4EB 3H42H 2OP4L 3LMJL 2UUDK 4U1IA 5K1VA 2IAMD 3ASOB 3TNNB 1G6VK 3B2UC 1MFCH 1I1CA 4NGHH 4POZC 3LZLA 1PX8A 1E2ZA 3AXLB 4EN2A 4L0PB 3TBWB 2EXWD 2PYFA 3LIZA 1FZOB 4ZX6A 5JXAH 3W39B 3JV6A 1SFDA 2D7PA 1EFQA 1HKLH 3ZDZB 4HMCA 4DKEH 5IKCB 5JR1H 4FHKA 4H2AA 3MLYH 4FZ8L 5A2AA 3QRLA 4FQJH 3PRZA 4MJID 2ZCLH 1RJLA 2GY7B 1Q9KB 2OZ4L 3BISA 3B6SB 2NXYC 1IAIM 4WVRA 4IYKA 4GKZA 4RMWA 3FT4A 5BJTB 5MEOB 3P3TA 4P2QE 5BRPA 1ZTXL 3VXQB 1D5IH 1P53A 4IK7A 4NRYA 2Z6FA 3V6ZA 1F1DA 5IJVB 1ZGLA 2K78A 3EUDA 1CMOA 1I1RA 4PWFA 3AREC 1U8QA 3MJ7B 4NQEA 1W6WA 4IK6A 2E46A 1YNLL 3LNGA 4IKJA 1HK6A 2VRKA 2G3XA 3D9AH 2VNCA 4HK3N 5IJCC 4YSUA 3FH7A 3V6BR 4PRAA 4ZUSB 3M07A 3OB0K 3RQ3A 3E9TA 2CDFB 4NO3A 4FCAA 1NANI 5K9KB 4LMQE 1IZJA 1PLGL 2F68X 2E7LA 4PRHB 2A38A 3HBZA 5A7BA 5KJRH 2X89A 4NHUB 4AENB 4IBVA 2WSKA 3CUPA 3UYPB 1FE8H 4AK2A 3OBAA 4E5XB 3BFQG 3GSQB 3QP3A 1F3RB 4NM8L 1WZ1H 4F93B 1G9NC 2OMYA 3HB3D 2WZ5A 4CMHB 3AQDA 3VWKC 5D6DA 1AACA 3JBG7 2DIJA 4CA4A 2OL3B 3DOHA 3FU8A 3UJTL 1CCZA 1E67A 4TPRL 5B22A 4EI5B 1M05B 1RUAL 2YEZA 3LCYA 5J6SA 1ZS8A 3OKKB 4A66A 1XGUB 1P5UC 4PG9A 1CDCA 3BWAB 1R19A 2Q86A 3NA9L 4NUJB 4A6YA 4R6UA 3DOIA 4ODBD 4TUKL 1JWUB 2VC2L 2X0VA 4HKZB 2OKMA 5HGBB 4MD4A 1TTAA 2BW4A 4MNQB 3OKYA 4CC4A 2C1PB 3ARZA 2Z0BA 5TE6H 1U8KA 1OE1A 4JFFD 1BGXL 3A4EA 3RY4A 3WELA 3V6FA 1RAMA 4RWYH 5JDSA 1MG3C 2ZPKL 4HPYH 2X4PA 1OW0A 2HJKA 5F1KC 5DJ2A 3S5LG 2DQHL 1JGVH 2JJSC 2XBTA 4OGYH 1MWOA 4H8UA 4LSVL 2J3SA 3ECVA 3OGOE 1PNCA 2DD8L 3T0AA 1K6QL 3AS2A 1DQQA 1F86A 2LLLA 1IBGL 1QHQA 1RIHH 3PE9A 5GZOA 5T3ZD 3BSHA 2F74B 4TULH 4C4KO 4ZW5A 1EHLH 3A21A 4JHAL 5EZLB 3WNMA 1M1XA 2FYYA 4LLUA 4DWHA 4ERSL 2JJVA 4AT6B 1NCBL 1JRHH 2ZG3A 4RX4D 4TSBH 1L0YA 3V52H 3WS3A 3KLQA 3NZSA 4JY5L 1CI5A 2QSCL 5D55A 4ZJ9A 3TU6A 4KO9A 2ICCA 2OSLB 3V4UH 4FXGB 4YR6A 1S9WB 4YSAA 1MIEL 4G8AC 1RURL 3FQTB 1VKXA 1CVSC 5GSRB 3AU1B 4BFRA 4BGDA 3VD4A 3BVXA 4NPYB 3LN5B 4OLVH 5INCA 1N4XL 1AHWB 3CVDA 4HS8L 4TUOA 3MPCA 3JYBA 3WY3A 2DQJH 4KJYB 2NX5D 3SDXB 1SEQH 5CLWA 4N9OB 2F58H 2ZOTA 3VXME 1QOKA 1IKNA 4HFWB 1OGAE 1TVDA 5IFAH 3CFDB 3AAZB 