2LW7A

Nmr solution structure of human hisrs splice variant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
170
structure length
170
Chain Sequence
AERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKALEEKIRTTETQVLVASAQKKLLEERLKLVSELQDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine--tRNA ligase, cytoplasmic
publication title NMR solution structure of human HisRS splice variant
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 36
structure length 170
sequence length 170
ec nomenclature ec 6.1.1.21: Histidine--tRNA ligase.
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2lw7A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 2lw7A02
3M8AA 4JI5O 1B76A 5H5NA 4LF7O 3J7AU 1NYRA 3T1YO 4YREA 1V95A 2ZKOA 4YRLA 1HNXO 2VQFO 4GKKO 4JYAO 1NS1A 4DUYO 4HWSA 5A2QN 3T1HO 4JI0O 3RT3C 2HHHO 1XNQO 1J5EO 1A32A 1HNWO 2ZT5A 1NJ8A 4TWAA 1QF6A 2N74A 1FYFA 1NYQA 4G85A 4DV1O 1R6TA 4OLFA 4EO4A 5LL6Y 4ZTUB 4KHPO 4LFCO 4YROA 2G4CA 4JI7O 3UH0A 3HRIA 1ATIA 4B3MO 4YRFA 2DJVA 4YPFA 4YRSA 1IBLO 2ZT6A 4DR7O 5BXZA 4E51A 2ZM6O 1NJ6A 1R1BA 1G5IA 3IKMB 4YYEA 4B3SO 5IWAO 4JI3O 4DR4O 4LF4O 4YRPA 4YY3O 1IBKO 1N36O 2ZT8A 3UGQA 4K88A 2JRIA 4DV0O 1AB3A 2UXDO 2PMEA 1H4TA 4JI8O 1ADJA 4X5OA 3O65A 3HRKA 1AILA 4DV7O 4YRQA 1N33O 2FKXA 3IALA 2PMFA 4NCXA 1XEQA 1FYJA 4P3PA 4KR2A 4DV4O 1ADYA 5BR8O 2AGAA 2VQEO 1H4QA 3J80N 2I4LA 1QE0A 2UUCO 4DR1O 1NJ5A 2J3MA 1GGMA 5LMNO 5IT9N 2EL9A 4X65O 1X59A 1DK1A 1HC7A 2I4OA 4TTVA 1HNZO 4YRNA 1IBMO 4LFBO 2UXCO 2Q5IA 4RDXA 4DR3O 4KQEA 4K87A 3JAMN 1G5HA 4LF5O 4HVCA 1H4SA 4G84A 4X62O 3A31A 4DV6O 4X64O 4ZTZB 2Z0AA 1N34O 1H4VB 3A32A 4JI6O 4P3OA 4YRCA 4HWRA 4A5UB 4Q15A 1F7YA 2ZT7A 4DR6O 1HR0O 4YRTA 4JI2O 4YRGA 1XNRO 4YRIA 2J3LA 3R66A 4LF9O 1KUQA 1EVKA 2DOSA 2E5LO 2ZXFA 4DR2O 2UU9O 2I4NA 1XMOO 4HWPA 3IKLA 4YDQA 4JI1O 3J81N 2UUBO 4LF6O 1NJ2A 4LF8O 4KR3A 3SDLA 3OTOO 3NETA 2LW7A 4K0KO 4YRKA 1YZBA 3UGTA 4NXMO 1N32O 4YRJA 2Q5HA 4AQYO 4WI1A 4YHHO 1FKAO 2UXBO 5FLXN 4HWOA 4HWTA 4YRRA 5BY1A 2F4VO 4GKJO 4X66O 4K86A 4P3NA 4JI4O 3LC0A 5E3IA 4DV2O 4DUZO 1G1XB 1WU7A 4OPHA 4JV5O 1D2DA 1HTTA 5C52B 4YP0A 1NJ1A 1KMNA 3F5TA 4NXNO 4YRMA 2UUAO 4DR5O 4OX9O 2I4MA 5C51B 1KMMA 4LFAO 4DV5O 5LMUO 1I94O 5C53B 1XMQO 4OPAA 4DV3O 4B3RO 1FJGO 1KOGA 4PHCA 1EVLA 4B3TO
chains in the Genus database with same CATH superfamily
1I2CA 2BOCC 1CZLA 1OU4A 3LQFA 4QQFA 1TM4E 3ZS8C 2OL4A 4D7TA 3ZBTA 4U2GA 2Y1EA 2D5BA 4GGMX 2JD1A 4GBGA 4CKEB 5JCOA 4K46A 1W59A 2QE7D 4C5AA 4G0WA 1R1BA 4XEHA 1OCZB 4GDFA 2X41A 3WQHA 2C8LA 1UPTA 3H4MA 1PZXA 4FMCB 1XEAA 1FP1D 3OQVA 1JIKA 3GHYA 1SC3A 3UF0A 2ZREA 3OZEA 1JHYA 5KDLA 3MMZA 3Q85A 1GPMA 4JMLA 4OYYA 5JAIA 3N9IA 5GONF 4YAWA 3DMTA 3SDZA 4AU1A 3JWEA 1W88B 1E94E 3IP3A 1DWPA 2ONCA 1V5IA 1E3IA 3HY6A 2B9EA 2P69A 3PIDA 4ZQBA 2N05A 5FAKA 2E5WA 3KAJA 1KKLA 1N36B 3DXZA 1DIRA 2X8WA 2AN3A 3Q88A 3IEIA 2BSAA 1OREA 1A50B 1CX9B 3KUDA 2XR1A 1E8NA 1W9MA 1R4NB 2W2VA 4GUDA 3VJRA 4GYWA 2ZZMA 1OXVA 2ILVA 2X14A 1GKUB 3FZQA 4LK2A 5HRAA 2H07A 5AKGA 4GSKA 5SYMA 4JNCA 4FFWA 2C77A 3WZMA 2R1TA 2FXIA 3ROQA 5BSKA 4ERNA 1ZU4A 2WNHA 5MDHA 1JYFA 4J0EA 5C35A 1JL3A 2Q9AA 4NBRA 1NN5A 1NE7A 3O4FA 2C31A 4B8ZA 1DAPA 4CTJA 1XWFA 3ID6C 3QU2A 1KIAA 2PAFA 3GR6A 4JH0A 1DOZA 2BFWA 1G1XB 5IH3A 5HUJA 5KNBH 2Q1YA 3D0QA 4ZMSA 4MDYA 4EPVA 1K4MA 5F5LA 4BVFA 1WUTA 1C9JA 4NMXB 3SAJA 1YTUA 2B8NA 6REQA 2QT0A 4BMSA 3WMRA 1XCLA 4XAQA 5JCPA 4FCCA 1M56B 5LA6F 3LDEA 1DV2A 3WQSB 1ZL8B 3IUPA 4HPWA 1UMBB 1C7FA 4PYQA 3OU2A 1ZEMA 1NUHA 4ZZ0A 3VTKA 5GGYA 5BWLA 2NU8B 1Y8RA 1UFVA 4TROA 3NTXA 4X71A 2AFHE 4RPIA 4MR8B 4MI1A 5LYJA 4URUR 3SSMA 3NTOA 3RFFA 3OCJA 2H5EA 4XVCA 4RJJA 4PONA 4EY6A 1FFHA 1TYAE 4X64O 1Y74B 1G5QA 4J76A 3KJEA 3FHJA 4LUCA 2BKXA 5A3VA 4HNAA 1J56A 4EJSA 4RL4A 1M66A 4MW8A 2ZK7A 1G4AE 2XZLA 5EUBA 4BX9A 1ZD9A 1PNRA 2VAVA 2RKBA 4MKRA 2ARHA 4O4JB 4AO7A 4QJIA 3FWZA 3I5DA 2IL1A 1F2TB 1M74A 4M1ZA 4WCEV 2ABWA 3C8HA 1QYRA 3FHOA 3OFNG 3JQCA 2YZ7A 3QHAA 1M33A 1HK7A 5L3FA 4PCAA 2IUYA 1QTRA 1C8BA 1BL8A 4NIMA 2QM3A 1SJ9A 1AZTA 3JATB 4M9SA 1UQRA 1UPFA 3AJEA 3LQ1A 4RK0A 9MHTA 3GYGA 4RM3A 5IYZA 3FVQA 4ICIA 3CBQA 1NM5C 4FI3F 3LL7A 4BNYA 5U4QA 1MB4A 1TT5B 4MVOA 3KJIA 3FTFA 1OPRA 3IT2A 3AHJA 1SEVA 2EX3A 5CA3A 4XD7A 3G2NA 1BXRB 3WP0A 2CXTA 2YDEA 3VU1A 1PKXA 2V7UA 1K34A 1RC8A 3RVDA 4P53A 8ABPA 2YJ6A 2DERA 1I6LA 3BB3A 1I6WA 2XAAA 5GTHZ 3T6KA 3H1KH 1O6ZA 2ZUFA 4XVUA 1J33A 3VM6A 4DMLA 1TEHA 3NX4A 3MOIA 2JHAA 1NWCA 1PV2A 3H13A 1KR5A 5G4LA 1E4YA 3CLTD 3GGCA 4CEHB 3JZDA 3NYQA 5CBKA 4B08A 5A71A 4B81A 3N7UA 3W6PA 1E3SA 1BGWA 4JASA 2FPPB 1T3SA 1ANKA 4KXFB 2EWMA 3KC2A 1MZPA 2FWIA 4U2DA 4GP6A 4BQPA 3ROPA 3G9ZA 1K6EA 2YDXA 4RHFA 3W7SA 2Q7OE 3SLRA 2EJCA 4DLZA 3J7AC 2WUEA 1CB0A 4C0SA 1Z2AA 3W7VA 4GNKA 1VJDA 2PQ2A 3BH6A 5AQ1A 1ISGA 5BQPA 3HB0A 1SA0B 4LYFA 2QN9A 1E58A 1Y98A 1ZAKA 1U2SA 4UCRA 4J4HA 2K1EA 3P9QA 5M29A 5AUOB 3LX8A 1QK4A 1V54B 1HNZB 1A7JA 3U4IA 4J8PA 3MLBA 1R15A 3VPCA 3Q3CA 1JJ7A 2GTSA 3UJ9A 3RAFC 5J9FA 3SHWA 2YOGA 2BFOA 1E32A 5K1ZA 1J0XO 1N8KA 2JFYA 2QTGA 2AOVA 1ZIYA 3NHUA 1TZ2A 3P2IA 4S1VA 2HPAA 2ZM5A 1GGJA 1VL6A 4YV7A 4ZDWA 