2LW4A

Solution nmr structure of human transcription elongation factor a protein 2, central domain, northeast structural genomics consortium (nesg) target hr8682b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
b'SHMPVPVTCDAVRNKCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGNTDMKYKNRVRSRISNLKDAKNPDLRRNVLCGAITPQQIAVMTSEEMASDELKEIRKAMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor A protein 2
publication title Solution NMR Structure of Human Transcription Elongation Factor A protein 2, Central Domain (CASP Target)
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 29
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2012-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 2lw4A00
4BY1X 4BXXX 3PO3S 3GTMS 4BY7X 2LW4A 3NDQA 2DMEA 1ENWA
chains in the Genus database with same CATH superfamily
2WPAB 2EUFA 1AD6A 2ZPIB 2ZPEB 3TN8B 1FINB 1TD6A 2C5VB 4OR5B 2UUEB 4ZGEB 3VKHA 1TFBA 2IW9B 1H1RB 4MFDA 4BCMB 4YOZA 3X24B 2CCHB 2UZLB 4AI6A 2WJ9A 2CZ6B 5DQVA 3EOCB 3VKGA 5ACBA 3MY5B 4BCPB 3VYHB 3BHVB 4HNVA 2WEVB 4OB2B 2W9FA 3QYEA 1OGUB 2DMEA 3BLRB 4CXAB 2WMBB 2BS2A 1O9KB 3X25B 2F2CA 4Z6YA 1ENWA 2V22B 1VINA 2C6TB 1H1PB 4ROEA 3WVEB 2W96A 3F5XB 4EOMB 4I3ZB 5IHYA 3RGFB 3DTOA 4F6UB 3TNIB 5DQWA 4AKGA 5IDPB 2DXCB 3H4CA 3DL1A 1KXUA 4YOOA 4ELLA 1OKWB 2CZ0B 2IVXA 4BCOB 4AKHA 5HBHB 2ZPBB 2DD5B 3QYHB 3BLHB 4AKIA 4KRDB 4EOJB 2IW6B 5HQ0B 2BS3A 4NC6A 1UNGD 3QZ5B 4CFXB 3HB9A 2WMAB 4JX6A 4CRLB 2X1NB 4ZGDB 5HBJB 1FVVB 1GUXB 4EOLB 3QWLA 2IW8B 5LMKB 4CFWB 1GH6B 1JOWA 1UNLD 1JKWA 2QGSA 1O9KA 3A8GB 1UGQB 3BG3A 4BCJB 4BBSM 1H25B 2G9XB 3TNWB 4BCIB 2BPMB 3HO8A 2UZBB 4ZGJB 2ZZDB 4EOSB 2C5XB 4YOSA 5HNBB 2W2HA 4OB3B 1JSTB 4EORB 5CEIB 4BY1X 4F7NB 4BCFB 2ZPGB 2QDYB 1UNHD 4BCQD 4BCHB 4OB0B 2KR6A 2UZEB 1OI9B 4OB1B 3HHTB 4EOOB 4JX5A 2I53A 4F7JB 4EONB 4FM4B 1GY3B 3VYGB 4BXXX 3O0GD 4YC3B 3A8OB 4QSHA 3QHWB 2WIPB 5FGKB 3A8HB 1D3UB 1GUXA 5EJCA 4G6LB 4BY7X 2C4GB 3K7AM 4JX4A 2QDJA 4HLQA 2CJMB 4CFVB 2PK9B 3BG9A 3GTMS 2ZPFB 3NDQA 2PK2A 3X26B 1E9HB 3TW7A 1G3NC 1BU2A 5LQFB 1UGRB 4CFUD 5HBEB 1OIYB 4MFEA 4EOKB 2LW4A 2CZ7B 4EOPB 1P5EB 2WHBB 2DXBB 1ZP2A 2QQ8A 3POMA 4F6WB 3BG5A 2BKZB 4BCKB 3QHRB 3A8MB 2ZCFB 4CFMB 1URCB 2IN3A 4HNTA 3X20B 2WIHB 2KMGA 2DPPB 3M03A 4F7LB 1H24B 