1H15B 2ED7A 1RZGB 2BNQE 3BIKB 1SXNA 4FCHA 1OSPL 3A3YB 5KSAC 1WFTA 2VDLB 2V2TA 1G9NL 3H8NA 2CJSA 2NNXA 2FVNA 4APXA 1EAPA 1AYOA 1P6WA 4KTEL 1RJCA 4TTDD 3MLTB 3WO4B 3KGUA 4PB0H 1AO7A 5E94A 3RWEB 1OM9A 1F6LL 4R4BB 4JW3A 2DJUA 4IRSA 1CVRA 4FYTA 3RDTD 3O45B 3ZLQC 4B9KC 3L4YA 2JNZA 1SDYA 4JM2B 5IHHA 5F9JA 3TO4D 5I1LB 2V8MA 3ZDWA 3RUGF 2WUCH 2VDPB 3V0WH 4JCWA 1A9EA 3CU1A 2IGTA 3PAYA 2ADIB 5FYLE 3S7GA 2I69A 2AZUA 3KGSA 4FQXB 1OB0A 4BZ1L 4PY8I 1JZEA 1T7YA 2HVJA 4KO6A 3QPKA 2R39A 3VXMB 5ABDE 3F62A 5CINH 3OJDA 1OGAB 4O51A 2ARJQ 2IH8A 3L4UA 2K0RA 4FMKA 1KLGB 5F6HJ 4J4PA 3CE1A 2F08A 1MRDL 4KKBD 3G5ZB 1G9MC 2J2ZB 4LPXA 1N8OE 3KD4A 3ME0B 3W82A 2DWDA 5E5MA 1GCYA 4G71B 4YHIA 5SWSE 2YGPA 4AEHL 4ZFOA 2R27A 1OD9A 3O6KH 2BOCA 4APQD 2X4SB 3LNEA 1WRFA 2NY6C 2PO6D 1A7OH 3OWRA 4QRQB 3NFPB 1VENA 1UHVA 2UZYB 2AXHA 3ZHFA 3QDJD 3QQ4A 3S3CB 4DGYL 4ETYA 5DD6A 1E28A 1ZK9A 1CUOA 3DROA 3I3EA 3WYRA 4FA8A 4UQBA 1A6VL 3MODH 4JGJA 4IRJA 1CG9B 1GHFH 2XZCH 3CNKA 1H5BA 4YZFF 3H3PL 3Q1SL 4R5TA 2XQBL 2DF3A 3DJZA 5JYLA 4R90L 4HXBH 1J0KA 3FUJA 3OKLB 3K6OA 2WLNA 3ALPA 4OLXH 2OR9H 4WW2A 1NCGA 4XAKE 3RFZC 2PP9A 2FWOA 2YD6A 5FK9B 4X98A 5JIDA 2JF1A 2MSPA 1P69B 2FSEB 3DXAA 4K3GA 4XHJD 4ZD3H 3WXVL 2G75A 3VTTA 1ND0B 1U8LB 3D8MA 1Q4NX 3UOAB 3N1FC 1QLRA 1UKSA 3GRWA 3RL2B 1SVBA 5LGJB 4WRLA 3LKOB 1RUQH 1Q8MA 4N9GA 4W1TA 5K59F 1J8HE 1RUMH 4MX7B 4BD4A 3N50A 1T03L 1VGEL 4XPHL 1EDYA 3EGSA 3DOSA 4HZLA 2E7LC 4PQXA 1MFBH 4X6FB 2DW5A 4QYAA 4L29A 4CU8A 3BEVB 1RJYB 4OLYL 1CJYA 5DZVA 4KFZC 2JXMA 2AJUH 5I0XA 3IDXL 1FVCB 4KK6C 4S2SB 3P73B 3I6LE 4I4WB 2JKRM 3GGWA 4LLAA 2J5WA 4OF8A 4D94A 5D6DC 4OM0H 1BAWA 1F4YL 1ECZA 1AZNA 2NQ3A 3HZMA 3OKMA 2OJEA 3NTCL 3DIFA 4HUUB 4HUVB 3ARVA 5CCKL 4JPKL 2FZ3B 4YEEA 1IU1A 2JE8A 3P30L 1X7QA 3TA3B 4GKOA 1BF5A 3N1MC 1S5IL 5FIEA 2HN7B 3SE4A 2XXMB 2K70A 1G7HB 2P8MA 3SCMA 4D0DA 1J8HB 3RPKA 2VGLM 1I9EA 4TF4A 4CC4C 1G9ML 4C8XA 2X40A 1QSFD 3LIZL 1BEYH 1PQZA 3ZKXC 4J6RH 5GPRA 3IVKA 3NZ8A 2HMID 4ODHL 4ANVA 3V4PH 2CO1A 1OW0C 2EEFA 2PCPB 5C6PB 3NCJL 3SZKC 1CK0H 3WFCL 4K23L 1U95A 3CH8A 3HN5A 