4OH1A 5IEJA 4H3VA 4DWJA 1VJGA 5BOSA 2R85A 4Z49A 1RWMA 4ENTA 1BGVA 1WB9A 4NG5A 5FULA 4JD5A 2GLTA 3EJWA 4KKXB 3V48A 4H7DA 4URYR 3OEED 2PX5A 3L74H 4H1TA 5ES3A 4I3HA 4DV4B 4YCLA 3L40A 3R7AA 4IKOA 1Z6GA 2ZRBA 2QTNA 3FZNA 2P2ZA 4BVEA 1UK7A 3KKPA 5SZIA 4NBTA 3HRHA 5A3JA 2BDUA 4KZPA 3RYIB 4HPXB 1O8CA 2JEOA 2AOTB 4IHJB 3FZGA 1VC2A 2R9VA 4R8VA 1BIFA 1GAQA 5L3CA 3HCCA 5H2FZ 4EYSA 3TSCA 1YVWA 1G20E 4QOHA 4FYWA 1E1KA 3I3OA 4DPMA 3M4JA 2BHTA 4NEHB 1GPKA 3DE6X 1OFUA 2AJDA 5A5GA 4J4TA 5GZ3A 3ED1A 1TLTA 3LNCA 3G7UA 4M6WB 3V4OA 4PWYA 2ZWPA 1YFJA 4W5OA 4RTNA 5IAGA 3KE9A 4A26A 2IC5A 4LF7O 5F2OA 3FNIA 3UFBA 4AJIA 1U5BA 3GJYA 3OE7D 4L8FA 4UE3S 2CLHB 3QPCA 3PFBA 1VEWA 2VHQA 2J9GA 2OQRA 3H1EA 1SK9A 4QUBA 5EWMA 3ZVKA 4CH5A 4NNOA 4IMIB 5KQPA 3NANA 5MGBA 1XMJA 2ODPA 3AVXA 3LX4A 1DG1G 2ZSFA 1KC8W 2GT1A 5U4XA 1LPBB 3OMAB 2JGNA 3RJMA 4QVGA 4NLLA 5CB8A 4DA4A 4YEDA 4Y8VA 4XJSA 3JAMA 5BYBA 5FBZA 2NUTA 4LSGA 4RQFA 1NZJA 3BWYA 4JHLA 3VZRA 3FLEA 3WIVA 1SULA 1GUYA 2VSFA 4OLBA 1DDIA 4DCJA 3JQ6A 4HJRA 4IO1A 3VO1A 3TX2A 4P5EA 4A03A 5TISZ 4BKPA 3ZCSA 2CTRA 4RF2A 1NDQA 2QUZA 1GTVA 5L4SA 1ST3A 4EO7A 3SZ3A 1MJHA 2Q6AA 5IBQA 5E38A 4H77A 5COBA 3JQ9A 3KKZA 3H1GA 1CZKA 1Z4JA 2BMAA 5TQ2B 2XNDD 1NURA 5EXDA 4CETA 2CGNA 2QL9A 3SPGA 3KFXA 2J3MA 4BAYA 1FTSA 1WTCA 3L1JA 3CLUC 5M34A 4MYUA 3I05A 1N4DA 2FMKA 1XNRO 3D2BA 1L5GB 3MINB 2QP3A 1H2WA 1KDRA 2MHCA 3I5AA 3Q6NA 4HLUC 4UV9A 4C7MA 2CLEB 2PGIA 5JJ5A 2W4IA 3LM8A 1E3EA 1CP2A 5IVDA 2WIBA 2WJ6A 1ATZA 1PZNA 3K9NA 2XQKA 3RW0A 4CKCB 3EDRA 3I1FA 1AJEA 1F14A 1YQTA 1QLWA 4EJFA 1Z2OX 4WN9A 3ESQA 3IDOA 1L5QA 2HJFC 1GYQA 2CFRA 4OP2A 1QPGA 2F9FA 2NVBA 5DWQA 3JYQA 2OILA 1KRXA 2LR0A 3D4OA 4U6NA 4BO7A 1UEXC 1YL5A 5DIFA 3TQRA 3ME5A 5B3SB 2PR2A 1Q15A 3R6LA 3DAPA 1Q1QA 1P6XA 4ED9A 3UWSA 2F7SA 5KOIA 1QRSA 3HVHA 2HKOA 3R9IA 2QVZX 5K0ZA 5LYYA 4WESA 3C70A 4YPVA 4ZI3A 1UAGA 1R8JA 3Q1LA 5TB5A 3VZSA 5COQA 1GU0A 2C2HA 3ENQA 3PDWA 1CEYA 1ZXXA 1AS0A 4B43A 2QTMA 1K5HA 1E2GA 5E0OA 1ZD1A 1XHFA 1GCIA 1TJPB 1N3LA 1JWBB 3FG9A 3ZR4B 3RS0A 4FIPC 1XXHA 1S7GA 4UAJA 3DO5A 1ZOIA 1QDLB 221PA 1JPVA 3EVTA 3KJQA 3LP5A 4MQUA 3OE5A 4JLSA 3ASZA 3E9CA 1H1TA 3K6KA 3U0ZA 3O84A 3K2BA 5AXCA 4JPRA 3KR1A 3ELWA 3ZJUA 4CI0B 2EKQA 2GEUA 3FNGA 1BFUA 3I55V 4AQDA 4U5XA 3FTNA 3MAGA 1F0KA 1JG2A 1FFYA 2GXAA 1BGXT 3UCSC 3ACBA 5IK2D 1QO9A 3A1CA 2BEJA 3HM2A 2H2AA 4EPTA 2QKCA 4RSGA 4ZO6A 1AJPA 5DCYA 4FEAA 2XXJA 1NW7A 4MB2A 4MTFA 5JS6A 5F7ZA 4M1OA 5J4YA 1KQ3A 1KB9F 3MAJA 2GVNA 4DUZO 4TWZA 3HA2A 2PAAA 2WZCA 2ONJA 4LDNA 2R1TB 2D1YA 4EMSA 1H5UA 3CNLA 2AD5A 2W0SA 3WGTA 1WBJB 3ML0A 1L5KA 1ESMA 3OR7C 1NR5A 8ATCA 3QY9A 5AVXA 3BHNA 3AP2A 5AJUA 3HEAA 1P45A 4JBYA 2H7VA 1AF4A 3NEYA 1KMIZ 1NW4A 2HRQA 3CIOA 5IJAA 3UM7A 2HSGA 4X5OA 1D2RA 5FPTA 4OP1A 3FI9A 1RKXA 3P20A 1R7RA 3PUZA 3K5PA 4K8XA 4GRIA 1BDHA 4X7BA 5CURA 1G8MA 3PJSK 4LBEC 1VQ4V 2V9CA 2OHGA 3ZCXA 2ZR2A 2AFVA 6REQB 2ZSEA 4XGIA 1DS6A 2HU8A 3NG1A 2QVLA 3UT0A 3SU8A 1AKQA 1SKYB 4QGHA 5A7GA 5KVCA 2V6MA 1TUBB 5LJLA 1Y8RB 2RBKA 2IUFA 1SRQA 3QPVA 1MUUA 3CUWA 5LYJB 3IIIA 1GVHA 1PFYA 1OLSA 1B74A 1H1LB 1IB6A 1FVHA 1GILA 1P44A 1MIOB 2ZDIA 2VP0A 3GJSA 2GCOA 1X8JA 3L7CA 4PLTA 4OB8A 2BZGA 3AR7A 4HNAB 1P61B 1FVFA 4F9TA 4DA8A 1XFAA 4EJSB 1YFZA 3Q7QA 2HQSA 1ZG3A 2R6R1 5F64A 5EMKA 1I1NA 5LLTA 2QSZA 1E9SA 2A9OA 4BJ3A 4ZT6A 5I51A 3I9V1 3O7MA 3ZTYA 1GM7A 1L7DA 3O1HB 3SYPA 3I4CA 4KI7A 4ML3A 4PYLA 5LDGA 2BSQA 1I01A 4RA6A 1GPJA 4N3AA 1PR4A 2JDID 1HDGO 3ENNA 1P7PA 1EAYA 1UC5B 4CTNA 3M2PA 4RJ2A 1PO7A 4ZAYA 2JGJA 1PS0A 4HB2A 4RV5A 4KBGA 3T1QA 4N39A 1IXSB 2YKGA 3K6SA 4EBFA 4LR3A 5T6BA 2HHCA 4X89A 3MOGA 4C4OA 1DEKA 1NXTA 1CF4A 3KQWA 4N0QA 3W1EA 4JLOA 4B7AA 4OOEA 1S8OA 2DFKB 5HFAA 1AVTA 4HDSB 3D7MA 4GRAA 5DN6G 3SFZA 4YQFA 2Z4RA 2VRNA 3EVCA 1P5ZB 3E8SA 2CCGA 2ZIVB 2WLIB 1FXSA 4J2TA 5FPYA 3IOEA 1UXGA 2W93A 4MGZR 1DHRA 4X91A 4KZKA 3VVMA 3PXXA 4RHUA 3JYOA 3JARA 5EC8A 1GL6A 3KB2A 3G5LA 2QJRA 2XH8A 4RXMA 5ITVA 3EDCA 4UNQA 1XV5A 3VX3A 1COZA 1KI4A 2P2SA 2AUMA 1U99A 3K73O 4X90A 1U9ZA 1QS0B 1HEUA 3M99B 4TXLA 2CK3D 3GNQA 2XE4A 4JOQA 1IUOA 2G5GX 1I4WA 1VHLA 3R7LA 3RVJA 3L93A 3FYSA 3PNYA 3TXSA 4Z2WA 5BR8B 1HDEA 1X2EA 2A0LA 1DC8A 1PDWA 1PQYA 5DBOA 1VPTA 4Y6SA 1M7GA 4NNJA 1A8IA 5AOAA 1EFLA 2KMLA 2W9XA 5I9MA 2W2XA 3OO1A 2VQEO 3F5SA 1KEKA 3FKSG 3GEMA 1WEKA 3K71B 3S4YA 2O0KA 5J5AA 3E18A 3QV1A 4YIKA 2B8WA 3AVTA 3FR7A 5AKEA 2XRFA 3SHFA 4QZVA 4HZUA 3CUTA 2X0FA 4A3SA 1QFZA 1OI2A 4ZVLA 2HFKA 4EG5A 2FPGA 4HI0E 1PWEA 5BY1A 1PPJH 2F4VO 1BVUA 3F8SA 1XHEA 4I50F 2QQGA 3LPNA 4YP5A 2R5WA 5BSWA 4DV5O 2ONKA 2OXRA 2IJJA 4LHVA 2PX0A 2NPIA 4CUJA 5JADA 5I5EA 2HU5A 5KNBA 2RGEA 4Q9IA 2QTTA 4EKNB 4NTZA 3FUXA 3LUPA 3DLHA 4Z4FA 1O8BA 4KR0A 4IUYA 1W4BA 5K9ZA 1U7HA 2BCEA 5FYDA 1OHHD 1SU6A 4I55A 1QLHA 1ADJA 3PGLA 4DW8A 3U4DA 2PL1A 3DNMA 3AIOA 1U0GA 3MJRA 5TC4A 1NJ5A 1QQ5A 1XEFA 2VK1A 1WBBA 1BEUB 1W94A 3IDAA 3WO0A 1QV6A 2WJWA 2WHQA 1H1DA 4UVIA 1HLGA 1N2OA 3B8MA 5K0TA 4OYRA 1D4AA 2IIQA 4YP9A 2QJWA 3IVRA 3SLKA 2PCJA 4D9EA 3DO6A 16PKA 3OWOA 1U7OA 3LC0A 1VMDA 3QKIA 5FI3A 1E7SA 2WJAA 1PFUA 1CUIA 1DGQA 3QI2A 4G3XA 4B45A 4TRNA 1V1MA 5CN0A 4ZQHA 1PW7A 1TQ6A 