2W9ZA 3TW6A 5IF1B 2AHJB 4KRCB 4EC8B 3X28B 2B9RA 4FX3B 4HNUA 2R7GA 3A8LB 1N4MA 1W98B 1VYWB 3LQ5B 4Y72B 3BHUB 4BCMD 1E7PA 1OL2B 2WXVB 2ZPHB 3EJ1B 1QMZB 2QFZA 1C9BA 4BCGB 1UGPB 1JSUB 5I5ZB 4M6VA 1AISB 3DOGB 4LOCA 2G77A 3DDQB 3KHIA 1H27B 3B57A 4II5B 3PO3S 1H28B 1OKVB 2CYZB 2C5NB 1H1SB 4HL4A 1F5QB 4ROCA 1QLBA 4F6SB 4EOQB 3QZ9B 4BCQB 2PJQA 3QXEB 2C5OB 4UN0A 4OGRB 5HVYB 3G33B 1VOLA 2I40B 4MIMA 5L2WB 4NSTB 4ELJA 1XO2A 3BLQB 2QF7A 3DDPB 1IREB 2UZDB 3DJBA 3HZJA 5CYIB 4BCND 4F7SB 2BS4A 3HBLA 3MIAB 1UGSB 2PMIB 3TNHB 3QYBA 1AHJB 4CFNB 2JGZB 2WFYB 4IMYB 5IDNB 1H4LD 1V29B 3QYGB 4BCNB 4EC9B 4CFUB 2W99A 4F70B 4TTHA 3WVDB 2DD4B 5BNJB 1H1QB 4EOIB 2CZ1B 2CCIB 4RODA 3EIDB 2PHGA 5EFQB 1PKDB 1OIUB 3MI9B 3MY1B 5ICPB 2D0QB 4BBRM 1FKMA 1H26B 1OL1B 3BHTB
chains in the Genus database with same CATH topology
4BY1X 4BXXX 3PO3S 3GTMS 4BY7X 2LW4A 3NDQA 2DMEA 1ENWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY1 X;  4BXX X;  3PO3 S;  3GTM S;  4BY7 X;  2LW4 A;  3NDQ A;  2DME A;  1ENW A; 
#chains in the Genus database with same CATH topology
 2WPA B;  2EUF A;  1AD6 A;  2ZPI B;  2ZPE B;  3TN8 B;  1FIN B;  1TD6 A;  2C5V B;  4OR5 B;  2UUE B;  4ZGE B;  3VKH A;  1TFB A;  2IW9 B;  1H1R B;  4MFD A;  4BCM B;  4YOZ A;  3X24 B;  2CCH B;  2UZL B;  4AI6 A;  2WJ9 A;  2CZ6 B;  5DQV A;  3EOC B;  3VKG A;  5ACB A;  3MY5 B;  4BCP B;  3VYH B;  3BHV B;  4HNV A;  2WEV B;  4OB2 B;  2W9F A;  3QYE A;  1OGU B;  2DME A;  3BLR B;  4CXA B;  2WMB B;  2BS2 A;  1O9K B;  3X25 B;  2F2C A;  4Z6Y A;  1ENW A;  2V22 B;  1VIN A;  2C6T B;  1H1P B;  4ROE A;  3WVE B;  2W96 A;  3F5X B;  4EOM B;  4I3Z B;  5IHY A;  3RGF B;  3DTO A;  4F6U B;  3TNI B;  5DQW A;  4AKG A;  5IDP B;  2DXC B;  3H4C A;  3DL1 A;  1KXU A;  4YOO A;  4ELL A;  1OKW B;  2CZ0 B;  2IVX A;  4BCO B;  4AKH A;  5HBH B;  2ZPB B;  2DD5 B;  3QYH B;  3BLH B;  4AKI A;  4KRD B;  4EOJ B;  2IW6 B;  5HQ0 B;  2BS3 A;  4NC6 A;  1UNG D;  3QZ5 B;  4CFX B;  3HB9 A;  2WMA B;  4JX6 A;  4CRL B;  2X1N B;  4ZGD B;  5HBJ B;  1FVV B;  1GUX B;  4EOL B;  3QWL A;  2IW8 B;  5LMK B;  4CFW B;  1GH6 B;  1JOW A;  1UNL D;  1JKW A;  2QGS A;  1O9K A;  3A8G B;  1UGQ B;  3BG3 A;  4BCJ B;  4BBS M;  1H25 B;  2G9X B;  3TNW B;  4BCI B;  2BPM B;  3HO8 A;  2UZB B;  4ZGJ B;  2ZZD