2LW7A

Nmr solution structure of human hisrs splice variant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
170
structure length
170
Chain Sequence
AERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKALEEKIRTTETQVLVASAQKKLLEERLKLVSELQDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of human HisRS splice variant
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Histidine--tRNA ligase, cytoplasmic
total genus 36
structure length 170
sequence length 170
ec nomenclature ec 6.1.1.21: Histidine--tRNA ligase.
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2lw7A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 2lw7A02
5IWAO 4DR2O 4K86A 4X5OA 5E3IA 2ZT8A 4DV4O 4YYEA 1DK1A 4NXMO 1HNWO 4TWAA 1B76A 3JAMN 2VQEO 4DV7O 2UUBO 3IKLA 1N32O 3LC0A 1G5IA 1XNQO 4YRIA 1G5HA 4YRMA 3UGQA 2LW7A 4NXNO 5BY1A 3T1HO 2Q5IA 4DUYO 4JI4O 3J80N 1KMNA 4B3TO 2DJVA 2ZT7A 3HRIA 4PHCA 4YRLA 4DV1O 4YRFA 4YRGA 1H4SA 1G1XB 4YRQA 4X64O 2ZXFA 1YZBA 1NYRA 1GGMA 1KOGA 1HNXO 3IKMB 1IBLO 1R6TA 2N74A 4DV5O 4X62O 4KHPO 4JYAO 1AB3A 1H4TA 2I4OA 4HWTA 4YRKA 1IBMO 4LF9O 1XMQO 4DV2O 2UUAO 1KUQA 1R1BA 4OPHA 3F5TA 4YHHO 2PMEA 1V95A 3M8AA 5C53B 4JI7O 4YRPA 4EO4A 5C52B 1X59A 4DR3O 5A2QN 2ZKOA 1HTTA 1I94O 4LFAO 4TTVA 3UGTA 4DUZO 4LFBO 2EL9A 4HVCA 1F7YA 2DOSA 2I4LA 1H4QA 5BR8O 3R66A 4LF5O 4G84A 5C51B 3SDLA 1QE0A 4P3PA 1EVKA 1XNRO 4KR3A 5FLXN 2J3MA 2UXDO 1HC7A 2Z0AA 1FYFA 4HWSA 4YRRA 3J7AU 4YY3O 3IALA 4LFCO 4DR4O 4JI1O 1N36O 4A5UB 4JV5O 4B3RO 4LF6O 4DV3O 3A32A 4JI5O 3HRKA 1QF6A 1N33O 4NCXA 4YRJA 1FJGO 3NETA 5H5NA 4HWPA 3O65A 5LL6Y 1KMMA 4K88A 1A32A 1NS1A 2E5LO 4YDQA 4KQEA 4KR2A 4P3OA 1AILA 3UH0A 1D2DA 2ZT6A 2ZM6O 4P3NA 1ADJA 4B3MO 4AQYO 4DR7O 1XMOO 1NJ2A 