2LW4A

Solution nmr structure of human transcription elongation factor a protein 2, central domain, northeast structural genomics consortium (nesg) target hr8682b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
SHMPVPVTCDAVRNKCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGNTDMKYKNRVRSRISNLKDAKNPDLRRNVLCGAITPQQIAVMTSEEMASDELKEIRKAMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription elongation factor A protein 2
publication title Solution NMR Structure of Human Transcription Elongation Factor A protein 2, Central Domain (CASP Target)
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 29
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2012-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 2lw4A00
2DMEA 3GTMS 4BXXX 4BY1X 4BY7X 3NDQA 1ENWA 3PO3S 2LW4A
chains in the Genus database with same CATH superfamily
4Y72B 1D3UB 5ICPB 1UGPB 4CXAB 1OIYB 5ACBA 2PK9B 2IVXA 1UNHD 3EJ1B 1OKVB 3X24B 4CFUB 2ZPIB 2JGZB 2CZ7B 4F7LB 3QWLA 5DQWA 4HL4A 3WVDB 4OB0B 3X20B 1ENWA 4AKHA 1OIUB 1AHJB 4FX3B 1UNGD 2DXCB 2DD5B 2UUEB 2CCIB 2QDJA 4EOLB 4TTHA 3VYGB 4CFNB 2CZ1B 3A8MB 4HNVA 1JSTB 3BHVB 2UZEB 4ZGEB 2DPPB 1FKMA 4BCJB 1GH6B 2KR6A 2CZ0B 2ZZDB 4F7JB 2F2CA 2V22B 5HBJB 3M03A 2G9XB 2W9FA 4ZGDB 5HQ0B 1TFBA 4KRCB 2WIHB 4OGRB 1QLBA 5HBHB 4BCFB 1OGUB 5CEIB 4YC3B 4F6SB 2WXVB 1OKWB 1KXUA 4EC8B 4ROEA 3DOGB 2X1NB 3NDQA 2PMIB 2DD4B 2W99A 4EONB 3BG9A 5IDPB 1V29B 2W9ZA 2ZCFB 3DL1A 3TW6A 4ELLA 4EOIB 5IDNB 4ZGJB 4BCQB 4MIMA 4IMYB 3VKHA 4CRLB 4LOCA 4BCHB 4II5B 4ELJA 4F7SB 3QZ5B 4BCGB 4JX6A 1TD6A 5IHYA 4BCNB 4OB1B 1C9BA 1E7PA 4G6LB 4BCMB 4OR5B 5HNBB 3H4CA 4CFWB 3MI9B 3TN8B 2DXBB 2CJMB 1N4MA 3GTMS 4CFMB 2PHGA 2WEVB 2B9RA 2C5OB 2C5VB 2WJ9A 4RODA 3DDPB 1O9KB 3QYBA 4HNTA 4JX5A 5FGKB 5HVYB 1IREB 2G77A 4OB2B 3DDQB 3TNHB 1F5QB 4F7NB 4I3ZB 3DTOA 1H1RB 5CYIB 4BCQD 5EFQB 4F70B 1H1PB 3TNIB 1OL2B 1OL1B 2R7GA 3F5XB 3HZJA 2WFYB 4MFEA 2UZLB 5DQVA 1W98B 1O9KA 1GUXB 4BCND 3MY1B 4MFDA 4BCMD 3HB9A 2ZPFB 4YOOA 1E9HB 4M6VA 3PO3S 2C6TB 1JSUB 3MY5B 4CFUD 2PJQA 3QHRB 1H1QB 4EOQB 3QHWB 3POMA 4OB3B 2C5XB 4BCIB 2CCHB 1AISB 1H28B 5LQFB 5BNJB 4Z6YA 1OI9B 2WHBB 2W96A 1GUXA 2D0QB 1QMZB 4AKGA 4NC6A 1VYWB 1XO2A 2IW9B 4BCKB 1GY3B 4UN0A 2I53A 1UGRB 2QF7A 4YOZA 2DMEA 3HHTB 4NSTB 2UZDB 5EJCA 