4KV5E 1F00I 3A6OA 4QRUA 2ZXQA 1B9KA 4BFIA 3GNML 2C4XA 4X4ME 5HJBA 1A3RH 4OFYA 5GZOC 5C0GB 2DWXA 4FLRA 3RUGE 4YDVB 2NOYA 3QQ3A 3TASA 4A38A 1E2WA 3K1KC 4MS8D 4JVUA 5I17A 4JO3L 4KTYA 1QASA 3MRHB 2HLAB 2PETA 1MW1A 2Z4QA 1FGNL 3GSOB 3SPHA 1IB5A 3HMXH 2MWCA 1OWRM 4R83A 1IIKA 3U46A 1XH3B 4LHUB 1T7ZA 3SY0A 3V4LA 4MNGE 1JZ2A 1J7VR 4HS6A 2XBZA 1CL7I 4OQTH 2V17H 4TLSA 1ZLSH 4NNXB 3F85A 2FUTA 1SBBA 3IXAB 4L48A 4H40A 4J3BA 1AFVH 2BVQB 5DWPA 3V5KA 3F7KA 1MXDA 1U42A 2VMDA 3L2NA 1JJUA 3RVVC 4BRVA 4D0CB 2C9UA 4P23B 3P4NB 4H1LB 3MV11 3UAJA 3BAWA 4GUCA 1EIBA 2BSDA 3LS5L 5F1NA 5I16A 1SXAA 1TITA 2ZP9A 2QGBA 1IKNC 3OAUL 5T5NF 2DL2A 3I3DA 5JZ7C 2ICES 5F7EL 2R2EA 3IDNB 1EJOL 1GGIH 3CFCH 1G7LB 1HH9A 1QSED 2OJZL 3H9HA 4H5SB 4KXZH 4ODXB 2QVFB 4O58L 3P9MA 3ZT7A 4LCCB 1L6ZA 3EADA 4TLKA 4CMMA 3GEFA 1S7XB 1N59A 2JTDA 3D06A 4IRSC 1RK0B 4HGWB 4HJGB 5EN2B 3MBWA 2XVGA 1FBIH 1NKRA 3J2PA 2R69A 3IDMB 3TH2T 2RGSA 1IZKA 4BCYA 2LHAA 3DX6A 4Z23A 3DGGA 4KDTA 4A6YL 2ZUQB 3K71A 2B20A 1M3IA 3WNKA 1I9IL 2H1XA 4OSUH 5TQ0L 3EOTH 2XACC 1TSRA 1U21A 3AITA 4PGEB 3AWGA 3FQRB 3S3JA 1ETZB 2Y6SD 4X6BA 5T1KA 1BQLH 3U48A 4OZHB 3QJOA 5DLMH 1LMKA 3HR5B 3WD5L 5K59E 4E9VA 1PZSA 1ZT7B 5BOZG 1IGML 5F89B 3QCTL 4XXWA 2LTQB 1HOCB 1OEZW 3CFBB 3B2VH 4EZJA 3L3KA 2VDQB 5DK2A 5C71A 5ERWB 5DQJA 4D3CH 1FNSH 3WMQA 4ZFFB 4G6KH 1S7WB 1NGYA 2K6ZA 4J4PC 4PJIE 5CLZA 5I76B 1ZCRA 1JMXA 1EFXB 1U8IA 4BWTA 1HZHH 2W60B 3SYQA 4QKXB 1ACZA 1I4FB 5AAWA 5F72S 2GKIA 5IVZB 3QUXA 3ZR5A 1XSIA 5J13C 3CFEA 2WLIB 3M7FB 1FG9C 3SE8L 5DJ8B 3PHQB 3SJVA 3FB5A 3MRFB 4FFTA 4HWBH 2R4RH 5D1ZC 5KOMC 3WIAA 2EDQA 3V9CA 5DSCB 1EEZB 4FQPA 1PFOA 3LZFH 5IB5B 3QWNA 2N56A 4G9FA 2YAEA 1U8HA 2O6DA 3IFPB 3P2DA 1QRNE 4XCYA 3GRGA 4IEFB 4C59B 1J9TA 1IKOP 4ZAKC 1EK3A 1KELL 1RJZA 3ETBF 1M7IA 3FUIA 1E27A 1R3KB 5DTFA 5DZ9A 4ISVA 4IRJC 1CFVH 4LRIA 4J1UB 1EEYA 1H5BC 3KWWB 3MNMA 4NOBA 1UASA 2NNRA 3VFUA 1AHKA 4WEMB 2HFEA 1O6SA 1T20A 4WW2C 4XP9L 2JKTM 5D70L 1JK8A 3V5HA 4DVBB 1OP5K 4ZPVA 5GGRA 4PJIB 1W2KT 2HFGL 1H6TA 1DVUA 3PNWB 1DN0A 5GJSL 2CZNA 1D2OA 2Y7OA 2AQRA 4IOIA 1KIRB 