1NJ5A 4JI8O 2F4VO 4JI3O 4YP0A 1N34O 4RDXA 2Q5HA 2G4CA 4DV6O 1ATIA 2UUCO 3OTOO 1NJ6A 4Q15A 4OX9O 4E51A 4YRTA 1FKAO 1H4VB 1HNZO 2J3LA 4OLFA 4OPAA 2VQFO 4YRSA 4YRNA 4DR5O 4JI6O 1FYJA 1NYQA 5LMNO 1J5EO 3J81N 2FKXA 4X66O 2PMFA 4GKJO 4G85A 2I4MA 2I4NA 1WU7A 2ZT5A 2UU9O 4HWRA 4DR1O 4YPFA 4DR6O 1IBKO 4YRCA 4LF7O 4DV0O 1EVLA 3A31A 4JI2O 4GKKO 4YROA 4LF8O 4WI1A 2HHHO 2UXBO 1NJ8A 4K87A 3T1YO 5LMUO 4ZTZB 1HR0O 2UXCO 4YREA 4X65O 4JI0O 5BXZA 4K0KO 2AGAA 1ADYA 1XEQA 4LF4O 5IT9N 4B3SO 4ZTUB 4HWOA 1NJ1A 3RT3C 2JRIA
chains in the Genus database with same CATH superfamily
2XD4A 2H1IA 2Z3YA 4O4JF 4YJDA 1OB2A 1TXGA 4L0MA 1W5TA 2UKDA 4XW2A 2XXBA 4R6WA 1HL7A 5AI0A 4HNSA 4OSEA 1IQUA 1RR6A 5DYTA 1XHLA 2CNKA 1GRCA 1KEZA 1ML4A 2ETVA 4ZQEA 3HXKA 1OQAA 3TXAA 1XFDA 2GM4A 3NV9A 1UXOA 4I08A 3QF4A 1C29B 1CDDA 4I5EA 2ERXA 4RF4A 4W82A 3ZI4A 4ZV4A 3E9YA 1G6KA 3IQIX 3K5HA 3O8OA 4O2BA 2XVMA 2ZRPA 3FAKA 4BB6A 4DVGA 5LGUA 1T3TA 2XA1A 4N1AA 2V7PA 4QE3A 1YJAA 3GVHA 1J9ZA 3PFKA 3UF0A 3KSDO 2EZOA 4NG4A 4FR5A 3I9LA 1BXZA 2P6PA 3L8DA 3NIDB 4BDTA 3QFRA 5B3SC 2PTMA 3HE3A 4OQ4A 4D3DA 5JBNA 1WDWB 3E1KA 4GZRB 4QRIA 2NTVA 3ZIDA 5J2UA 3H87A 3K16A 1RLIA 4P0PB 1NMXA 3AL3A 4XB2A 3AKZA 4EG0A 3A6ZA 4X3PA 3KXLA 2JB9A 1YQWA 1ZOPA 1U8TA 2HQOA 2E55A 2RHMA 3DOCA 2VF7A 1VL2A 3JWGA 3NHJA 5FF9A 2REOA 5BN5B 2R5NA 1GN3A 3FAVA 1GKYA 3SYRA 1QUFA 1GU7A 1TW2A 4FGSA 1QVRA 5H2FZ 3KE9A 1BVYF 3WRWA 1XLTC 3DM9B 3WXBA 4ROTA 2IUSA 4CLHA 3AVWA 1US6A 1TE2A 2VAWA 2BEWA 2XW6A 3HU2A 2D1TA 4DLLA 4E0BA 4MR7B 1UWKA 2WAMA 1YFLA 3HPQA 1E6LA 3L1IA 3PQCA 5CCDA 4KN8A 2IHKA 2QTGA 1A9QA 3OTFA 5EP2A 4U2KA 1IVYA 1OHHD 1UP7A 3AETB 4ZT3A 3RTCA 3OLCX 4DZRA 2GN4A 2Y4UA 2O07A 1AIPA 3SPJA 5F3RA 2BGTA 2QWOB 5HKLA 2A3NA 4LDAA 