2NM0A 5BW5A 1ODSA 1KKMA 2MWMA 5JD3A 3TG8A 2OQ2A 1WUJS 4W8HA 1NP3A 2IDMA 4B4KA 3NHMA 1ZK2A 4KHPO 5IX8A 4ILEA 3MA0A 3JXEA 2PUBA 4UCOA 1JQDA 4MUMA 4FVMA 4L5JA 4RXTA 4LNAA 5CRIA 2YJGA 4C4RA 3JQBC 4JR1A 3WHPA 2OFFA 1YQWA 1JXOA 4MRAA 5KNCH 3LGAA 1VF7A 1JJIA 1W2BU 3NIFB 2R9AA 2OTCA 2CTQA 1ORQC 2QMYA 3FE2A 1H3EA 3PUHA 1M4UA 2JC3A 1G6Q1 2BMVA 3VBCA 2FF7A 3H2KA 3BZWA 4AQYO 5EWMB 4FJ0A 4AECA 4JIMA 3NW9A 3OTHA 1H23A 4TYQA 5EZYF 3CCFA 5EC2C 3FSRA 1KI7A 2Q27A 4ZEWA 1DLIA 1Z17A 4TZTA 2J3IA 3ZXUB 2V7PA 5B7NA 4KNVA 3VYWA 1MTZA 2L18A 3GGJA 1QF6A 4PZPA 4KIGA 4BKMA 5JJJB 3WU2Z 1W8DA 3RBZA 3UAOA 4N5DA 2AZTA 3PI7A 2QNBA 2BYTA 4NWIA 4HD8A 4J07A 4HADA 2PZEA 3GLVA 4Y2UA 3G2MA 2ZR9A 4LFBO 1V5GA 2WHEA 1QBZA 1CR4A 4WOPA 3IGFA 4DBVO 4G2TA 1KZGB 5TMPA 4B3RB 1FEZA 1YJBA 5K4GA 4DQXA 4CS4A 3CC2V 1GZ3A 4CIDA 1L5NA 5CDHA 5BUQA 4X6YA 4RM2A 4LRQA 2I0FA 4D42A 3C7CB 4YJHA 2B61A 3E27A 5TVGA 5JQGF 4NVPA 4B3CA 3HDGA 5CD9A 3RG2A 2UKDA 2VDJA 5GOZA 4N21A 2P4SA 3HCBA 2ZWIA 1SVMA 2H2DA 3PZRA 2BFAA 2B1QA 4J9VA 2ECOA 4LHSA 1G8YA 1E1DA 3FM9A 1R4NA 2NV0A 5EHZA 1WPXA 1PQ4A 5F7XA 1CZUA 5LQMA 3UMVA 3PGXA 1P1IA 1D7AA 3HJCA 2FYUH 1T9CA 3M89A 4F1KA 1P7WA 1MO3A 2NVUB 2KQUA 1WUKS 2C7BA 4GMXA 1CUXA 1RFGE 2JVDA 3T7TA 3TZBA 3R66A 2E5LO 1H5NA 4Q4LA 4WN9B 3S2FA 1Q21A 4QD3A 4DL9A 4ZT5A 1GSHA 1QIGA 1FMCA 4KRXA 1IFXA 3DDHA 1JBEA 1B2LA 3OZGA 1TZBA 1K8ZB 4GGPA 4DZZA 3QGMA 5CDSA 1N2CE 5HJEA 3NO4A 3WRYC 2VHUA 1UBTS 2PNJA 1BE6A 1IZ7A 5EP4A 3A4YA 3U10A 3N70A 4WESB 3GFVA 4LFCO 5EPOA 1JMKC 1NLYA 2A94A 4JLUA 2DPLA 2AMYA 2VZ8A 4MITA 3K4HA 2QD2A 2GVZC 5G41A 3BZUA 4BO5A 4GCZA 2K5UA 1MO2A 4LISA 1JVSA 1DC6A 1LZKA 5F76A 3AQIA 4OQDA 1XXHB 2NU8A 1MOSA 4XSHA 3VRHA 3DMRA 5HIMA 3ZW9A 3GI1A 4NENB 3NAQA 5KHOC 2K9PA 5AKHA 1QCZA 5MFPA 3OOHA 4UJ5A 4QJBA 1WXGA 2HCFA 1EVYA 3IUNA 2WLTA 1URPA 4X3PA 3LX5A 2ZUSA 4IHKA 3M7MX 4C7OA 1EFKA 1SCKA 4RSHA 1HYQA 5IZ4A 3L6RA 3HSSA 3K7EA 2BSKA 4MTLA 1TMYA 5FDFA 3H86A 2Q4BA 2BCCH 2PLFA 1ZRNA 1OR8A 4UFZA 1UFIA 4DCCA 3OEWA 2QPLA 3IV7A 1VL5A 2OBYA 4CWAA 3WGZA 1JHAA 3QWIA 3I34X 3L7MA 3V4FA 1Y1SA 2DYRB 3LE8A 1RPOA 1Y7TA 5TS2A 2OKGA 3CUEF 4K26A 2ZSHA 4RVDA 4TTQA 1H38A 2B9ZA 1R3DA 4DSZA 1A72A 3LVBA 4MR7B 4RORA 4FYXA 2WW8A 1LK7A 5T5QA 3RC8A 4C20A 1TT5A 1P2BA 2X5XA 3FB8C 1EXNA 4R98A 3B8NA 4I5EA 4ALMA 3OF3A 3ANMA 4NI5A 4V0MA 4C5CA 1BXRA 3P7MA 4E33A 4WVLA 1IY2A 2ZOSA 3LGSA 3JTEA 5JY6A 4MVJM 4BNUA 3I23A 5KOJB 2EAUA 1VQ1A 3WG7B 1GTSA 4L4RA 2DYSC 2V3VA 4AQ7A 4GSYA 4EJ6A 4OAPA 1I9GA 3FSGA 4HNTA 1VIAA 4FCTA 2M98A 3QP9A 2DBVO 1HG0A 2G88A 4IVPA 2QSUA 4F1WA 2BI8A 3ESYA 4HNVA 4CEHA 4DIDA 3QPUA 3BY6A 1E3JA 4HB3A 3QUBA 4Z0PA 1SXJC 3BJZA 1GRVA 4JP5A 4IICA 5BV7A 1W5FA 2FPPA 3JAMN 3K1JA 3DG9A 3X2SA 4N9WA 1T2DA 1A7UA 1Z36A 2GCOB 3ISTA 4GWKA 2YC0A 3TO5A 4KR3A 2I7TA 1RPZA 4AY2A 3RKSA 1WMAA 2P9CA 3P9NA 1VJRA 2R66A 3HI4A 2WMDA 2XA2A 3E6AA 3PUWA 4JAUA 5CDFE 1XZDA 1YJAA 2OHOA 3IXLA 4XUEA 1K9SA 3K5IA 4HEA6 1GYRA 2HEPA 3L4BA 1XQWA 2EJTA 3CUYA 3NEJA 3A25A 4F72A 3VKGA 2PWZA 4MI3A 2ORIA 5CJ2A 4P92A 5AG2A 3NM6B 3HO6A 4TT3G 2Q9UA 4NZ9A 4XIJA 1RXVA 2X86A 1BGYH 5FNVF 4PU0A 3TYXA 1AUOA 4AKSA 2RGYA 1KZ7B 1UJNA 5K45A 4B4UA 3A4IA 1NUQA 1RZUA 1FMFA 3MCZA 4NS1A 3ODGA 4TRRA 4PPYA 2I99A 5FTNA 5JVDF 4KWHA 2GJ9A 2OXTA 5T7BA 1CY1A 2D59A 4NB5A 1CZOA 4MV8A 3CXCU 3E9RA 4YV0A 1QP7A 5CA0A 1WV1A 1IATA 3UH1A 2AZ4A 3CONA 2VBCA 4ZN6A 4MHSA 3HXOA 3ZX6A 4CLHA 4D81A 4IIJF 2CB0A 2ODWA 2ZB8A 4J2OA 3N7TA 4JJKA 3Q4HB 2YN0A 4M0FA 2DX7A 1AK9A 1V9SA 4LNHA 1WY5A 2XT9A 3KLOA 1GKIA 1H2RS 3PE3A 1KDVA 5JDCC 4B6JA 4AJ1A 3T9AA 2HD4A 3MMXA 4PXSA 3PUIA 3JARB 1NJ8A 2BMFA 3IUMA 2BGKA 2GI4A 5B4VA 5KQGA 4HQNA 4S1PA 5CFOA 4MP6A 3TXQA 1G63A 1W5EA 2F3TA 4BFCA 3FA2A 1GL7A 3CO0S 3M4NA 3T5TA 2ADOA 1R6BX 3IMEA 3ZIUA 5IYBO 1E1QG 3CO5A 1Q0QA 1WCV1 2GAFA 3A0RB 3CEIA 1JRLA 2XMQA 4CDNA 1K5QA 3K79A 4MARA 3GP8A 2AOTA 4Y6GB 4ZCRA 1CLEA 1YV9A 1SR8A 3B6JA 5SV2A 3QE0A 4JWTA 5HXAA 4R6XA 4XR9A 5K20A 4YDQA 4JFAA 1O2DA 4J49A 1IN4A 4MRNA 1ESCA 3BGWA 1F6DA 4PYRA 1XPOA 2VNAA 2BFBB 3RF6A 4RS4A 1HYGA 5DU2A 5IWAB 2PGDA 1OFUX 4ER7A 1WDTA 1C3OB 5CDTA 4M6WA 1VSUA 2OV2A 5IAOA 1GTG1 2UYYA 3HGMA 2E6UX 3QIAA 3AZPA 4FGSA 2V4DA 1JI3A 1YAJA 1N77A 2Q49A 2GZSA 3N6XA 4J7AA 3W4JA 2FLVA 1GQOA 2YV2A 5J2UF 3RSCA 4HZUB 3S7TA 1NU8A 4DXAA 4DRZA 3BX1A 1FFBA 2YHAA 1VE6A 4G0YA 3EVEA 2FPGB 2HWUA 2X9QA 1ZO8A 4FOSA 4I81A 1D09A 6Q21A 2QR2A 3L5OA 4YECA 5EZQA 2UXBB 3MC1A 2Q46A 2D2XA 4K81B 4IV5A 3OIYA 4X65O 3LHDA 4INJA 2I4OA 1RMQA 5KNDH 1T26A 3LSYA 2XQIA 1W87A 4HYOA 1VBFA 2CFTA 4AP6A 4Q37A 4D8XA 4WOKA 3DEHA 2DUJA 3QE3A 5AVRA 4MVJG 4DABA 2DQYA 1G3QA 2PKYX 3RVMA 1LCIA 4IZIA 4P3YA 3ZLBA 4A6EA 9ABPA 1WXEA 4IIFA 3FVRA 1JYEA 4G24A 3ET5A 2BW0A 2FPSA 4QLOA 3O1LA 2ZSBA 4E2ZA 2XMSA 1RQRA 1AD2A 4INZA 3HWX1 5D2CA 2G5TA 4D3YA 1QAQA 1RXYA 1JI0A 1DKNA 1EDOA 5HUHA 4YY3O 4XVRA 4P08A 3H04A 2IA5A 3S2YA 3FWNA 1LPMA 3TZEA 3OQNA 3CZ4A 3MUNA 1JHUA 5C37A 4O63O 5TQ2A 3TTSA 2Q5CA 1V1MB 1GRQA 3DMDA 4MNTA 1I3MA 1KDTA 2I76A 2QY9A 2CXSA 2P2LA 3GRRA 1CY7A 1DXHA 2CJPA 2H9IA 3EGWA 1K73W 1XROA 1XRNA 3CR3C 2QLTA 1C8VB 2SKEA 3UK0A 3MTJA 3MINA 3ZCVA 3D6TB 2JFHA 5BMOA 2OR3A 