3QYGB 3BG5A 1FINB 3BHTB 2UZBB 2BKZB 3K7AM 4EOJB 4F6UB 4ROCA 2PK2A 4FM4B 3TNWB 2QGSA 1H1SB 4EC9B 2IW8B 2WIPB 3BLHB 4HNUA 4AI6A 2ZPGB 3RGFB 2QFZA 2CZ6B 2CYZB 2ZPHB 4EOSB 3BLRB 3QZ9B 4BY1X 5HBEB 3QYEA 1VOLA 3BHUB 4QSHA 4EORB 2IW6B 3HBLA 2ZPEB 3BLQB 1BU2A 5LMKB 2EUFA 3G33B 2C4GB 3X26B 3HO8A 1G3NC 1P5EB 2LW4A 4EOOB 4BBSM 2WMAB 2ZPBB 2QDYB 5L2WB 3QYHB 4HLQA 3A8GB 3B57A 2WPAB 2BPMB 2BS3A 1URCB 4KRDB 5IF1B 1FVVB 4EOKB 5I5ZB 3EIDB 4BCPB 1JOWA 4YOSA 3WVEB 1H25B 2C5NB 2QQ8A 3X28B 2BS2A 1H24B 4CFXB 3A8OB 4EOMB 3VYHB 2BS4A 4BCOB 2W2HA 4JX4A 3VKGA 4BXXX 3A8LB 3O0GD 3LQ5B 4AKIA 4EOPB 1UGQB 1JKWA 3DJBA 1VINA 1AD6A 1PKDB 4BY7X 3A8HB 1ZP2A 1H27B 1UNLD 2AHJB 3TW7A 2I40B 4BBRM 4CFVB 4F6WB 1UGSB 3X25B 1H4LD 2KMGA 3BG3A 3KHIA 3QXEB 1H26B 2WMBB 3MIAB 2IN3A 3EOCB
chains in the Genus database with same CATH topology
2DMEA 3GTMS 4BXXX 4BY1X 4BY7X 3NDQA 1ENWA 3PO3S 2LW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DME A;  3GTM S;  4BXX X;  4BY1 X;  4BY7 X;  3NDQ A;  1ENW A;  3PO3 S;  2LW4 A; 
#chains in the Genus database with same CATH topology
 4Y72 B;  1D3U B;  5ICP B;  1UGP B;  4CXA B;  1OIY B;  5ACB A;  2PK9 B;  2IVX A;  1UNH D;  3EJ1 B;  1OKV B;  3X24 B;  4CFU B;  2ZPI B;  2JGZ B;  2CZ7 B;  4F7L B;  3QWL A;  5DQW A;  4HL4 A;  3WVD B;  4OB0 B;  3X20 B;  1ENW A;  4AKH A;  1OIU B;  1AHJ B;  4FX3 B;  1UNG D;  2DXC B;  2DD5 B;  2UUE B;  2CCI B;  2QDJ A;  4EOL B;  4TTH A;  3VYG B;  4CFN B;  2CZ1 B;  3A8M B;  4HNV A;  1JST B;  3BHV B;  2UZE B;  4ZGE B;  2DPP B;  1FKM A;  4BCJ B;  1GH6 B;  2KR6 A;  2CZ0 B;  2ZZD B;  4F7J B;  2F2C A;  2V22 B;  5HBJ B;  3M03 A;  2G9X B;  2W9F A;  4ZGD B;  5HQ0 B;  1TFB A;  4KRC B;  2WIH B;  4OGR B;  1QLB A;  5HBH B;  4BCF B;  1OGU B;  5CEI B;  4YC3 B;  4F6S B;  2WXV B;  1OKW B;  1KXU A;  4EC8 B;  4ROE A;  3DOG B;  2X1N B;  3NDQ A;  2PMI B;  2DD4 B;  2W99 A;  4EON B;  3BG9 A;  5IDP B;  1V29 B;  2W9Z A;  2ZCF B;  3DL1 A;  3TW6 A;  4ELL A;  4EOI B;  5IDN B;  4ZGJ B;  4BCQ B;  4MIM A;  4IMY B;  3VKH A;  4CRL B;  4LOC A;  4BCH B;  4II5 B;  4ELJ A;  4F7S B;  3QZ5 B;  4BCG B;  4JX6 A;  1TD6 A;  5IHY A;  4BCN B;  4OB1 B;  1C9B A;  1E7P A;  4G6L B;  4BCM B;  4OR5 B;  5HNB B;  3H4C A;  4CFW B;  3MI9 B;  3TN8 B;  2DXB B;  2CJM B;  1N4M A;  