3P9IA 5FPKA 1TRHA 2RHCA 1NDUA 4C0SA 3K70D 4B7AA 4AQ7A 1H6DA 1E4EB 2J85A 1CJCA 2XDQA 1O9HA 3ESBA 4JJIA 4PIPA 4WNCA 3F6PA 1NJ6A 4KNWA 4KMRA 4X1YA 4LV8B 2D0OB 2ITDC 3PHHA 4Q9DA 5HKBA 4C3VA 1TTHA 3VDNB 4Y1FA 2DQSA 3BRQA 2VHQA 3PDWA 3SBXA 3TZQA 1H0KA 3JAMA 2E49A 3B82A 3IUEA 3HCCA 4MB6A 3UMVA 5KOJB 2DFPA 4RJLA 4J1TA 3FPBA 3ADKA 2P4HX 3GI1A 3TLCA 1BRMA 1Y1KE 1XDUA 3DL4A 1ZITA 2L69A 3G71V 2Q0SA 3RWBA 1PSZA 2XRYA 3ORSA 4JY7A 4F56A 4ZO8A 1GTSA 4QTUB 3L0DA 3ZRSA 3MUEA 2BFMA 3BEOA 3PSHA 3WADA 1U3DA 5IUJC 5D3ZA 4G1EB 2V03A 4B6GA 1SO8A 3S2ZA 3FPKA 3ZLJA 3MJFA 5GPBA 2W6JA 3ZDQA 2W8BB 3KJNA 2ZTHA 3QH4A 4JI5B 4MHTA 1OXUA 1EFRG 2ZR7A 4BJ5A 3D02A 4W5QA 4Z3KA 4ZTZB 1ZOLA 4S0XA 3TTTA 1GN4A 3H1IH 2KYRA 1ZSPA 5HGJA 5HQ3A 1RHUA 2Q2VA 3DMFA 5CM8B 4ZTUB 1DXHA 2H59A 3ABKB 5A6VA 3SE0A 2DHQA 1Q11A 3GJYA 1A8SA 1SQBH 1UP6A 2EF1A 3HNRA 2ZT8A 3V1NA 4EDFA 4HLUA 1GP2A 2W2QA 1J2RA 2QXTA 3PQ3A 2WSYB 2WV9A 4F4IA 5ALHA 1TVEA 2ZE8A 4DPKA 5AYVA 1N9GA 2JBWA 2CVFA 4INJA 4IZIA 1PJBA 1KEKA 4U63A 4CLXA 1VYTA 2MIIA 4NCKA 2ISSD 4RHUA 4UCQA 3D8BA 1IMOA 4JI4O 3P26A 1ZC4A 3DEZA 4NXNB 2H65A 2XY4A 2Y71A 5ES3A 4AZSA 2IX3A 1BZKA 1YIDA 4G5XA 1H2FA 4EG3A 3ZYCA 1M33A 2OESA 1RC0A 4I3GA 3LY8A 2N74A 1BMFD 2PLRA 5A02A 2RN9A 1FW8A 1DC3A 1WBBA 3TTWA 1JFVA 5L3RA 2ZZNA 4CF5A 4J10A 3F46A 4NATA 1GFZA 2WYHA 4IR7A 4Q1EA 1KO8A 4COKA 5ITZB 5LOVB 1U98A 3BWCA 4EWLA 4DAOA 1SG0A 2I4TA 3HMQA 3K20A 1DIOB 3M6LA 3TLBA 3HM2A 4EO4A 3AGQA 3D8SA 4F1WA 3QO8A 2P9ZA 1P72A 5J5CA 3BCCH 1OWLA 1RXUA 4QM6A 2Z4TA 4CQMB 1ZJZA 4J4BA 2DOSA 1VJCA 4R7TA 5BWCA 3QW2A 3G8YA 1VF5B 1Z82A 2ZUUA 1RWWA 4HLCA 3CB4A 3FTNA 4FW9A 5B58C 1EK6A 3QUCA 5MFZA 2O0JA 3EFBA 2BZ0A 1R0YA 4LFCO 2QR4A 4WD3A 3KKZA 5IBPA 5BYBA 3UHAA 3L6UA 1GAQA 