3BAFA 4I1YA 1PTJC 2KYRA 5D6OA 2GOYA 1V8PA 2C97A 3L82B 3SP1A 1IOWA 1V95A 1CY0A 2LTAA 1DTWB 2AJ8A 3BB1A 1YONA 3WLHA 5C1PA 2AYYA 4O4HF 2DPHA 3UJ8A 2EBOA 1ZI8A 3V97A 3O9VA 4TVOA 3E8FA 3JY6A 2P6NA 3UPUA 2W2NA 1YHNA 1Q1GA 4UTRA 4F93B 1SBYA 4UM5A 3OTFA 2IYNA 4YMSA 3P9XA 1XD8A 4LJSA 3K0KA 2Z57A 5AHRA 2YXEA 1Z5ZA 2VSOA 4ZQCB 4LWPA 4D4MA 3U4HA 5TPZA 3CB4A 2ECQA 3KQKA 1ABFA 2Q3CA 3MWGA 1EDDA 1TW3A 5DHRA 5L4LA 4WY2A 1KJJA 4TMVA 2JLVA 5SYNA 3MHSC 4QSMA 1KFCB 4UUNA 4M1SA 2BHNA 1YDEA 3OZWA 5FJIA 3OPNA 2VPYA 2OIEA 3AT1A 2EILB 2APJA 1CVIA 4INAA 3TIIA 3ZNQA 4DAEA 3NVKI 5LP1A 2GD1O 3NH9A 4WKCA 5JAOA 1M72A 5H82A 3P3PA 3CCCA 1UKAA 3W6UA 3GGPA 1FUEA 4YJHB 4BO2A 4LC9A 4X62O 5KX5A 4I1SA 2ZCEA 5L7YA 3OG9A 3UW3A 4QRIA 4Q05A 1JVNA 3O26A 2J3LA 3BJRA 4L8LA 1WMBA 4R9UC 3ENWA 4N40A 1CJSA 2VJMB 3EQ6A 3UN1A 4AZVA 3H8SA 3ZVNA 2N1BA 1XL4A 1Z8DA 1Q95A 4UUQA 4RVSA 4KW7A 5FWDA 3G8CA 2RJNA 2IS1A 1S0VA 1U5CA 2XUGA 3ILHA 4J11A 2XB2A 5EZ6B 3C3CA 1PJAA 2O48X 3F7OA 8LDHA 1UDCA 1YL7A 2HADA 2AJTA 3TMAA 2H59A 4C3OB 3ZD9A 1ID1A 1F9AA 1UPUA 5ES4B 2IWHA 2R68A 3PNKA 5KMGB 1YMQA 1YIOA 2ZQ5A 3L8EA 3D0OA 1RRMA 3R5XA 3MJ4A 4HAMA 1IEQA 4E1VA 4BLVA 1EZ1A 4N6OA 2N1MA 3EQZA 2D5AA 1QG4A 1JIUA 1D8TA 5FUQA 4N5HX 1SS3A 2NACA 4IIBA 1MV8A 1FRNA 3KSMA 3TBFA 3A6GA 2F9MA 3GRKA 4QPKA 1BQZA 2HA2A 4JC5A 1E1CA 1Q0HA 1FXKA 3UIEA 2IXEA 2H1IA 3DLIA 1EE2A 4QJ4A 4HOYA 2JIBA 2G9NA 5A06A 1OH8A 4QOGA 1PD3A 3N3AC 1TUBA 2YJ5A 1HKHA 1Y4SA 3HADA 5H59A 4XFDA 5I4CA 5A4DA 1RM1B 1UJCA 3NIDB 4G0OA 3RADC 3MD9A 3Q8WA 1H1LA 1JUDA 2NXEA 1MIOA 4GX1A 2ZXWC 4Q3KA 2GBGA 2QVGA 4ZARA 4PYKA 1RAAA 2X8AA 5ECGC 4JC4A 2CMKA 4C7OB 5GZ6A 1JFRA 2H9AA 1CE8B 5EJIA 4AL4A 4ZGWA 1TYBE 4AULA 2XUPA 4DMRA 2BSKB 1CDDA 2YRWA 4ENQA 4HGRA 2VXOA 5I7SA 2IUUA 2LPMA 2POCA 3BKXA 5JMTA 1JTFA 4Q4HA 2Q9BA 5KC8A 4X7MA 3U3XA 1JHVA 4U3JB 1PZMA 2O19A 5KNCA 3TIFA 4HVTA 4J41A 4ZRMA 2AL7A 2OMKA 3LIPA 4YQZA 1Z7EA 4UEJA 5IABA 4FK8A 4CLDA 3GOHA 4ETWA 1NG9A 1E2PA 3DE4X 5TMDA 1BQEA 4IIEA 1EVLA 5L3SA 2PWBA 2JFVA 5AHKA 5DNVA 2XKAA 3BGSA 2QTBA 4FFVA 1MMFB 4QYWA 5FL7A 1S2IA 2PYIA 2WKQA 1XO1A 3TQHA 4R2IA 2XCIA 3KL4A 4DEYA 1E2FA 2VHWA 1N6HA 4YQEA 3ASVA 4HDSA 4FPXA 3BD6A 2QRGA 3F7TA 4H59A 1NN1A 2YVUA 3PRKE 1IXBA 2DFVA 2Z3WA 1QYCA 3IIMA 3WMFA 1RYFA 4YJKA 3KV3O 2WLIA 4WBNF 5J59A 3TF5A 1U0FA 5JY1A 1LPSA 4FSHA 4DBLC 4KFSA 5DBEX 1CUSA 4QBGB 1FYDA 2E4WA 1W6RA 2YIMA 3OOSA 1C1HA 3WYDA 1KQGA 5DCUA 4CH4A 3ACDA 3TJTA 1QS0A 2AN9A 4WZBE 3CEMA 2H51A 2PUJA 5TARA 5KTRA 1B15A 3S2UA 3SJZA 2X19A 1LC0A 2JEYA 1XN1A 3OWHA 4PG7A 2BTOA 1T9ZA 1ZVVA 3TFOA 1AT1A 1TKRA 5DECA 3AL0C 1ODKA 1CV2A 1B6SA 4JJEA 4NJEB 1K2WA 1E6MA 4KE8A 1NF2A 1IMJA 3KQTA 4RZSA 1YBVA 4BO3A 3B9PA 3Q98A 3CZQA 3CLSC 1XTKA 5L9AA 3IPXA 4OYHA 5AJXA 1BEZA 1VPLA 4JLJA 4DIUA 3C45A 1YDHA 4Z4CA 5DX1A 4O33A 2X4IA 4J29A 3UJPA 4P7KA 1YR2A 4YV2A 5KQMA 3L9WA 3V42A 3FYTA 1TQ8A 4AM8A 3JSLA 2C2YA 5JPIA 1G8FA 4PI0A 3AJ9A 3ROXA 4TKVA 1SN7A 4AICA 4EEQA 1U4OA 4XPZA 1P5FA 1HX7A 1ZH0A 1M1YE 2LD4A 2VHTA 1PJLA 2VSYA 3IAAA 4LWSA 1U8EA 2ZYRA 2ZXEA 3Q3HA 5JSYA 2Q68A 3IAYA 4EBBA 1JU3A 2EIXA 3KVOA 3Q8XB 3VZBA 4TVBA 5CA0B 3LJKA 1Z37A 1PBTA 4PC1A 3TVYA 1CRLA 2XHZA 2Q6OA 2ZTHA 4RDHA 1UXJA 3GCZA 5JQWA 1MB3A 1U2QA 1QVVA 2C4HA 3ELUA 5K4HA 3E61A 4M55A 3BIOA 1RWVA 4JV5B 1H8ED 4UE2A 1RPRA 2HFJA 2VK2A 2YDYA 4FOPA 3EMBA 2P1DA 4HEHA 4GYKA 4YMWA 4EG7A 2ITDC 1E0AA 3QYJA 2HA3A 3PXBA 4WJKB 2P11A 3OMLA 2QRPA 3P4XA 3U3DA 1EAMA 4OU4A 4FFKA 1EWYA 2NT4A 4HNSA 2OQVA 4AKGA 4GXQA 3H3FA 2RDCA 3GFBA 4MUHA 1FJGO 5AW7A 1JF8A 3F97A 4CQLB 4BCBA 1CEXA 1S4MA 3BH0A 3GRUA 1AA6A 4XOIA 4ZQGA 1V26A 1XTQA 1QVAA 2HLHA 1M2VA 5CYFA 2OM2A 3WGJA 3ETLA 4X1KB 4DLUA 5JYEA 3DE2X 2QUJA 3QMVA 1KO5A 1MO5A 3AEXA 4RHXA 3OZUA 4GUNA 3T3GA 3C5VA 4MDFA 2FAXA 3ZVLA 1Q2XA 4ANFA 5E95A 4PV7A 2XRYA 2VR1A 4KAAA 3R76A 1V1RA 5JIBA 1KKCA 2WE8A 2YHIB 2JIZD 2XF8A 4R84A 4DWOA 3GRPA 2LQTA 3OHMA 3NHWA 4DSAA 3A1DA 4PHGA 1WDKA 3WZ2A 1OROA 4CT0A 4OHWA 3QTTA 1E4EA 4YXWD 2XCOA 4RD4A 5HBRA 5H02A 2EVWX 2ZIMA 3E3AA 2NU7A 1NF8A 2C61A 4HDMB 5F73A 5JXGA 5J23A 2B35A 2AX4A 3FTPA 2EIMC 3TPFA 2OG2A 4RFSA 2JW5A 5HMMA 1DAFA 4RACA 2FR0A 2PTMA 3WQQA 3WL8A 1BJRE 3G0HA 1ZM3A 3FFAA 5BR7A 4IOKA 2DHEA 3VPHA 4OL9A 1L4NA 1TU3A 2WKRA 4KBFA 4FMCF 1FDOA 3ZWYA 3IC9A 2C7VA 1DELA 4FX2A 2XTNA 3AR8A 4BNFA 2QM7A 1GAJA 5DLPA 2B94A 5DO9A 1U3UA 2QHXA 4X0EA 4X1YB 4LFAB 2P9ZA 3ONNA 1WM1A 4V0QA 1JV2B 1U8ZA 3IMKA 521PA 1ISPA 3CMAV 2JHCA 2E3JA 2GTHA 4G9EA 3R6WA 1AC5A 1NVFA 1UKVY 4LPSA 4COKA 4BAGA 2UDPA 1PK8A 1Z5NA 4RE6A 4KQHA 3U4AA 2YNMD 4ZI7A 2ISCA 3UC5A 4H44B 4WD3A 3RC3A 3JQFA 3LSTA 3SQMA 3THOA 3O8LA 2PX8A 3I12A 3ZS8A 4KIUA 4BVLA 1FFXA 1UT8A 3GZTB 3WX0A 1NJSA 3AETA 1TF7A 4RQUA 3HR8A 4K9RA 1SQSA 4UEWA 5AKYA 3BWCA 5IDYA 5C9ZA 2IXBA 5KTPA 2PU7A 2JFFA 1GKLA 4OGQB 2BMEA 4RVNA 1D1PA 4MYRA 3PC4A 1GMGA 4MI9A 4FLMA 1UBKS 2AZ2A 2YJ4A 1KVQA 1PE0A 2V55B 3BYZA 1YMUA 4TSFD 2A1IA 2NVUA 2X6RA 3EPPA 2EIKC 3QFTA 1OBHA 1WWKA 1Q77A 3PQDA 3J81k 1TCCA 4DV0B 1ULSA 1FDUA 4UV8A 1YVPA 3L77A 2X0NA 4F8EA 4RAOA 5H5NA 3KQYA 3HJFA 4QJ3A 1OFVA 3WFIA 3RS9A 3A9WA 4JI0O 1LQUA 1NSTA 1JKJA 2OUKA 5J4VA 2VEOA 3I2HA 2OZEA 