1BJMA 4BSVB 2YFOA 1CD1B 1U3JA 4BFKA 1QA9A 2OW7A 1M2VB 2VDRB 1CF1A 5E1GA 5IMOA 1B6DA 2VUYA 2BHYA 4PGCA 4Y2NA 1RERA 5I73C 2EDXA 2QTVA 2V7NB 3L2LA 4L2YA 4JG1L 4E0RA 3LPWA 2GIXA 4M62H 4AE1A 1YJDH 3PGFH 3VVVA 4KKCC 4DZBA 3FCTA 4UT7H 3D25B 5A6IA 5EA0H 4X9YA 4KKLD 3OKEB 3P11L 5LO7A 4XNXL 3SGEH 3LPFA 3SDAA 3ABLB 2HG5A 1SHMA 1YQVL 4FERA 1RQ5A 1BVLB 4M8QA 1WJ3A 3OXRB 4GUPA 4EN3D 5EDSA 3X11A 5CCHE 4R2GD 3MRRA 4Z3TA 4IOFD 3NBNA 2VN5A 4P9HC 2L8AA 4JLRB 4PJGB 5GRVK 1WFIA 2E27H 3CSTA 4H0HB 2H26A 4LKXB 2XZAH 2HVKA 1CL7L 4Z8FL 3NGBC 4A7UA 5B39A 3C6SB 4ELMF 1KJ2H 4WV1B 1TO5A 5AVVB 4K3JL 2VUOA 4TNVK 3MOAL 2HX7A 4P5SA 3DUSA 3LKQA 1J9QA 1OXYA 2D0FA 3IU3A 4Q7DA 1VDGA 4RESB 1T1WA 3SE4C 1CQKA 4XOEA 3SCMC 1EO5A 1NBZA 4JQXA 3M88A 2WANA 2OTUA 4WY7H 4GBXB 3NCEB 5C0IA 3PWPD 5D7SH 1LO3L 5SWQB 4U33A 1EEQA 1N18A 3TZVB 1AD0B 3HCVA 3LKSA 1ZTXE 4NWUH 1F3DH 4RAUA 5FPIA 1EJ6A 3U9PL 1UA6H 4LPCA 3S4SB 4ZFOL 4G6AD 2R15A 1USZA 5C09E 3T8MA 1E5UI 3CX5J 2NLJB 4ZMPA 1ZY9A 5FYJL 3GJFA 4AMKL 1E5CA 4F5CA 1CB4A 2W91A 3ABGA 4WI3A 3LQZA 5EEXA 4NC0B 5DJAB 2YPLE 4E41D 2QSQA 4JKPL 2WHVA 4LQ1A 2F7RA 3CHRA 1QKZL 5EOCJ 2FEJA 4Z5RB 5EC2A 1GRWA 3WEXB 5BRZB 2EVFA 4ZZFA 1T04B 1JPSL 3FFCA 3FSVA 2WNXA 2VO8A 5BS0B 4PVNA 4GG8A 4A7SA 2XN2A 4U1SB 1SMDA 3KM1A 1FAIL 1T3FB 3F83A 3POHA 3RWJA 3RY5A 3VFNA 3O4LD 2X42A 5ES4B 3L5JA 5JO5B 4ZNEA 1BAFH 1QTYT 1KACB 2HT4D 1QSVA 5IM7A 3WFDL 3GRWL 4MA3A 4PGDA 3IFNL 3QUMA 3V0FA 5D7LA 4C47A 4TVPL 2EKSB 2I27N 1A7PL 1EZUA 2QPUA 2X5PA 4K5PA 5H8DA 5T3XL 3UBFA 2QMKA 3HZKA 3UAJC 5C09B 3CD4A 2AQ1A 2F53E 4B0MB 3KPQA 2MTAA 3CZKA 2W0LA 1FI8C 3QORD 2XWJA 2QSTA 2B08A 2XNAA 4G42B 5DZAA 5JLZA 4YIQA 1QACA 4B60A 3LZQA 4Y1TA 3RNQA 5JOPD 3CN2A 1K72A 4LCUB 4S1SH 2FIRT 3LRSA 5E6SB 2YPLB 5AAMA 3WHXA 4DF9A 1UFUA 3GIZH 5CJQL 2DQUL 1MJ8L 1NAKL 2A9NL 2YMXL 3EJJX 2KBGA 4NKOA 4LAQL 2GK2A 4H13C 4N5UA 2NW3B 3FZUC 5LNDA 4P9HL 5T1MA 3L9BA 3TFKD 1HWHB 3ARFB 4RBPK 4BKLA 1BYNA 4AJWA 1A7NH 3BGMB 3CMOL 4KDTC 5IVOA 3IGFA 1DBKL 4QHMB 1BOYA 5KUMA 4E9LA 4M5YL 2EIZB 2QQNH 1KJMB 2N0KA 4MKMA 5FECA 4GQ9L 3UBHA 1S5HB 