2I66A 2IBSA 3DWIA 1B2RA 3DLPX 5CTJA 3NVMB 2C4VA 3MDSA 4AKTA 1B0ZA 1XOUA 4W7SA 1DJPA 1W8IA 3QVNA 5EIBD 3ZE9A 3OMAB 1RE1A 1OTYA 4QWMA 4EX7A 4XUGB 4DT1A 4WBSA 4ZGWA 2OCHA 2IEGA 5B2EA 2YIMA 1NHWA 3GT3A 1DSSG 3BDVA 4JQYA 2V7QD 4KN6A 2FJ0A 2E4AA 3WLPA 1UEXC 3OCCA 5KREA 3KZNA 4BFSA 3IV6A 1X19A 4RQFA 1YJBA 1N34O 4MCIA 2P2ZA 3E1GA 3DXZA 1TKAA 4MVJE 1MOQA 1XZ8A 1Z2NX 2VHTA 3LDHA 4FMCB 4FXPA 4IV5A 5FPPA 3TWOA 3OKFA 3Q8XB 1LR1A 1N5LA 5TY0A 3TSZA 4KMOA 4US1R 4GR5A 2OB2A 1HNZO 3EGWA 3RADC 2XYHA 4AN1A 4L3VA 4EHFA 3CSXA 2WB2A 2CHGA 3WL8A 2NZ8A 3PC8C 4MKZA 3FRHA 1FY2A 3MW8A 4XJSA 3NH9A 3D6HA 3T4DA 1QTIA 5F5NA 4PG4A 2CNDA 4G1MB 1KETA 2C97A 3SHQA 2FRVA 2AHRA 3ZZNA 2DR2A 1QV9A 2BGUA 4Y0NA 2TS1A 3JQ8B 4M0MA 1HMPA 3RVDA 3L92A 3C1AA 4FCCA 1RXVA 1TGVA 5AIAA 3JAWA 3JATA 3PD0A 1ZL0A 4UHCA 3A6JA 3ZXUB 1S2DA 4AZVA 3HDHA 5HNKA 1JTFA 2MDTA 4EHIA 3DDUA 1T8RA 1VJDA 4OJMX 3LUJA 5KNCA 4LIPD 2PSHA 2ZI9A 2CYAA 2IYZA 3DWEX 3FG9A 3HDQA 3SJBA 4RULA 2BD0A 3KETA 1GL3A 3AY6A 4EUNA 3V2UA 3Q3IA 1KO7A 1H2WA 3N53A 1I5RA 3ZE2B 4ZO4A 1QFZA 2ZI3A 1BCSB 1G20B 5J4VA 4PV1B 1BRTA 5TF4A 2BRUC 4BO1A 4EZIA 2I2FA 3LWBA 3K1JA 3ZBTA 1S8AA 3OEYA 4IIDA 3U13A 2DCMA 3FGOA 3GGJA 5LZ8A 2PZAA 3FYUB 3KVVA 3TLMA 3KSUA 4PQRA 5TJ9A 4CKEA 3U44A 5DF1A 1C1XB 2WHRA 4GM1A 2PUFA 4NCHA 2X5XA 3SQDA 1QU2A 3UGJA 1I0IA 3AHEA 3EIQA 1X9GA 3OF2A 2XCSB 4IDCA 1RJ9B 2CFTA 3QK7A 3V3KA 2BGGA 3OEHA 3T7RA 1OBVA 4BNUA 2XHBA 4BCBA 2ONZA 3H9VA 3KQYA 2WUVA 1A4XA 1IBMB 4N0PA 1NMYA 3RVZA 3WB0A 4YP5A 5JG7A 3TQFA 4AWAA 3A0UA 1E32A 3KHKA 4R8MA 4CIDA 6ABPA 3OP4A 4J6EA 2AZDA 2PUBA 3KP1A 3GB9A 4CKCB 2OHFA 2GXSA 3K09A 1GG9A 3O92A 4RL6A 4GP7A 1P61B 1P45A 1MKYA 3BWBA 3QVXA 1HNZB 2CHEA 2NUTB 1PFVA 1GZ6A 1I33A 4HDAA 5B1OA 1NYTA 