1ZJJA 5BRNA 4PGGA 2QVXX 4KLRA 4BFLA 2GPSA 1JEEA 4KAXA 5FX2A 3ZHYA 1T2NA 3WWPA 3E82A 5C2JB 3SHTA 3QKWA 2B20A 1ZQ9A 1M34E 3KHUA 3TSOA 1AGRA 5DW3A 3QNWA 5JE8A 1E92A 1IDN1 2DQKA 3RG8A 1ZNXA 3FCXA 1D6MA 3W5VA 1D2AA 3V5NA 2W6MA 4O4JF 1J2TA 4NENA 3EISA 5HDQA 1P9RA 2QVYX 4M0MA 2O7QA 1GSIA 4ZOEA 2B83A 3RFTA 4OA8A 4H13B 5ESXA 2IHNA 2UYGA 4KU4A 4Q93A 5EJ5A 4RKRA 5KX5B 1YU6A 2AV6A 3MWDA 3G6KA 4UHJA 1F06A 4KG7A 3ZHUA 1IX9A 2DFNA 4B3SO 1F8GA 1E2NA 5BZBA 4PZEA 3ZI4A 1QSGA 3ZC3A 5K3CA 1WAZA 3BHPA 1J0DA 4UVGA 2YH2A 5WRFA 3AVOA 2R1ZA 4GKJB 1DCKA 1IDSA 5FUWA 4NRDA 3T1NA 2YCBA 1HFWA 3D2LA 3AFGA 2P3SA 4QATA 3SXJA 4CFYA 4D9NA 3Q9NA 2QMEA 2QN6A 4MR7A 3KSBC 4II3A 2PGAA 2CXRA 1T3GA 5KCMA 5LNK6 4RKEA 1Z5UA 2CKMA 4YDSA 3UJCA 2WU3A 2ZQMA 1U3VA 4PZ0A 1C3VA 4KO2S 4LCUC 2TRSB 4V2UA 1X1BA 3EUWA 2V7QG 3DMFA 3QXCA 4F7DA 3G0DA 1O6GA 2QAGC 1YQGA 1YOBA 2X5KO 4BQFA 3NP9A 3KQMA 3ZU6A 4Q34A 1UBCA 1P91A 4HRVA 5C1IA 3O92A 3PQEA 5KOJA 2DPGA 3UTCA 2A8YA 4ZVNA 2P9QA 3SJCC 1LFAA 3UENA 4NPAA 2V59A 5AW2A 4PIPA 3AK2A 2RHMA 1F3OA 5BW6B 3G2HA 1U63A 4ARBA 3DLBA 4NYMR 3R3XA 5AVVA 4BV8A 2V45A 1E1CB 2ZKIA 3PICA 4OB6A 1FXKB 1WP7A 5IXSA 1NM5A 3QLEA 3T7EA 5MN5A 5DJ5A 1NVPD 4Q7KA 2QWXA 3FR8A 4ENRA 5IDVA 3A32A 1B00A 4YT4A 1F8XA 5BSEA 4CIXA 4GP7A 4HWPA 1UP7A 5I47A 2YXYA 1NNEA 2GKGA 3SPJA 4GICA 5JDIC 1SVWA 1SC6A 4QGSA 2Y68A 2CUKA 3MHTA 2WZBA 1RABA 1EJBA 3DCNA 3A3YA 1ECPA 1XP8A 4R7ZA 3NBKA 4OK6A 5KHJA 1U4NA 3N58A 1JLRA 2OUIA 4E4EA 4J9YB 1YS6A 2OCCB 2QUIA 1XEWY 4Q4HB 3EIXA 1WAMA 2VSXA 1RLMA 4B6FA 5JG7A 1PFGA 3AGPA 1BT8A 1SK8A 1G2QA 1P6QA 1SXJB 3NLLA 2BIFA 5EINA 1P0CA 1S8NA 1ZD2P 3O74A 3OZFA 3IMGA 1WB8A 1BDJA 3F2IA 3QVOA 4G0ZA 2PUDA 5AKZA 5L3SB 3H2BA 1VA4A 1YQDA 3ENKA 1I7DA 1RKBA 1TO2E 3ZCQA 3T9EA 3MN1A 2G83A 3PWZA 1BXGA 3RAPR 4F46A 3U9SA 1E59A 1USUA 4LZLA 1MX9A 2II6A 5DM4A 4UMEA 3SI7A 1KWKA 5LHGA 5ER6A 4TL7A 1GHTA 3Q4HA 2UV8A 2YEVA 1MT0A 3F6YA 3KOWA 2X0EA 3NTLA 1X6VA 3QLJA 1FNSA 5C34B 3D6FA 3AF2A 3ZZ1A 3GPDG 1E3TA 2G8NA 4IHJF 4N18A 4ZEOA 3QPAA 4MUXA 3PBKA 3T7KA 4D7AA 2PIDA 4F3NA 4L1KA 3ADDA 2C84A 1TJNA 1ZVJA 3TLZA 4YNBA 4XB2A 3QVWA 2ZJAA 2DQ0A 3DB1A 2VWHA 3AMVA 3A0RA 3GZ4A 2P6RA 5K0LA 1JJ2U 1E2QA 4PDMA 1J9GA 1R3LC 4EG6A 4IMPA 3ZK9A 1E79G 4G23A 5M3BA 4M8LA 4OPMA 2BFBA 2ETNA 1W93A 5AK5A 3LZDA 5C8XA 1DP4A 2DWCA 1UBFA 2R6GA 1WRBA 1JDSA 4PPGA 1C3OA 2IHYA 2X4LA 4ZYXA 5CXUA 3BHMA 3CW2A 3NHAA 1R64A 5SZJA 1B1AA 2JBWA 4HBNA 4TKVB 1M90W 2J33A 1PHRA 4BNMA 3VZQA 2UUPA 3M70A 2CNDA 4QO7A 2PEZA 3VNVA 2FZ5A 3AF0A 1Y81A 3FRIA 2VP2A 4LWSB 3D8UA 3VJMA 3V4RA 3VR5D 5D87A 2H48A 3HWRA 3E8MA 4PG8A 4BX0A 3C8DA 2XUMA 4G37A 5JD6A 4J0DA 3MB5A 2EF0A 2BWJA 1YZBA 2Q7HA 4RW0A 5DTIA 4N6NA 3SMQA 1WBDA 5CT6A 2XRZA 4JUAA 5ENDA 1PGOA 1OCCC 3KYJB 3EPJA 3DWGA 4KC0A 4OHYA 1RSZA 4UHHA 4QOSA 3WJ1A 2PSJA 2AR7A 1ULAA 1AM4D 4J1QA 3O0TA 1AKYA 4WGGA 2NYAA 4RKFA 3RC9A 3C15C 4RTQA 2VNIA 1ATIA 2JKZA 2IE0A 1JWAB 4RULA 2VTDA 1R0WA 3DAOA 4IIVA 2LXNA 5KZMB 4JROA 2Q4TA 4R8SA 5KHIA 4OHKA 4MV4A 1BMFG 1NOKA 3G2LA 3ZQJA 2YV4A 2ZE7A 2J7KA 3X1DA 1BU8A 3HV2A 2W6PA 4ITRC 2EC5A 3NEAA 3AG4C 5AWFC 5H3LA 4Q9HA 5KPJA 3EIOA 4IF4A 4Q15A 2IHKA 5JAZA 4NICA 3T3IA 1N2JA 3GP5A 3L8ZA 1P9NA 5JECA 4BRZA 2DTDA 1M2VB 3R7WB 4YAJA 3MIIA 1YRLA 4YUZA 1USGA 2PO7A 3DUWA 4L4SA 1J2JA 3OJFA 2WINI 2YYYA 2JFBA 1VIVA 4A23A 4NCKA 1S9HA 3OLWA 1J5EO 5HKOA 2VCYA 4KN5A 2OO7A 1I33A 4F6RA 1JQBA 1V1RB 4QNRA 1QAMA 1UT6A 4BLOA 5A5FA 4EYKA 4Y1EA 1MENA 1ZOPA 1A2OA 1DTWA 2QTRA 3FWKA 4MGKR 1XE3A 3QZUA 1U3TA 2CJWA 1I08A 1MEOA 1E4EB 4NMWA 1I1OA 3G85A 2E49A 4W9MC 4O2BA 1PIWA 2NU7B 3VV3A 4UXNA 2DE0X 1JXQA 4RFSB 4JBHA 3BH7A 4X8AA 1WE2A 1SVUA 3BIFA 2YUIA 2Q3EA 1W0KG 1NJ2A 4EB8A 3LCVB 1IZ0A 5LWHA 3LDHA 1YBMA 1Q81W 4CV2A 4IYRA 2X40A 2ZRJA 2X7XA 3QVJA 2WVGA 2PKEA 2P75A 4HLUA 3GPLA 2AWOA 2ZAGA 5HJ2A 3H0CA 3MBKA 2QUHA 1ZD3A 3KO8A 1F2VA 1H66A 1F17A 4KO8A 4C4TA 3KD2A 2N0SA 4OXRA 2ZU0C 3JRXA 1LI7A 1NX9A 3U3KA 1BWQA 3H2IA 5EQTA 2ZSJA 3K0SA 4KMRA 2PL3A 4BB0A 1YCHA 1KU0A 4JXJA 3PT9A 3GJ7A 2DQZA 1QQCA 2W48A 4BCCA 2C4KA 3CNOA 2W71A 4QSHA 1SH7A 5M5BA 3H65A 4JVNA 5KYWB 5AKXA 3A6DA 3HMKA 1DNPA 2OHXA 3ZS9A 3HP4A 1ITZA 3VDMA 4ZI7B 2DEUA 4UBJA 2CLKB 4YXFA 1R0XA 1OA0A 4ZOBA 2YMMA 2A6PA 4ZFNA 1N6KA 5EN4A 3RBXA 1Z0SA 1LUWA 3BXZA 1FFXB 5B5EZ 1WSWA 2COUA 3GUUA 3L7LA 3AETB 1EFRD 4D5EA 1KL7A 1IL0A 5FLXA 2VJMA 2L0XA 2JH8A 4EEXA 4NFYA 2G9VA 5JJNB 4OHMA 3PE4A 1GPDG 2EHJA 5HTKA 5B7QA 2QW1A 4H7KA 4TMWA 1NWHA 1IWBB 4QWMA 5IEBA 5JZ9A 4F60A 4ZOCA 5KTMA 3SR2C 2PZGA 4KWIA 3Q40A 3LQYA 3HV0A 2DCUA 4HF7A 2X3UA 1XQVA 2HLDD 1R4MA 3VPBA 4H15A 5FBWB 4CM7A 5KMGA 1P8AA 4Q18A 1IHDA 1PYDA 5EGSA 3V4LA 2XOEA 2CY0A 3PNLA 3OLCX 2HGSA 1JKJB 1O94D 1XKLA 3RK1A 3RGBA 3NV7A 1UWCA 1LNSA 3LDFA 5HVNA 2ZATA 5E3IA 4DV2O 3F8WA 1KFJB 4Z0HO 5H16A 5LYJF 4CV0A 3HP1A 5UKDA 1SCUA 4IH4A 4H0FA 4AF8A 4H35A 1CQZA 3B4SA 2JHFA 1JBQA 1KI6A 4OMFG 1IPHA 1A32A 1E2JA 3E2PA 2ZT9B 4ENPA 4ZO9A 1CUAA 1MA3A 4Q03A 3I4FA 4M76B 1L7RA 1E5VA 4HX2A 4XDJA 4FYVA 1VCHA 2IS4A 3RRFA 5EKSA 4DR1O 2RHTA 3H4TA 1A7AA 2XD4A 4DE5A 4WCDA 3A58B 2YW2A 3CLHA 4HZGA 4ZTZB 1CE8A 1CP3A 5JO9A 5LGTA 4PG4A 3N5CA 1N9ZA 5T3UA 