3GTM S;  4CFM B;  2PHG A;  2WEV B;  2B9R A;  2C5O B;  2C5V B;  2WJ9 A;  4ROD A;  3DDP B;  1O9K B;  3QYB A;  4HNT A;  4JX5 A;  5FGK B;  5HVY B;  1IRE B;  2G77 A;  4OB2 B;  3DDQ B;  3TNH B;  1F5Q B;  4F7N B;  4I3Z B;  3DTO A;  1H1R B;  5CYI B;  4BCQ D;  5EFQ B;  4F70 B;  1H1P B;  3TNI B;  1OL2 B;  1OL1 B;  2R7G A;  3F5X B;  3HZJ A;  2WFY B;  4MFE A;  2UZL B;  5DQV A;  1W98 B;  1O9K A;  1GUX B;  4BCN D;  3MY1 B;  4MFD A;  4BCM D;  3HB9 A;  2ZPF B;  4YOO A;  1E9H B;  4M6V A;  3PO3 S;  2C6T B;  1JSU B;  3MY5 B;  4CFU D;  2PJQ A;  3QHR B;  1H1Q B;  4EOQ B;  3QHW B;  3POM A;  4OB3 B;  2C5X B;  4BCI B;  2CCH B;  1AIS B;  1H28 B;  5LQF B;  5BNJ B;  4Z6Y A;  1OI9 B;  2WHB B;  2W96 A;  1GUX A;  2D0Q B;  1QMZ B;  4AKG A;  4NC6 A;  1VYW B;  1XO2 A;  2IW9 B;  4BCK B;  1GY3 B;  4UN0 A;  2I53 A;  1UGR B;  2QF7 A;  4YOZ A;  2DME A;  3HHT B;  4NST B;  2UZD B;  5EJC A;  3QYG B;  3BG5 A;  1FIN B;  3BHT B;  2UZB B;  2BKZ B;  3K7A M;  4EOJ B;  4F6U B;  4ROC A;  2PK2 A;  4FM4 B;  3TNW B;  2QGS A;  1H1S B;  4EC9 B;  2IW8 B;  2WIP B;  3BLH B;  4HNU A;  4AI6 A;  2ZPG B;  3RGF B;  2QFZ A;  2CZ6 B;  2CYZ B;  2ZPH B;  4EOS B;  3BLR B;  3QZ9 B;  4BY1 X;  5HBE B;  3QYE A;  1VOL A;  3BHU B;  4QSH A;  4EOR B;  2IW6 B;  3HBL A;  2ZPE B;  3BLQ B;  1BU2 A;  5LMK B;  2EUF A;  3G33 B;  2C4G B;  3X26 B;  3HO8 A;  1G3N C;  1P5E B;  2LW4 A;  4EOO B;  4BBS M;  2WMA B;  2ZPB B;  2QDY B;  5L2W B;  3QYH B;  4HLQ A;  3A8G B;  3B57 A;  2WPA B;  2BPM B;  2BS3 A;  1URC B;  4KRD B;  5IF1 B;  1FVV B;  4EOK B;  5I5Z B;  3EID B;  4BCP B;  1JOW A;  4YOS A;  3WVE B;  1H25 B;  2C5N B;  2QQ8 A;  3X28 B;  2BS2 A;  1H24 B;  4CFX B;  3A8O B;  4EOM B;  3VYH B;  2BS4 A;  4BCO B;  2W2H A;  4JX4 A;  3VKG A;  4BXX X;  3A8L B;  3O0G D;  3LQ5 B;  4AKI A;  4EOP B;  1UGQ B;  1JKW A;  3DJB A;  1VIN A;  1AD6 A;  1PKD B;  4BY7 X;  3A8H B;  1ZP2 A;  1H27 B;  1UNL D;  2AHJ B;  3TW7 A;  2I40 B;  4BBR M;  4CFV B;  4F6W B;  1UGS B;  3X25 B;  1H4L D;  2KMG A;  3BG3 A;  3KHI A;  3QXE B;  1H26 B;  2WMB B;  3MIA B;  2IN3 A;  3EOC B; 
#chains in the Genus database with same CATH homology
 2DME A;  3GTM S;  4BXX X;  4BY1 X;  4BY7 X;  3NDQ A;  1ENW A;  3PO3 S;  2LW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...