B;  4EOS B;  2C5X B;  4YOS A;  5HNB B;  2W2H A;  4OB3 B;  1JST B;  4EOR B;  5CEI B;  4BY1 X;  4F7N B;  4BCF B;  2ZPG B;  2QDY B;  1UNH D;  4BCQ D;  4BCH B;  4OB0 B;  2KR6 A;  2UZE B;  1OI9 B;  4OB1 B;  3HHT B;  4EOO B;  4JX5 A;  2I53 A;  4F7J B;  4EON B;  4FM4 B;  1GY3 B;  3VYG B;  4BXX X;  3O0G D;  4YC3 B;  3A8O B;  4QSH A;  3QHW B;  2WIP B;  5FGK B;  3A8H B;  1D3U B;  1GUX A;  5EJC A;  4G6L B;  4BY7 X;  2C4G B;  3K7A M;  4JX4 A;  2QDJ A;  4HLQ A;  2CJM B;  4CFV B;  2PK9 B;  3BG9 A;  3GTM S;  2ZPF B;  3NDQ A;  2PK2 A;  3X26 B;  1E9H B;  3TW7 A;  1G3N C;  1BU2 A;  5LQF B;  1UGR B;  4CFU D;  5HBE B;  1OIY B;  4MFE A;  4EOK B;  2LW4 A;  2CZ7 B;  4EOP B;  1P5E B;  2WHB B;  2DXB B;  1ZP2 A;  2QQ8 A;  3POM A;  4F6W B;  3BG5 A;  2BKZ B;  4BCK B;  3QHR B;  3A8M B;  2ZCF B;  4CFM B;  1URC B;  2IN3 A;  4HNT A;  3X20 B;  2WIH B;  2KMG A;  2DPP B;  3M03 A;  4F7L B;  1H24 B;  2W9Z A;  3TW6 A;  5IF1 B;  2AHJ B;  4KRC B;  4EC8 B;  3X28 B;  2B9R A;  4FX3 B;  4HNU A;  2R7G A;  3A8L B;  1N4M A;  1W98 B;  1VYW B;  3LQ5 B;  4Y72 B;  3BHU B;  4BCM D;  1E7P A;  1OL2 B;  2WXV B;  2ZPH B;  3EJ1 B;  1QMZ B;  2QFZ A;  1C9B A;  4BCG B;  1UGP B;  1JSU B;  5I5Z B;  4M6V A;  1AIS B;  3DOG B;  4LOC A;  2G77 A;  3DDQ B;  3KHI A;  1H27 B;  3B57 A;  4II5 B;  3PO3 S;  1H28 B;  1OKV B;  2CYZ B;  2C5N B;  1H1S B;  4HL4 A;  1F5Q B;  4ROC A;  1QLB A;  4F6S B;  4EOQ B;  3QZ9 B;  4BCQ B;  2PJQ A;  3QXE B;  2C5O B;  4UN0 A;  4OGR B;  5HVY B;  3G33 B;  1VOL A;  2I40 B;  4MIM A;  5L2W B;  4NST B;  4ELJ A;  1XO2 A;  3BLQ B;  2QF7 A;  3DDP B;  1IRE B;  2UZD B;  3DJB A;  3HZJ A;  5CYI B;  4BCN D;  4F7S B;  2BS4 A;  3HBL A;  3MIA B;  1UGS B;  2PMI B;  3TNH B;  3QYB A;  1AHJ B;  4CFN B;  2JGZ B;  2WFY B;  4IMY B;  5IDN B;  1H4L D;  1V29 B;  3QYG B;  4BCN B;  4EC9 B;  4CFU B;  2W99 A;  4F70 B;  4TTH A;  3WVD B;  2DD4 B;  5BNJ B;  1H1Q B;  4EOI B;  2CZ1 B;  2CCI B;  4ROD A;  3EID B;  2PHG A;  5EFQ B;  1PKD B;  1OIU B;  3MI9 B;  3MY1 B;  5ICP B;  2D0Q B;  4BBR M;  1FKM A;  1H26 B;  1OL1 B;  3BHT B; 
#chains in the Genus database with same CATH homology
 4BY1 X;  4BXX X;  3PO3 S;  3GTM S;  4BY7 X;  2LW4 A;  3NDQ A;  2DME A;  1ENW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...