3ZWXA 2ASVA 3MWDB 1UXKA 4LY3A 2E85A 1IQPA 5IYZF 1ACMA 4GI5A 3K0EA 1M1UA 3NHLA 4U3JA 4EPRA 4NZOA 4Y0NA 3NQ41 5TJ9A 4RVFA 1MAAA 1S77D 3OSUA 1FNMA 2NVWA 4A8PA 3PCRB 5K0JA 1VZ3A 2Q1WA 3W5IA 2EZ9A 3Q5GA 3UJAA 1Y9DA 4H9GA 2UU9B 1DBWA 3N2EA 3U0VA 4W7HA 3BUSA 4O25A 3D02A 3K9SA 1J06A 2BISA 3HB5X 2FH5B 1NU6A 5TNXA 1KXZA 3HDQA 3OZ7A 4LYYA 4KI0A 1TT7A 2PMDA 5T6MA 3V46A 2V4UA 4LF9O 1NATA 5C1OA 1PDVA 1TEVA 3OKFA 3IKLA 1V1JA 3OTOO 4JYAB 1IULA 4XQEA 4MH0R 4YT8A 4HC4A 1B6GA 2NTNA 1AG9A 2V98A 4PGAA 3GWKC 3HKDB 1CRZA 1X0VA 4FDAA 2Y4OA 3A4LA 3MT7A 2W8ZA 1SBZA 1RIIA 1H9AA 3OKCA 3TRHA 2RHLA 3ZCUA 4GLXA 3N53A 3IIJA 1NH2B 5KA5A 4DG5A 3X2EA 2VRCA 3LC7O 5B58T 2JK1A 3AOEC 4ZC1A 5FBKA 4NCAA 1XQYA 4NZZA 4OJMX 4B4OA 4TZ0A 2QLMA 1XTPA 1DBIA 4C0LA 4DC9A 3DAGA 4PHHA 2JEXA 3TOVA 4QJ5A 3LCJA 5BN1A 3C97A 1EP9A 3U62A 3B51X 2UUCO 3M5WA 2JLAA 4NJEA 3DC5A 3O03A 4KQEA 3DWFA 2EYUA 3MWFA 4EAQA 3M6XA 1DIGA 4TM8A 3MJHA 2WVAA 4LDRA 5CEFA 4EG8A 3K08A 4WFEA 3HXKA 5JMPA 3EPKA 2YY6A 5F77A 1PD1A 2WAAA 5C4MA 2ZRQA 4DCTA 1W46A 4B3FX 2O07A 1EP2B 4W4LA 1WLYA 3LHSA 4ZTBA 1QE3A 3UKJA 3DV0A 2E4VA 5IE9A 4M0PA 2A59A 2J41A 1WD7A 2N42A 4IP0A 1AJQA 5FTLA 3IT1A 5HHTA 2AYXA 1EE1A 1IBCA 1LH0A 2GK3A 5F33A 2ZJYA 1BNCA 3OFND 4ZT4A 4BP3A 2IVZA 4UBMA 2Z1DA 4DCOA 1BXGB 3NHPA 3KQHA 2VH2A 2XADA 2WA4A 3GT7A 4HXFB 4DUGA 3E1KA 1EVZA 1GQFA 2GCGA 2GAAA 3SS7X 2BM9A 3ZWBA 4G9BA 1SRYA 1G7TA 3T4PA 2C8KA 3BWDD 2YEVB 1IN6A 1Z47A 4JA0A 3WIEA 1DIHA 5FI0B 3DE1X 4C7BA 1Z22A 4GOJA 3U56A 3L7JA 3MSXA 3VV2A 5J5VA 3TTVA 1QHYA 3R5FA 5DM6V 4DM4A 1UJ2A 4ZZIA 2DC1A 2QZZA 1ZSVA 1GTZA 3BMXA 2PWPA 5H4HA 4N5LA 1S96A 4D80A 4OJNA 4MTCA 1MDBA 4JK3A 4PY2A 4MS2A 2OZKA 3FMFA 4WOJA 4CQLA 3LTNC 3A27A 5ECYA 1HETA 1L4BA 2PA3A 4NEGA 3TIGA 3P52A 1CSEE 3I2JA 4GU5A 3O94A 4F12A 3U4GA 2BF4A 4XVQA 3FUWA 3VHLB 1KMIY 5B1DA 1EHCA 4X1KA 2YZMA 3ZW8A 4HYEA 1Q2UA 2YWXA 1VJ1A 4M21A 3QJGA 3F9IA 4KITB 1K8XB 5DNYB 4JI2O 1QK3A 5JYBA 4H0CA 1WN7A 2BGNA 4DOMA 2BC9A 4JR2A 4E30A 3R0JA 5KSPA 1NTMH 1TTPB 4NARA 1T35A 2YHIA 3QU4A 4M0DA 4KWTA 3VOAA 4Q4CA 3PC8C 2P9HA 2WF5A 3RI3A 1ZJ4A 2HL6A 3W0LB 1P4AA 2YUAA 5KNLA 5IKXA 3T0GA 4Q02A 3F4BA 3APQA 4HDMA 2PUVA 3IOYA 2UZ4A 1NR1A 3GNTA 2C9ZA 2XVZA 1G2IA 3NT5A 4O0MA 4E51A 5BPHA 3FF1A 3IKMB 3ZIAA 4D9KA 1G6UA 1NI3A 1AZSC 3CZMA 4EDHA 4U0KA 5D6NA 5FPQA 2CNWD 2NZJA 3TLAA 4DY6A 4DGSA 3JQBA 4MUIA 3KR0A 1R9NA 2CAZC 2ZYIA 4MJ7A 1L6RA 1FPOA 4RY8A 2CBXA 3EF0A 1LV7A 1G18A 4BMCA 1JJOA 1G5FA 5A1TA 4X1YA 3O4VA 4PBRA 1DBRA 5K6AC 4XYBA 4Z1VA 4GOKA 1NTKH 1K75A 2XOKA 3AV0B 3ZJVA 2ZBVA 2OA0A 3JVEA 2EIMB 1VM6A 5HWSA 4J9UE 5FBLB 3TD9A 1P49A 1EWTA 2RAPA 3HBJA 4ZDKA 1KO7A 1XRQA 1PL0A 1MQ8B 5HQJA 1Y82A 5CFRA 4UZSA 1QQAA 5ICEA 4MQEA 4P82A 4PVDA 3AG1C 5TEWA 2WKPA 2Q4OA 4YAFA 3PWKA 1ZHHA 1HM5A 4C08A 5K03A 4IIGA 5KHLB 4FZ0A 4TS4A 3L6UA 5ALIA 1XMOB 5LDHA 1QIHA 5DLQC 3CP1A 1GEGA 2AC4A 4EZEA 1SVIA 2VQSA 4YONB 4AFNA 3B38A 4FSDA 1AO3A 3U1VA 3Q3IA 4XZ3A 4P2GA 1K89A 3SYOA 1T8YA 4F6RB 3CR8A 1E64A 2G07A 3U7JA 4G4SO 3P30A 4R1PA 5IYCO 2NSLA 1B0UA 2VJQA 2HIMA 2JJ2G 4XA8A 2CJWB 3B52X 2NIPA 5KAIZ 1KY5A 4QXPA 2IW5A 4LX8A 1JQ0A 1WZCA 4E88A 3HN7A 1F4NA 2H92A 1L7MA 4IV0A 4O2BB 5TJHA 3HABA 1FB5A 1M6VB 4LV5B 3I6ZA 2FPMA 3BTOA 1T4CA 1KMHA 3GRCA 3MXOA 3JWHA 2PD3A 2QTAA 3IVCA 2H65A 5KHKA 1SIOA 4OHXA 4EKWA 1RRPA 3L4KA 3AKDA 1VMAA 3WFJA 4DV7O 3HPRA 1NT4A 3F5QA 1YZQA 3V8PA 1ZRHA 2QI9F 3V1LA 2J5KA 2NXNA 5HKKD 4L57A 3SYQA 4L08A 4YFYA 1QBKC 4K6GA 4G28B 4GMHA 5EIWA 4ZCIA 1CEZA 2IS6A 3N8GA 4BUJA 1HP8A 3DULA 1PVOA 3DC7A 2PLRA 4FN4A 5CBFA 1LWOA 2CLMB 1WZEA 1SXQA 1NYLA 1NAHA 3UJDA 5G53C 1GGEA 3DL2A 4N5NA 4DRXB 3NHKA 4I8DA 4MJ3A 1TA0A 4RSRA 1GYPA 4NTYA 5EXXA 4YRAA 3HKCA 3UV3A 4BRSA 3BF7A 4QFCA 4JTAB 4JJZA 3WRYA 3FXAA 1BX0A 2D1TA 1UWVA 2Y1WA 3I5XA 4JC8A 3P3NA 1XCJA 2FFBA 3QHPA 1R5BA 2XGGA 5EE1A 1XREA 4QBTA 3KJXA 4G63A 4OTZA 3ZU3A 4L50A 2C5SA 2HRZA 4B34A 3ZDQA 3M6WA 5CX1A 4B79A 1E2UA 2C88A 3LUKA 4DARA 5CGZA 4XVHA 1AUXA 4YO8A 3I5MA 4MUBA 3G17A 3PX2A 1AQJA 1T4GA 4A0FA 5FUYA 4PSUA 4AUNA 4QU9A 3HHEA 1YI8A 1TJ4A 3KOUA 3ZXSA 5BV8A 2EV9A 4WERA 2R97A 3F5FA 2HBRA 2Q21A 4D0NA 1FUIA 1EA7A 1X19A 2BE9A 9LDBA 4WHMA 1R4MB 1J25A 1VQOV 1ZNWA 3KZOA 1YR3A 1P1RA 1QYXA 2QX7A 1R9MA 3CM0A 3TQIA 1KKDA 1RTKA 4WAUA 4GBJA 1K9VF 4X44A 2Y1CA 1F0YA 4WKOA 1K5GA 4OLFA 1MX3A 1YGYA 3FDIA 1KYVA 1ENVA 4O02B 1T9GR 1I5XA 3JQAD 4NZYA 4EGSA 3GT4A 5F35A 4KR2A 1UXHA 4UFPA 1A0OA 4GVLA 1PHPA 1SCUB 2O2YA 1NBIA 2PH1A 5E8RA 2Q41A 3K35A 4BLRA 1UADA 1KI6B 4RD2A 2AG8A 4E5MA 3FCYA 4GKAA 3Q7EA 6NULA 1T8UA 4DV1B 2VLBA 1WX1A 3L6DA 3UJHA 1HWYA 2CTPA 2QAGB 1E3DA 3GLFE 1KK1A 1K7FB 2Z2JA 4JBIA 2I2XB 5AQEA 4WKPA 1SUIA 4RZ3A 5CFMA 3HJGA 4HFRA 1VHQA 2NO5A 2IEBA 1QHIA 1AURA 4OI2A 2VOJA 1QHFA 2XLCA 1QR8A 4QPDA 1XKQA 4EKGA 4ZVKA 3LPDA 1TVEA 4JB2A 3AFHA 1RJDA 4OUDB 1NJIW 2QWNB 3EVZA 4P30A 2ADQB 3WK4A 5FO0A 4XBFA 2VF5X 1Z4MA 1Y89A 4JJIA 5HKLA 3LF1A 1A71A 3IP1A 2WUWE 1SXJA 2DXIA 4KVZA 4BW5A 1ML3A 2WHPA 1TMKA 4F3KA 2C7GA 1HUQA 4NESA 4WNIA 1R4AA 4BP8A 1FIUA 3F5DA 1P3DA 5AI4A 1NVVQ 1IK6A 4C6SA 2FZGA 2G0NA 4LEIA 4ZYYA 5IRCD 1F51A 2XD9A 4H60A 3JVVA 3H2SA 4E70A 1Z56C 3FNFA 2YHBA 