1KJVB 3CC1A 3EJCA 2MCAA 2ADFH 3QNXB 5LUMA 3HHRB 4I18B 2ZXCA 4XVOA 4G82A 2H6OA 3GXTA 4XXWC 2BP0A 1IT9H 3OD3A 1E90A 3V7AG 1MWAA 4X5WB 3U30B 5TK2A 1BPVA 4YUEL 4MJ6B 5EBLA 3Q01A 3TEWA 2PCFA 1CGUA 2VC2B 3IAPA 1OPGL 1TZOA 2GTWA 5DR5L 5T33H 1XF4A 1HH6A 5JHLH 4FYRA 2FAUA 1VPOL 3QFJA 2DM2A 5AAWC 3QUXC 4YVUA 3HC0B 1NGZA 1UEYA 4XN4A 5LBGA 2WLKA 1YYML 3B1TA 2CRMA 2DKMA 3AZUA 4S1DD 3KDMA 3S36L 2J44A 2F54D 1BVZA 5TJWK 3MV8E 3OKNB 1MQ8A 4WUKL 2VLKE 4YFEA 4NI6A 5CIPA 5JW4R 3JWDH 1XH1A 3FT2B 1QR4A 1L9OA 2HSIA 2EQDA 1TXKA 3FQNB 4ELME 5PAZA 1MEXL 3BWSA 3NRQA 3PGDA 3MRQB 2NXYB 3GMMB 3PP4L 4G43B 4Y4HD 3GMLB 4Z3FA 3OC5A 1L3NA 3NFNA 1HL9A 2VZ1A 5D2NE 2APSA 4LPUA 5GRWA 5F93C 4XB7A 4F33A 2I9TA 1XEUA 2WWOA 5FUOH 2BHZA 1QQDB 5B1BB 2KPNA 3MV7E 4ORGB 5L4FA 3MACH 5FO8B 3AREB 5M94B 5KOVC 2WNGA 4JN1H 2YQ3A 5G2NA 4UOZA 5H4ZA 25C8H 4HZ1A 2EVJA 3G9AB 3VI3A 5IW6B 5A2CA 1GS6X 1U93A 3T0ED 2QELA 2WW8A 15C8H 4X5QA 1LO2L 5E6IA 5L9DL 5AOMA 3TWYA 4LCWA 4OZFA 2F5AL 2R0WL 4MD0B 4NCDA 3ZMNA 5IR1A 4LGRB 3GPEA 4XOCA 4XPBL 3RWIB 5KZCD 3HPJA 4XMKL 1F02I 3ZGIA 3EJPA 5J7CC 1GJUA 3LVTA 4LVNC 4ODTL 1OK0A 4P57A 3QXDB 3RA7H 5B3SB 1MJJA 3KPNA 3LZNA 4XE0A 2R69L 1FLRL 3SDAC 1RFDH 4NQCD 1CFSB 3V0IA 1RIUH 3IMUA 3ARGD 3VWKB 2PR9A 3NPSC 4OZIB 1W8OA 3LXBA 2GJ6D 3ZKQD 4N2OA 4L4VE 5HTSA 3MV7B 2BC4A 3M1BB 5KBKA 1JYNA 1R33A 5DVMA 3L54A 4ZDHA 1IO4C 2ICWB 2XVBA 2B8OT 3MJ9A 1P5UB 5CEYB 5FYJU 4AUJA 1FDLH 3O2DH 5ALCH 4XBEH 1JAEA 4UILH 4JQXC 5M95B 3PHSA 1KV3A 3OAYK 1U36A 3BW9B 3STLA 4N2AA 4DPAX 3DX8A 4JO8A 2YA2A 4Z7VF 2D7QA 4BFJA 5CLYA 1KN4L 1KYOJ 3A4DA 4MAYA 4UINL 3FBKA 3ZE0F 3HI5L 1NUDA 3O3DB 2J1KA 1V7NL 1F4XL 2WBXA 3NEOA 2GCYB 4FMVA 2H8PA 3NQIA 5KJ4A 3K46A 4H25A 2BJML 4X4YB 5A2BA 3WENA 5KN5A 2W8CA 1WWCA 3GXUB 3ZO0A 3QQXA 1GZHA 1LP9A 2Z93A 3ULSA 1H9VA 3MVSA 5D5MB 5JPNA 1YNKH 4MQ7A 1S7TA 3K4ZA 5GS2D 3NQKA 4ZO7A 2CSPA 3HNSL 4NJ9L 2E74C 2OK0H 4L4VB 1PEZA 2K8QA 5HDQH 5ICZA 3S35X 4F7PB 4MHHG 3G04B 3GLZA 3K2UH 4I77H 1JTTA 1F3DJ 3CX2A 2XX1A 4KUZL 5JQ6H 1U3HD 2H2PC 2WTPA 2Q3ZA 5LXGH 4P4RB 3E2HC 4OGXH 1YRKA 2WQUA 5CSZA 1MCHA 