1Z0AA 2KWIA 2FK8A 2OV1A 2ZYWX 2ZYIA 1COWG 1VMDA 3WLRA 4PI0A 1VCMA 3JQEA 2PUEA 4GBED 3DLCA 3GA5A 3EISA 5K99A 3C8HA 3CZAA 5JV5A 4TTRA 4NMLA 4DPMA 4AY6A 2JLBA 4UBIA 1L5VA 3AP1A 3A6PC 3JAKA 4QUDA 4ALIA 3OLXA 1Y6QA 1LD3A 4GE3A 2XAQA 5J5VA 5EXEA 2JEOA 5C34B 2UYQA 2BKXA 1ZX1A 2YVAA 4QREA 2EIKB 2DH5A 3AOEA 3K6KA 1J21A 1WA5A 3DHEA 3EZ7A 3V4OA 2N1BA 4U6NA 1ADJA 1AK1A 2VQ6A 1AVTA 4HOYA 1EFTA 3GRZA 1POWA 2I6UA 3C6XA 1IUOA 2O8BB 1DF5A 3K5NA 3TTSA 4I8DA 1K92A 1R7RA 2C3MA 3PR1A 2JATA 4GSLA 3CUYA 3FBGA 2QJOA 3QEOA 3RIEA 2X3FA 3HVRA 2JLUA 1CS0A 3ZWDA 3F71A 1TMKA 2Q3LA 3SR2C 3D4BA 4D8XA 4DLWA 3P32A 5B7PA 4NZYA 4OIMA 2ZI5A 4MA0A 4X64B 3NBQA 3OJEA 4NYMQ 4OXRA 2PA3A 5JS2A 3CLTD 1VKNA 2GD6A 3BA6A 4LF9B 1HLPA 4NHEA 3L70H 4LNUA 4FUTA 3CCMV 1FF9A 4OSOA 2QE7G 5JAIA 2XCUA 4D9FA 3CVWA 2BBTA 4GWLA 3IP1A 1KO5A 1BT8A 4YXFA 1ZGGA 3EG9B 3I04A 4ZQGA 4R16A 5BRNA 5GZ6A 2RGXA 3P4XA 4NG5A 1UC9A 5BR8B 1TO6A 3KALA 2Q4RA 3VPCA 2JZOA 2W2MA 1CYEA 5JMTA 2QYHA 4FQ5A 1BGWA 3HDGA 1SPBS 3BK2A 2LW1A 1WMEA 4L51A 1HFEL 2R2AA 1V5WA 4RPIA 3HTXA 1ABBA 2HRBA 4C01A 2NU8B 1O95C 3EQ2A 3ABOB 1VG1A 1RYHA 1T2EA 1KYIA 3D6UA 5GJCA 4L4ZA 3KQPA 2X9QA 4LCJA 4CQJA 5EOVA 3O8CA 1DU4A 3P45A 3ERCA 2ZVDA 2YJGA 3FCEA 1HUQA 1X13A 2LR0A 3HCNA 3KJFA 4V0SA 5D01A 4DMHA 4ERXA 1ZN8A 2H6EA 3IUJA 1TQ2A 4ZZ2A 1XVLA 2RHJA 3EY4A 3GAAA 2AZMA 4JBNA 5EA2A 1N77A 2QTHA 2LDXA 5A3SA 1A95A 1LWOA 5JD6A 4UCOA 3A27A 4JWKA 4QUEA 1HE5A 4I8IA 1F1BA 4UVHA 3U4CA 4PXSA 2WQ7A 5EHGA 3SJ7A 2CEKA 3FSEA 1KEVA 4UUJC 2B78A 2C8VA 1ZK4A 2O20A 3JY6A 1PSWA 3NGMA 4LCUC 5KWEA 1NY5A 1F4PA 1CDEA 2BIFA 1RCTE 2ZXFA 5KTRA 3AF1A 3B8MA 2F00A 2PI5A 4DV5O 2ZE6A 5EMMA 3T1CA 2HCRA 2KS6A 4DILA 4L4RA 1HG1A 2CFCA 1Z4JA 2GRJA 7AT1A 2P9FA 3CVYA 4GEGA 