3EVAA 2AUNA 3DYVA 4M87A 3QU9A 2OSVA 1E3MA 6LDHA 1IAQA 5B6PA 4JKOA 4LZNA 1AKUA 5ELXA 2NTVA 5IWCA 4UPEA 5A6SB 4YR7A 4EJ0A 4FLEA 5EA2A 3G49A 3VMFA 2VYVA 3RSFA 1C4WA 1Q1ZA 4AJHA 2Z0MA 4RTSA 1YUNA 2MMGA 3CCJV 1AILA 3ROFA 3OMIB 4WFAV 2X2FA 4HAXA 1KDZA 1KI2A 5FLEX 4MRVA 4L6IA 2C9MA 4Q3EA 2FWJA 4AKIA 1P4SA 1D2HA 5B3LA 4P32A 4XJVA 1CJBA 3ILSA 1XMQB 1RCUA 4QQKA 1K8RA 4DLXA 3GBPA 3KDPA 2Z58A 3EBOA 3OTQA 3C3YA 1YNOA 5CFZA 5TF0A 5L3RA 3E5HA 3GJRA 3I2GA 4EZIA 2N46A 2GH1A 1I7FA 3TSWA 1M8FA 3TLCA 1E7WA 3X0DA 4MKZA 2H2WA 2X9LA 4XTRA 2OBLA 5JDCA 1D1TA 2CLCX 1ZZEA 1MVOA 3L01A 1WMSA 4DR7O 4Q19A 2RGGA 3N39C 2XJ4A 4C01A 2QJOA 2PE5A 4JEIA 3U7IA 4KQWA 3N0XA 4F45A 4R81A 2VCEA 2C4VA 1WXXA 1Z0UA 2XAJA 2YQ4A 1UM8A 2ILTA 1D1QA 3DV0B 3GZJA 2B7LA 2PGJA 1C4XA 4MUGA 1Z4OA 3RABA 4U02A 1XKXA 3WQRA 1ZMXA 5H80A 2QU8A 4YH1A 5ED4A 2WYUA 2ECKA 2EHDA 3I6YA 4GFDA 5FLXN 4I55F 1Y80A 3ZGLA 2YVAA 2O52A 5KVVA 3JD3A 1DFHA 1K4YA 4F6CA 4X54A 1J5XA 1BXKA 1UC4B 4MV1A 2YVLA 3RJ5A 5BUSA 5LCXA 2B4QA 2N74A 3WGNA 4OU5A 4AZ0B 1QBGA 2EATA 4H7IA 2F23A 1TJ5A 3FD9A 3STUA 4CIYA 3DLPX 4LZZA 4EX6A 2ZTMA 3BXFA 3BN3A 2WB2A 2CDNA 3O0DA 5CA1A 1RM3A 2FL4A 2NO4A 1P0IA 3Q2IA 2C3UA 3W3AH 4EI8A 3N86A 4O29A 1T9BA 1XPUA 1B0ZA 2YJTD 5CUQA 3BXHA 4N65A 2P5YA 2I29A 1FQWA 4DJDC 5H4GA 1VQMV 2FSGA 4WBSA 1QZUA 1IE3A 4GYCB 2VATA 1CB7A 1YR7A 5DNAA 4ZEXA 1NVDA 4IILA 3S7ZA 2I2FA 1OCCB 1I2MA 5IBCA 4OLAA 3R7WA 2PQ6A 2PX4A 4MW6A 4UTZA 2WTXA 2P9EA 1ODCA 2P4QA 3CW9A 4G26A 3VZPA 5F2NA 1UMCA 4Q9JA 3I58A 1RYNA 1NF9A 3OX4A 5C4IA 1P1HA 1JZTA 1RXIA 1U31A 5CM2Z 4JU8A 1QHGA 3KKNA 2H4HA 1Z4NA 4BMYA 3GK3A 1RKVA 3UMFA 1YE5A 3MNFA 2B2CA 1JDBC 2HV8A 3ASOC 1GXSA 2VJCA 2QRNA 2WU1A 5AJVB 2IBSA 1D2EA 1KK0A 1KECA 4EWLA 1GCAA 3FKSD 4EO9A 1ZUHA 2G09A 2V74B 1OZ0A 1GARA 4WADA 1B3RA 5FUVA 2I8AA 1FDSA 4BQEA 5GJWC 1UJMA 1Z15A 3HFGA 3ZH9B 1FU4A 2P4VA 1L1FA 3F9CA 5KREA 4I4IA 3GBVA 1ZUIA 3CF6R 3V4VB 3BE8A 2YZGA 4IXMA 2P5SA 1PTJA 5IC6A 4HT3B 4B6GA 4FNOA 1XZ8A 3SK0A 1KDOA 3IDQA 1V7CA 3KTFA 1UL1X 5K3OA 1P3Y1 1QO0D 2IX3A 4OK3A 3WL4A 1ADCA 3C3EA 4KAJA 5JLAA 3HUDA 3DLAA 3TAXA 4X95A 1PW5A 2ZRDA 4DKXA 1U6JA 3GJQA 3PVSA 5IT9N 3VC7A 1S2MA 4HNUA 3KK0A 5JAMA 1RAIA 4J16C 3NMUF 5CFNA 1LGYA 4C22A 5KYWA 4QQNA 4D46A 1G19A 5SZHB 1SUAA 5LLDA 4PIVA 1NW3A 4MQEB 3RIGA 3HXLA 3THSA 1V6AA 2LNDA 2XYVA 4R2HA 3SMVA 2ZYVX 1MPXA 1XTTA 1G8AA 5FKJA 3J81A 5C52B 4YP0A 4DDVA 4RDCA 3EODA 1K6XA 1AN9A 4HAIA 2YXBA 4BXOB 3QFRA 4LRWA 1M5RA 2CXNA 2B4AA 4B3HA 1G8SA 1PX0A 1H5QA 1PR5A 5IDQA 1N6IA 1SCQA 1GNQA 1WQ3A 1JPNA 2NPFA 3SDSA 1EGVB 1QRDA 4EUKA 3ECCA 2ADMA 4DV6B 5I6DA 3QVKA 7ADHA 3KBBA 2VHJA 2JJ1G 1VLJA 4LXQA 4H3HB 4JQOA 5G40A 5AJTA 4LF8B 2PXXA 3U3JA 3G23A 1T2EA 3K72B 3IQZA 4KTVE 3IQWA 3HPQA 2XCSB 5B1BC 3Q87B 1BN6A 2IDZA 5IT0A 1SHKA 1Z2NX 4MGIR 3DMHA 1QHEA 3U7GA 3I0NA 1T4CB 2OORC 4JTCB 1IQ0A 1V2HE 5HCIA 1KMHB 1HRKA 3LOPA 3CX5F 4GI1A 4OAQA 3JD2A 5EIOA 2EFJA 4G4SP 1AQUA 3H18A 3OFJA 4HAYA 1V4VA 1USKA 2O3SA 5ILGA 1RI1A 2UXDB 3E03A 1K7XB 4DDHA 4UTPA 4JI5O 3OM0A 2HTEA 2FETA 1SUFA 2XZPA 4DDWA 3RD5A 1TNDA 3GD5A 1UKEA 2XEXA 4WOBA 3LUBA 1RC0A 4ASUG 5I9IA 2MYPA 1SCJA 4GUAA 2JZNA 3NIWA 3ONDA 5AJYA 3TSAA 4FZ1A 5H6QA 3B78A 3AJAA 3TRIA 3TGWA 3A70A 2WD9A 1K1EA 3FJ1A 1NMXA 1MQ9A 3VBEA 4EABA 3MS7A 2HJ9A 1O5IA 4IKEA 4WOCA 1ZSNA 4ZO4A 4YS6A 2YWRA 3CYOA 3HKCB 5DM1A 4O0LA 4WIAA 4P9OA 4QUAA 4DR2O 1JFSA 2W6QA 3CF2A 3DUFA 2RI0A 4XUGB 1UZMA 4CXMA 2RGCA 4YHHO 2I1QA 1X2BA 4MB6A 5DM2A 1H2KA 1U7PA 1JJFA 3CX6A 5FUBA 5JRZA 5CH3A 5IM5A 2GPAA 2CE2X 3A9CA 2DT8A 2IVFA 5CX1B 1U7WA 1N8NA 3N0WA 4MJXA 5FRDA 4LI3X 5TDHA 1UDWA 3AINA 1GRNA 1T9KA 4L7QA 4CGZA 1N3YA 2CJXA 1LX6A 3QVSA 2J9ZB 1J8QA 1VKNA 4W5NA 2QD5A 4MO2A 4IQGA 3J7TA 4I4TA 1J2EA 1BD3A 5HMLA 3V6LA 4PC3A 3GRVA 3F7NA 4JODA 3GL9A 4RNCA 3C3KA 4GI2A 1JEOA 1VBKA 5EJ8A 3DQQA 3RROA 5KNDA 1YCGA 1DBQA 1SC1A 3PWSA 3PLRA 1Z2EA 3O8OA 1UKZA 4W5QA 1R5OA 2BUBA 4YC7A 3ISJA 5E2AA 1XELA 4E94A 2OFXA 4LCEA 1VGRA 3SDLA 3IQEA 4TRMA 3HTXA 5F9FA 1VPDA 1GPH1 3ZWKA 1RI3A 2I1VB 5EE5B 3WHLA 4OQQA 3VPDA 4NY1A 4BQSA 3H5VA 3INRA 5IUJC 1SCIA 3CPHA 3KCXA 4BOYA 1OB2A 1I4EB 2OV8A 2HSDA 1Y3IA 2C42A 5C3UA 3HKDA 1QOZA 4PV1B 5BN4B 1AV6A 3CF4G 3ND5A 1YFLA 3ZZUA 2BMJA 1RJGA 2B36A 2PI4A 1EINA 1C9NA 3G82C 5AW4A 1N5MA 3OJXA 4M1YA 3HUUA 4OQMA 1RWOA 2OYRA 1IJKA 5HS4A 3COWA 1EI9A 5KSOA 3JQQA 5TV2A 1CXZB 5CBPA 2PX6A 4EX7A 4AMVA 4CF3A 2DYSB 5ICCA 1EP1B 4PLVA 3P45A 4J0JA 2OWDA 2BR4A 3PXDA 2GYWA 4WFBV 3B2EA 1AB6A 3S40A 1UK9A 5GP1A 1VRWA 1NBHA 2JAWA 4B44A 2WSSG 3IPYA 3SZRA 5DP1A 1YMVA 4UB6Z 3EG9A 2Q5LA 4R9NA 5HZHA 4B73A 4OFXA 1AQYA 3IPCA 3VGJA 5CA0F 5C31A 2WHPB 1E1MA 2GZ1A 2P2NA 5YASA 1VG1A 2X3YA 3N27A 1UZNA 2X0DA 3DF9A 4P84A 4PGHA 1Z4QA 4XJTA 5LP6C 3OAAG 4CMKA 4BMXA 5CFQA 1O0BA 1VIDA 2IKQA 1OY1A 4JELA 2GBPA 4R5MA 2R84A 4W82A 1B14A 3H7IA 2FMUA 3GLTA 3AEKB 3NALA 4UTNA 1GCUA 2E6KA 1M83A 1N2SA 4CKBA 3D4IA 4NABA 5DHQA 4RKQA 2J5RA 2QX9A 1V9PA 1T5TA 4MZXA 4BFVA 4OHCA 3ANXA 2IEYA 4JUFA 2FPKA 4AI8A 5IULC 3VR3A 3CC8A 1D4OA 1LPNA 1PLKA 1YZKA 3W1VA 1Y33E 4OM7A 1MJGM 5EQFA 1U8CB 1E0SA 3RFXA 3L4JA 2VPPA 2VDPB 3B40A 3HKBB 3ZK8A 2H6EA 5K6TA 3R5HA 