2GABA 1T22A 4QCIB 1N6QL 1A1NB 2CHWA 4GT0A 4I2XE 4JCLA 4OJYA 5HPMB 4ANKA 1KBKA 5HGHA 4WNQA 4PTTB 5GRZA 5C0AE 4QD2E 3GXIA 1ZA3B 4Q52A 1FJ1B 3MRGB 3HG1E 1DLFH 3HZYB 1E8WA 1ML0A 5HGGS 2ATAA 3QNYB 1IQWH 4PLKC 3U25A 3MNVA 4L2LA 3QZNA 4DO4A 2XPGA 4G7VH 5DUBA 3FT1A 2J4WL 5AAMC 5FV2A 2HTLD 3G6DH 4X8GA 3X1GA 5KSAB 1HILA 5EBMA 4PJ8D 4Z3EA 1UZGA 1YEHH 4Z7UA 2IGFH 4NUGL 4NM4L 2X44D 1UD3A 3HG5A 4CVXA 4POYA 4OTXH 1KB5A 1UYWH 1NMAL 5EWIL 4E36A 1JGIA 4J8QA 4H8WC 4U6XA 1MI5B 2GC7C 4I2XB 4KK9D 1HCFX 1PG7W 1DLHB 2PYEA 3FUHA 4JFEA 4PP2A 4OFVA 3DI3B 5H94A 4YL9A 4OIAA 5C0AB 2WQRA 3WFHB 4I1RA 1PEWA 5D7JD 2XXFA 2CGRL 4P46D 3RX8A 3CBJB 2CNYA 4PJ5A 4LSPL 2ZWYA 1OY3B 1HHKB 3ULUF 1PD6A 4UDTA 3RGHA 2YPKB 1EMTL 5KG9B 2CO7A 1A6ZA 3FU3A 5BW7A 2GJRA 2A9BA 3IJSB 4YO0A 1XD1A 2HCZX 1XIWC 3LZRA 4M9OA 4U1IB 1VF5C 5K33A 4U1KA 2YOAA 1GY1A 2EJ1A 3JTTA 3OAZK 1L0QA 1NAMH 2P52A 1AMXA 3QDAA 5EG6C 2CBMA 4HIJA 4G1EB 4PVMA 2AJXL 2DYPA 2PYFB 3GKWH 3JV6B 4JMNA 1GMIA 3V10A 4ONGL 2R0LH 4OCRL 1R17A 3QCUL 4F58L 1J05B 1ZHNA 2NY6B 1RJLB 4AI7A 3INUH 5AB0A 5TE7H 1T6WA 1PCSA 3LN4B 5FYLH 1AKJD 1BXVA 1R5VA 3A4FA 3GK8H 4GKZB 7FABL 3GZOA 2ZSVA 5T5FH 5IW1A 3IU4H 1ITBB 3H2PA 3P4LA 4RMQA 2P8LB 4ZUVA 4X7TA 1KT2A 1VADA 3CFQA 3QUML 4N85A 2DDQH 3WEBA 2GI0A 3QHFL 1F90H 4NRYB 3IGAA 2VR5A 4LPWA 3ZE0E 5CZRA 3VWJD 3CHQA 2VSKB 4FQQA 4HAKA 3HRPA 4HBQA 4M8UA 4F80A 1A9BA 4A7GF 3RFZB 2ZJSH 2R0ZH 4OZGF 4AV4A 2EIJB 4V1DD 1U8QB 3BT0A 4NQEB 1H0DB 4K94C 2ED9A 1NFDF 5JDJA 2AV7A 3U0PA 2Y07L 5DRZA 3D69B 4H8VA 5E6IC 3NSCA 3UTSD 1I8MB 3P77A 1INEL 3DMMD 1FZKA 3DUHA 4OBSA 4NO3B 3ARRA 4WW2F 2EDBA 1E3XA 1LK3H 1PZ5A 2G3NA 2CMRH 2P80D 4JX0A 3IT8D 5AG8A 4YDIL 3QNFA 3CUPB 3DBXA 4MA1C 5IBUB 5BXFA 1F56A 4CRPA 2WAQA 3KPPA 4H8WL 4GUOA 3GQFA 2OMYB 4QJ5B 2C9PA 3EF4A 1G7PA 3VFTA 2G30A 4M48L 2PABA 3MLZH 4PJBA 4XN9A 1YAIA 4KRNA 2DH2A 3MCKA 3JT0A 1ZS8B 4BCXA 3PP3H 1NICA 4PG9B 3EYSH 3KXFA 2Q86B 4A6YB 2AJSL 4ONFL 1DSWA 3RVTC 3SDCD 5C70A 1NINA 2BP5M 4JFOA 2QFRA 1JV5A 5DD5L 3U6XS 4MD4B 4NNPL 5ICYA 4MAYC 4J3OC 2OYKA 4BUGA 3D0VA 4K7PX 1YN7A 2CCVA 1I9JH 