4C7OB 2WPDA 2ZIGA 5IKEA 3RAFC 4N8DA 3F78A 5KVAA 5E8JA 4C9BA 4UFPA 1CW2B 1RRPA 3NWOA 4RIIA 2I55A 5DV9A 4LHSA 4DWVA 1NVPD 3BIWA 4DDKA 1T5TA 4YA6A 3IT2A 1JDBC 3TPCA 5BR8O 3IP3A 5KS2A 4EB6A 1V8BA 1D8TA 3V4SA 2ES4A 3B78A 2JCYA 2P4VA 3TPFA 3UCEA 4R5MA 4MICA 2WVJA 1SFRA 3DDSA 4A8TA 4GYCB 4IYIA 2R4QA 1P4GA 1E1NA 5A7GA 4EYSA 1QGUA 3ZMTA 5CBPA 4Y18A 1CJBA 3NRCA 3LQ4A 4M99A 5EZQA 2Z1NA 2FMIA 3K5PA 1JWBB 1V2GA 1YI2V 5JU6A 4G0MA 4GEKA 1FP4B 3A1NA 1VQOV 5BSHA 3NR7A 2GZ1A 5J47A 1TYAE 3CUUA 1RWQA 1OCZB 1QH8B 3R20A 4IWNA 5EJ4A 2DP4E 5A9RA 5BSRA 2QU8A 2VDJA 5DXFA 1X7GA 4I66A 2OM6A 1NBAA 5E9QA 5M29A 2HYIC 1QU7A 5K7SA 2C2WA 2PNFA 3RS3A 3ZIAD 1G8SA 1GO3F 1LWNA 4W1SA 4UM8B 3IPAA 3L8MA 4BMZA 2JGDB 1NW7A 3IE2A 5TJHA 2ZRKA 1ZHOA 1XLUA 3D81A 1KFEB 1NIJA 2HQRA 3E27A 1GHTA 4ALNA 3SYLA 3PEYA 1AN9A 1M34A 3LK6A 4IIUA 3AUSA 2KKWA 1DO0A 4LJ4A 1TVKA 1TYDE 1CRWG 1UM9A 1X7YB 1UKYA 3VU3A 3PN1A 4N0QA 1ZM4A 4H37A 1GSIA 1JJFA 4YXWD 4M1TA 4PFSA 2NVBA 5KNDH 2JNWA 2XTJA 2V7XA 4F3YA 4GX0A 3G49A 3OU6A 4HYEA 2MU1A 1A7JA 1D0VA 3ZC3A 3K09C 2JBHA 4YRCA 4BMSA 2G28A 3KB1A 1I2ZA 1K8XB 3S44A 3F0TA 5FOXA 4TWBA 4QKQA 1WLSA 4L0DA 4PEVA 4UFNA 1Q84A 4B17A 4YCSA 4LYAA 3C5VA 3ADPA 3ZD6A 4HH3C 5CMUA 2GRUA 4KVGA 1JTVA 3ID6C 3P9NA 2ST1A 4WZ6A 5C2JB 3Q3HA 1AQYA 4GNKA 4GR4A 1QGED 4G0PA 4DYDA 4MMYB 1GQSA 1T9DA 4Q1BA 3I5UA 1PJRA 1RWNA 2PYLA 1E79D 2ZPAA 3GOQA 3KZVA 3OMLA 3RRBA 4B3DA 4CG1A 2HJHA 3V1TC 5J4YA 4G01B 3SOPA 5FADA 4D96A 5EC2C 2GM9A 4YI3A 4RK6A 2GHQA 5AM0A 5I9LA 1SIOA 3TX6A 3OTWA 1Z15A 4NQZA 2P27A 4AYTA 5IFLA 2X19A 4TUYA 4ND5A 5FFMA 1BMDA 3LKBA 3ZG6A 3WGTA 4LDQA 3M0EA 2BSKB 4BR6A 2SNIE 1U6JA 4O29A 1J0DA 1T3HA 3QPAA 2NXEA 1GNLA 2P6RA 3PCTA 4N40A 4IDEA 1SWVA 4WZAE 9LDBA 2GLXA 4JLOA 