3VO9A 1H69A 1UPGA 4UU0A 2E87A 5DE3A 4LPKA 1IQRA 1N2XA 2FR1A 1RCTE 1YO6A 4OAOA 4KGZA 4XQGA 2FA9A 3H9EO 3V1KA 2FTKE 2AN4A 4RWEA 1TE2A 1KBHA 4DKJA 3UJNA 3IAM6 4AMUA 2I6TA 1FS0G 2Z0AA 1FXUA 2IYXA 1ORVA 1PYOA 4W4KA 5JZBA 4EF6A 2HLNA 1KYZA 2F90A 1XDBA 1OYOA 3OUTA 3GFPA 2GHIA 1J20A 2FMHA 3V33A 4C0HA 3RF7A 5JNLA 6AT1A 4ECEA 3JSXA 2GTIA 2XMGA 1AKEA 4R2MA 1IY8A 1JMYA 2AOWA 3E7DA 3HU3A 3R5JA 1WTAA 2BONA 4LMBA 3CRAA 4OQFA 4RK5A 2H52A 1DIAA 4LBZA 2I7XA 1C1DA 1DOAA 3R0IA 4LSWA 2J0QA 1N34B 2C78A 2IPXA 1H93A 1GKYA 4X97A 2P7HA 1XZIA 3KQUA 3CRZA 4EW2A 1TAGA 3MTIA 2VTBA 2XQFA 1ZL0A 2Q1UA 2JGIA 1AS3A 4MICA 1X77A 1E2IA 5ALLA 4TT3D 3SX2A 3AG7A 1G5HA 2VSQA 3ICXA 4RY9A 4F5WA 3OKPA 2Q3BA 4Q00A 3FLAA 1U04A 4O1IA 2P7IA 3KOYA 3F9RA 3G1TA 1NASA 1HNWB 4MKXA 3DTVD 3LP8A 3N59A 3MWEA 3MGKA 4TZ6A 5IN5A 3IEUA 1D2DA 4PSKA 4F11A 4W5JA 3D6JA 1V48A 5DN9A 4QVIA 4PF1A 5CA1B 1JSCA 5C3MA 2VT3A 3NUZA 3FDJA 3GPCA 4NU0A 1Y67A 1QHNA 3RS3A 3M6IA 2LBPA 2DR3A 4KN6A 3DZKA 3NH6A 1K6JA 3AFOA 1BOFA 1VQ5V 1XDWA 3PKIA 4E5DA 1BVYF 3RS7A 1YA4A 3V8RA 1OFGA 2PKCA 1ZM9A 3WISA 3K59A 2JIPA 1C3LA 3S68A 3GB9A 1T1RA 1XTBA 1LX7A 4QYXA 4BN0A 4ETNA 3HU1A 3AR2A 2IYZA 2JGLA 3GDHA 1VFNA 4MO9A 2YC4C 1M0TA 4DCUA 3CQ9A 3S55A 2BGJA 3VR1A 1VL8A 4TMZA 5D3MA 2YCLA 3CCSV 4I4CA 3BDVA 1OTXA 1E1QD 4D8TA 1UMCB 4G5HA 4OI1A 1E6WA 3WLNA 3NDBB 3VNUA 3NVAA 4EG3A 3AK3A 3FBTA 5C7OO 2O3TA 3I42A 1DDOA 5EUMA 4ZMRA 1FNDA 4RHCA 3SLGA 1KQFA 2VDQB 5IKOA 2ZM6B 4EFLA 4PHTA 4A5OA 2RI1A 1PWYE 5KOHA 5JHHB 3TXYA 4ZYUA 3OQPA 4P0QB 1KFKB 1CUZA 5K51A 1MBZA 1GXSB 2FPWA 4ZV7A 3PL1A 5AMXA 2BBSA 4OHOA 4FFPA 1IG0A 4EG4A 2ISSD 3TCXB 1M6VA 5JRJA 4UFNA 4KFTA 1Y4MA 1LUAA 1E3LA 1G9TA 1P84F 1BN7A 2EGUA 3G0IA 4HMPA 3OHSX 5KYUA 3INGA 4ABMA 1L8LA 4L3OA 1H8HA 3M82A 5EFOA 1PL4A 1YBAA 2HWKA 1QGUA 1KI3A 1G42A 3SFTA 3TOSA 2NO9A 2Q2NA 3C41J 1G3MA 1Z6PA 3R0XA 4I9FA 2JGDA 3CGGA 1UJ4A 4C03A 4RVHA 3E81A 4OCZA 2PSDA 1MPTA 3SXUB 1VP7A 2VJDA 3BB4A 3EGVA 1J00A 3DZIA 2DCMA 1I94O 2WJVA 1FUYB 2JIQA 1N1DA 1SBHA 3GEBA 4FIDA 3OCWA 1UBUS 4MVJD 1V45E 5KX5F 4AJ9A 3VR2D 3G6EV 3QF4B 4DUYO 2Q8QA 4TTTS 5HGXA 4BWYA 2XUOA 4DRXA 2YV1A 3TIVA 1UDAA 2ZUTA 3DCYA 3RVQA 2P22C 5HZKA 4RZXA 4I5IA 1B4DA 1Z33A 5A0FA 1RWKA 3U49A 4KMSA 3Q2KA 3D0RA 4IXWA 3PEWA 4ND3A 1I24A 2OAP1 3C1TA 2EKLA 1C7IA 1X7GA 3C1AA 2QTWB 4R16A 1X7XB 3MS4A 3J80A 3WYCA 4YJDA 4N23A 3T1YB 3FHLA 3CTPA 4EYGA 3T1HB 1TUIA 1Q0LA 1RAEA 3IBTA 3P19A 2WEKA 2YN4A 3TRKA 4ALJA 1C1XA 5DSXA 5H7XA 3O2SB 2GUZA 1EFVA 3R4CA 4PHCA 2FW0A 4XCVA 1A2KC 1QGDA 1ZVQA 1PLJA 2RI6A 1O6BA 4C6RA 3NJRA 4A8JC 4X63A 3FTQA 1P77A 2OBFA 3GUHA 1Z2GA 3LT1A 4Y67A 4LXXA 3RDPA 2H7XA 1AUPA 5LL6Y 1W36D 1SQGA 4GGOA 3EN0A 4I3GA 4D8UA 5A9RA 5BO5A 1G5IA 3L9XA 3EEQA 1CHNA 2PMEA 4WV3A 2PUEA 1XXLA 4FGUA 1Y0BA 2ODMA 5BWBA 4D4IA 1ZA1A 3D3KA 3W4KA 3BRCA 1JA1A 4D7SA 4GXRA 5A7HA 1DUIA 4IZOA 4P93A 4NMLA 2DUUA 2ONZA 3IJ4A 3RRMA 1W9HA 2PYDA 2DBZA 2WSMA 4S04A 2DOSA 4LP8A 3SF0A 1V0JA 4YI5A 2AVNA 1Z7YA 4JOCA 3TDNA 4NMHA 5C8YA 2PEYA 2CXPA 3W3AA 2BRUC 3HL0A 2ZINA 2G36A 1AI4A 1M1XB 3EAQA 3CEJA 4IEEA 2GCEA 3RUPA 3KQPA 3CX3A 4BTEA 4LBWA 1ZICA 1C7JA 1DJNA 1WCWA 1NRXA 2AH5A 1BKDR 4BVKA 2ZS8A 5F3DA 2JGUA 4K1LA 2QAGA 2WSLA 3TUJC 3AK1A 4OXXA 4EHHA 2QPAA 2FQYA 2ZYWX 1GDHA 2VPXA 4HDKA 3WIDA 2WA3A 3DUFB 1TUEB 5BNZA 5JSHA 2E74B 3SJCA 4E0BA 4REQA 5A5VA 5FL3A 4WZ6A 1YCIA 2WAMA 3DFMA 3OWXA 4M8KA 2F1KA 3MFQA 4OUDA 1TA4A 4AZ3A 4YRNA 4EAAA 4Q9NA 4GQBA 1F60A 3K9AA 4LG1A 4XEUA 5TT1A 3U7EB 2DAPA 4UUAA 5IDJA 2EJWA 2DW4A 4J7UA 3DSQA 1GGVA 4XIYA 1KEUA 3LV8A 3I56V 2ERXA 3RYCB 3OZTA 1SOVA 3IULA 2XBLA 4B17A 4I4TB 2B78A 3B7PA 5ICSA 2DMRA 4LF4B 2ZXWB 3I30X 1RLOA 5KJEA 5JDIA 1BZKA 2FI1A 3U5ZB 1EPUA 1NYRA 3NORA 1AE1A 2GN6A 3HJTA 4UXIA 3O8OB 2JZOA 3EZ7A 1I4LD 5J2TA 4YMIA 3STTA 4KN9S 4Q6GA 4P7GA 3LA6A 1Y3DE 1QANA 2JGMA 4WCFC 1NKSA 1JDTA 3H9QA 2I4IA 4M83A 5A6SA 5IT9A 3H5NA 5DYIA 4C2TA 3SYKA 1B73A 2IY7A 3FIJA 4ARIA 4Z9BA 3AO0B 3DBOB 3F8TA 4ZHSA 1QYVA 2JRLA 4C04A 4DYHA 4AZSA 4YBZA 1TCBA 3RVLA 3FB4A 5DHPA 4B4VA 4B8YA 2ID9A 4G97A 1QORA 1PR6A 2E1PA 4JIGA 2YIBD 3I61A 3V8BA 2VHZA 5GW7A 2Z8YA 3CLTC 3BE4A 3BXPA 2F93B 4R01A 1RXUA 4DM3A 2R6JA 4PA9A 1HE3A 2V9PA 3ASYA 4DUPA 2K6GA 1KYYA 1L5VA 1XX6A 2LV8A 2VN8A 1U9JA 4GYYA 5EMLA 3K15A 3TPZA 1W19A 1YZGA 4XX1A 3UK2A 5CBPB 4OIFA 2UYHA 1DCMA 1SIWA 2IIVA 3FX2A 2YFKA 3P97A 3WWZA 3TVDA 3HXPA 4D6TH 3B9RA 4GE3A 1CNEA 1H6BA 4C2BA 1JQEA 4CR6A 2WA1A 2OMEA 3O1JC 4XXHA 4FFBA 4TWRA 5DFAA 1BMTA 2BOVA 4CDMA 3LLVA 3U3ZA 1TAEA 3BULA 1EDBA 4K7JA 3EG9B 4KODA 1C7ZA 1U8TA 3LYUA 1ZGBA 2FW8A 3G9QA 2FWMX 3J81N 2LGQA 2PTHA 1PNVA 2BVNA 1YB1A 2QSYA 4D8VA 4UHBA 3NYWA 4HS4A 2NNWB 1RQGA 2DLNA 4G81A 1UODA 4C2AA 4FIZA 3C39A 3ZJYA 3LOQA 2WE7A 3NM5A 3PUXA 2ZYAA 2L6LA 4F56A 1QTQA 3JYCA 1FXWA 2GMWA 2W00A 2H5LA 1KQOA 4CKBB 1IBMB 3NRCA 4MLCA 4ES6A 4XB1A 1R16A 4ZKDA 1EN4A 3RAEC 4OXQA 4B40A 5AHWA 2WF6A 4AZ0A 4CFZA 3L1VA 4IYHA 4YK7A 1MOZA 3QUAA 1M2EA 1WZNA 1J23A 3FFWA 3BHIA 4CZ2A 3I45A 4URZR 3PFCA 3DZFA 5NLLA 4CMJA 1H4VB 1V9CA 2QIOA 3E86A 1G2OA 3ER9A 3T7AA 2J3KA 1E7QA 4A0GA 4XLZA 2M1ZA 1U3FA 5JBNA 1S4QA 1A9SA 2FVYA 3PXEA 1TL7C 2XNHA 3EIWA