3T2LA 5E2VL 4FFWC 1E43A 1AZUA 3ZKXB 3V6FB 4JQIL 4IM8A 5JDSB 4LIQE 2WXFA 4OIIL 4QXGH 4U3XA 2CIIA 3EH2A 1WBXA 4J3WA 4UV7H 5I19H 1N3NA 2X4PB 3GTVA 2HJKB 1SYVB 4J3TA 5DJ2B 5T5NG 5LKNA 3I9AA 1GZHC 2AQSA 4B9PA 1P6FA 1WAEA 2ORBL 2NY3D 1JZ8A 1N68A 5JPNC 3SBWA 2C3VB 4YWGH 1IGCL 1NCIA 4ELDA 1DVQA 2HYMA 2BSCA 4OKDA 4YHOL 1RZKH 3BZFA 2BMKA 1M1XB 2FYYB 4PCTA 4OCWL 5FGRA 4YX2L 4DERA 1VB9A 1DVSA 2V5YA 4JHBA 1E6JL 2BSEA 4W68A 3SDDD 3BAEL 1S9YA 1S78D 4NLHA 4IBTA 2F7QA 2DEYX 1GS8A 1WH0A 1MAMH 3GFUA 1TZGL 3ULUE 3GLEA 4XPFL 2ZXEB 4EDWH 1MW2A 4NAJA 4YR6B 3C6LD 3SD2A 5C0BD 2G9HA 4R4FL 1BLNA 3EJZD 2FHFA 3RDJA 4K94L 5CP7B 2H6UA 1VKXB 4PLJD 1MXGA 5HHOA 3TGXA 1GGCH 1PLCA 3GSXA 5HI5C 3MKGA 1HE8A 2AKRA 5K9JH 3CDZB 1OAUL 5INCB 5LDUA 1OCOB 4TUOB 4AL8C 3OZ9H 4NFBA 5F1SA 1BVOA 4WO4D 3FTXA 3BIAX 1ZLDA 3Q9PA 5TTRA 5KW9L 2CHZA 5AZEL 1T0NA 5KVGE 2ARJA 2CUAA 3SPGA 4JHWH 3O6FD 3WIHH 4DKAA 1VFAB 1XWVA 1EDQA 3C2SA 2N7AA 5DMJB 2I25N 3S34L 3W9DA 4NOFA 2V2TB 3PWVB 2DEXX 4IBQA 4APXB 1EAPB 2GUYA 4DSYA 3FO0H 1SPDA 4G6FB 2EDFA 4PUBH 1AXTL 4N2MA 1AO7B 5E94B 3LDBC 1HL4A 4IRSB 4KOCA 4B96A 4R7XA 1N67A 1D3CA 4JO1L 1J87A 3MJ9L 4AC4A 2I85A 1NCCL 1GZPA 5F9JB 3VX1A 5FYJE 4R26H 1UM5L 2XCMC 4OZGE 2PWGA 4G8GD 4QGTA 5J0BA 5AALA 4GSXA 2L7UA 3LNIA 4CSZA 5A7EA 5JPMC 1A9EB 1WZLA 4XPAH 1CR9H 1NFDE 1Z9SA 4G6JH 2UXTA 2RA1A 2UVFA 1HJBC 2OMNA 2R8SL 1CZ8L 1KYFA 4KUCD 1FNAA 2HVJB 1X4XA 3FYEB 1BOGA 3HLAA 4HCRH 1EGJA 4OIBA 3GSWA 5BW7C 3OJDB 4JRWA 2J1ZA 1NCNA 4O51B 1IC4H 1Z5YD 3IAGC 2YSTA 3DXAE 4OD3L 3NJKA 4EOWH 3NABL 2KYIA 2WJ7A 5C7ZA 4UM8A 4EZLA 4EUPA 3WAKA 5J13B 2J73A 2DWDB 4K8RC 4FQIH 4MCZA 5E5MB 4Q4EA 4YHIB 4TV3A 4ZFOB 5D1ZB 2BOCB 4S1QH 4WUUE 5CCGE 1I8AA 2ARWA 5KWYC 3ATEA 4RVBA 5JMRA 1BLIA 1BBDH 3BD4A 4HIEA 3RI5F 4A2MA 4BXVA 3QQ4B 2H6PA 5DD6B 1E28B 3DROB 3B7RL 4ZAKB 2VQ1A 4NRZA 4H26A 4QY8A 1II4E 4IRJB 3FYIB 5LGYA 1H5BB 4HKJA 1J0YA 5J89A 2FX8L 4OLWH 4GMSH 1BVKA 4F7EB 5DHVH 2WVVA 2A74A 5D7IF 1MCWM 3F7LA 4BFFA 2W9DL 1BJ1H 1QYGH 1T2JA 3LN9A 4WW2B 5AZ2H 3VGAC 2OYLA 1SN2A 2X4NA 4AL8L 2QQKL 4X98B 1F2QA 4K2UH 3QYMA 