1ZMXA 3QVVA 4PYQA 1I1QB 3BPSA 2XE8A 4W5TA 2A3RA 5B37A 2EERA 4MVSA 3II6X 4R2LA 4RF5A 5KEIA 4C76A 4TM7A 2G1KA 2WKQA 1X9HA 5A04A 1TFRA 1LC3A 2E6UX 3GLGE 2Y1LA 1M1YB 2PBLA 2WC1A 1E3SA 2XH8A 3CXUA 3DVQX 3OPYA 3CURA 5K2MA 4CZ2A 2JLXA 2IYXA 2WTEA 3TX2A 3QNMA 5CFLA 1BS2A 2UZ4A 3OJOA 1C81A 2WMYA 4JFRA 3OGCC 2PEZA 3SPCA 4NAVA 1FE8A 4RC9A 4WK4B 2XR1A 3DE4X 3W2TA 1D09A 1URFA 1RAIA 3BTUA 3DFMA 3AEYA 2AZTA 4JXJA 4UDYX 4F2PA 3LUKA 3QU4A 5IW8A 1VEWA 1HC7A 4W8GA 2QZJA 3A6DA 4OFWA 3SOZA 2H2HA 3NHRA 4CUJA 2AXQA 1BHJA 4OGWA 4LYGA 1EFAA 2PKEA 1GY8A 2P6UA 3G9ZA 3LBFA 2FG7C 3LU1A 4ZV9A 1ZAUA 2VPYA 2H0AA 4P4LA 3KO8A 3D0KA 1PG5A 1W5EA 4MI3A 3UB3A 1R3IC 3UGKA 1P7CA 2M32A 4NYIQ 5EQDA 4DCTA 2UUCB 3EN0A 3KZKA 4D8WA 2Y2VA 1QHTA 4UBOA 1L1EA 2G8LA 3CUEF 2V4MA 3LQRA 5IBCA 1HDCA 1ZCZA 2R8EA 5JAPA 1M10A 2K2QB 3BXZA 3FMFA 3N05A 3OX4A 4IOLA 1ZN7A 1TF7A 5KQRA 1FYVA 4OM7A 1NI8A 2YW9A 2Q3BA 3I8SA 3NIWA 4B48A 3CW2A 4JGSA 1N7JA 4CQNA 1URPA 4ZQHA 4AS2A 2BEUA 2QUZA 4C7BA 4RENA 3DH0A 3VC2A 2GR9A 4CMKA 2C5LA 1HQCA 1NVDA 1TZCA 4WSOA 3TG8A 1YI1A 1IXKA 3NAZA 2NLJC 3IVAA 3HXMA 2WB4A 2XTNA 3DZIA 4D45A 3JD0A 1LKZA 1VE9A 4BQNA 2PKXA 2I87A 2OK8A 4L5CA 2AOVA 4MS1A 1HWYA 4RZUA 4DG5A 1GPAA 1JS1X 5KDDA 2E5FA 1WL8A 5JWHA 3T3DA 4G9BA 3B20A 1IEWA 2BBSA 3K03A 4FLYA 4X7MA 4TYYA 2FUEA 2R72A 2IYUA 4D7SA 3JQRA 3DVRX 1ULUA 2LTAA 4FDLA 4K87A 5B3LA 4LH7A 1JE1A 3AVXA 4X71A 5A05A 3WX0A 1QAOA 3SC4A 1G8FA 2C2YA 2X1LA 4JBIA 1M66A 3EVZA 5FUYA 4RTSA 1TQDA 4K3VA 3AG1C 4DS3A 3BAZA 1QPZA 4KDFA 2CTRA 1K73W 5KKNB 1L1FA 2CHQA 5BURA 2XSZD 1K34A 4KH1A 4OF4A 3LQYA 2F93B 4Y8VA 3N8IA 4X60A 2F43A 1S4QA 2F1JA 2BSKA 1M57B 1VC2A 2QIPA 4LZWA 4BO4A 1PR5A 1TO2E 3WYCA 3VJRA 1U4SA 4TUYB 1KIAA 1MJ5A 2W22A 5C18A 1JJVA 