2PW1B 4FYSA 2MQGA 3DXAB 4OF7A 2P45B 3N1PC 5J4MA 4PRHD 1XGZA 3PDGA 5E2WH 2P43B 1NBQA 4H88H 1QLRB 2EDMA 3RPIA 5B8CA 4P2OD 3AWFA 4K7PL 4EBQL 4HOMA 2XTLA 3HAEA 4NC1C 4N9GB 3OSVA 1ET7A 1FPTH 2P8PA 2ZOWA 1UFGA 1EXGA 4CSTA 1X5IA 3TF4A 4Q6IA 4WUUB 3GRBA 2ERJC 3EO9H 5I73B 3EGSB 2BP3A 3DOSB 4HZLB 4GKNA 5J3HC 3CXHK 4PS3A 5AVXB 4EI5D 4L29B 4WU5A 1OP3K 1MREL 1KDIA 2HFTA 2HTKC 4R96A 3WNPA 4ODUA 2JXMB 2VSCA 2FB4L 4K9EC 4XOBA 1YA5A 2ADJA 3GGWB 1JHTA 4PS4H 1NPNA 2FT7A 5CN2A 3WSQH 3GMRA 4OCYL 3WUWG 5E9AA 4KKAC 3CIAA 5FOBA 4F37K 2BY1A 2HKFL 3MTRA 3PABA 3HZMB 3OKMB 2IV9A 4MNQD 2OJEB 3HW7A 4P49A 5CD5C 1RUKL 5IGXL 3NGBB 4JGUA 4Q9QH 4U3CA 4GSUA 1FGVH 2BY2A 3D85A 2B1OA 3BQUA 3L16A 2J6WA 1QI3A 1X7QB 1V10A 2Y1AA 1Q9WA 3TBSA 5AW3B 4HIIA 3SCMB 2P8MB 4D0DB 3T2OA 1SF5A 1XB6A 1ACYL 3LRGA 2LABA 4AGOA 1PX3A 4M7LT 3WGVB 3VXPA 3F6LA 3HG3A 4RMVA 1PQZB 1MPAL 4K8RL 5GS0C 2Y2WA 4YDLC 5FFOA 3MLPA 1UC6A 2VUKA 1LHZA 1XFPA 3D2UA 3NZ8B 5AOZA 2FECI 3IVKB 3ABZA 3TBCA 1EZLA 4I9WD 3OPZH 2FWSA 1FH2A 1U95B 2FD6H 3M1OA 4NBZB 1NIDA 4ZO9A 2A9AA 2V37A 3OV6A 4UCFA 4YHPB 4QRUB 5E1AA 5FM8A 4AYSA 3Q6FA 4BFIB 5CCJA 3SBWC 2IWKA 2QHRH 2GQHA 4UZSA 4HDIA 2WZAA 1X5MA 3QQ3B 3S6CA 7PAZA 5I17B 1BZEA 2HXAA 2YAHA 5IBLC 5E23A 3ROLB 2OULB 2K6YA 2Z4QB 1TJIL 1M7DA 2YMTA 5HHVL 1OTTD 2XRAH 4AC2A 3EBHA 3J27A 4XPGL 1JZ3A 1X7SA 1K3ZA 2WP3O 3TBVA 3U46B 1AGBA 3SY0B 4KROC 2B2XL 2CE6A 2N59A 2CDGA 3H56A 4HS6B 5AVSB 3RIAF 5I1KL 3ABMB 4KAQH 3VFRA 2YRPA 3TJHD 3E3QE 2FQGA 4PJEF 4NDMA 4XBGA 5ECGA 1NBCA 3V5KB 2ODHA 4N0CD 2N3JA 1B4JH 2DQCL 4DETA 3MJWA 3GM0A 2G2RA 4DP9X 4GEJA 4PJAA 4J3VA 4TQIA 2PXYA 4K3DL 1YSOA 4XVJH 4ACPA 4CGTA 1YEEH 1XCQA 3ZQ9A 4F3FA 2GBUA 1U8JA 1ZRUA 4FNQA 5DO8A 1QLFA 4ZOAA 5DCCA 3BDBA 5ADOH 5AEAA 1NEZG 4JM2D 2YEQA 5K9QI 3R1GL 2R2EB 4K9EL 5D1XA 4Y4KD 3WY2A 4N2IA 4QO1A 3O3EA 2QSVA 1R0AH 1HH9B 2YXMA 3DK2A 1F58L 3H9HB 2UWEF 2GSGA 3CPLA 4NXKA 3X1EA 4Y0GA 3SKJH 2ISDA 1AY1L 1J0HA 4CMMB 4FQXD 2YMOA 1N59B 2D3LA 3Q6GH 4GAJH 4KI5D 2ITEA 3MBWB 3L9RA 4L8BA 3WTUA 2AV1A 1QBAA 4PWJA 2EE2A 1RUPL 3F6JA 4G9FE 1HVXA 3DX6B 4WHTA 1E2VA