4FKZA 2VQEB 1L6IA 3LUFA 1P7VA 2NGRA 5EINA 2IEAA 5C1OA 4FT2A 5MN4A 5LQRA 1EVYA 5JPDA 3COSA 3MBKA 4E5MA 4INZA 3FBWA 4G4SO 5A62A 1Z28A 2XGMA 1ORIA 4X89A 1C7RA 3OE5A 3GMIA 2PF4E 2LW7A 2H18A 4GPEA 1TM3E 4CW7A 2ZVPX 1GQFA 3MUNA 2EFGA 4YRGA 1GNSA 4MUBA 5BWNA 4QBTA 1RQ7A 5H5JA 1OLSA 3C3DA 3B2EE 1DKUA 4QAJA 1ESCA 4YHBA 4YRQA 4ARAA 2ZT9B 1U2RA 1ZISA 3OLVA 1DTWB 2QTCA 5DHFA 1A71A 2EQ5A 4J1TC 1W0JA 4CU2A 4HB0A 3ETQA 4DV2O 5ITWA 4B74A 5DBIA 1T5SA 4DJDC 4IFIA 3HKEA 4H7EA 4HDMA 1OTHA 3P9SA 2HY7A 2KQUA 2X1VA 3IHLA 3TJZA 1OZ0A 2HCFA 5JRZA 3IC9A 2AFVA 4RKWA 5AQEA 3CZCA 4ZQFA 4J7CA 4CG0A 4H0LB 4DUZO 3BWYA 1BAPA 3WGUA 1SR8A 4MAMA 1OV6A 4ESVA 4OLHA 1UM9B 3DDZX 4X65B 2IOQA 2JAHA 1BE1A 2IS1A 3VI3B 1KKLA 1M34B 2IDKA 3B2EA 3BGWA 3I5AA 1HNNA 3JQFA 1TC2A 4LK3A 3B3GA 3FSJX 4LHEA 3BGDA 3WNZA 2NWQA 5BR1A 3FDZB 4JI5O 3D3EA 4IEFB 1D6MA 4W5RA 1QG4A 1IG3A 1L1QA 2BJWA 3T15A 3UJDA 4PCVA 3I1IA 1LBIA 4HMPA 2PXAA 3MCZA 4RMHA 3E5MA 5EEGA 2UVDA 1NS1A 2YZ2A 1MRNA 4HDNB 1YCHA 5AM4A 1QH8A 4MVJI 1YJNV 2YQZA 1G8HA 4R1UA 5BO5A 4Q4HB 3S1AA 4EZEA 1Q7RA 4MVRA 4R9RA 3RUEA 2LCQA 2WWXA 3UK1A 4BB5A 5IAEA 2OORC 1LCIA 4ASUA 4EB8A 1I3NA 4PIMA 5D2CA 1CR4A 3FZQA 2JGKA 2EIHA 2PH3A 2YYAA 3HFJA 1DZIA 4I9WA 2GMWA 2I1WA 1OGJA 3H9QA 4KZPA 3M6XA 5FIUA 1CQIB 4E1BA 4IP0A 1S2MA 3BXXA 4D0GA 1UFIA 6ADHA 2E4WA 4TMZA 3ZJYA 4X7PA 4J6FA 4B6PA 2CJWB 4C05A 4K03A 1VHDA 3BGVA 2IU0A 5EBWC 1H2RS 1CJMA 1U1CA 2B4RO 3IIJA 4BQOA 3TQOA 2R6CA 5ADUS 4MDFA 1SKUA 7GPBA 1P1JA 4ID9A 2VUUA 1EAMA 1QP0A 4TSFD 1F2DA 4KE8A 3GGCA 4QPPA 4JI7B 4XUDA 4Z1MD 2DQ3A 2QM0A 3M3HA 3VPSA 3DKVA 3Q7QA 1QVWA 4QBIA 5JMOA 2C9DA 2V55B 4A16A 4LXQA 3D43A 2RHTA 1G7RA 1R6UA 3HGQA 4FD2A 4QG7A 5EN4A 1A8HA 1I2AA 2W6MA 3EHDA 4JI0O 4ZVOA 2EFHB 3WYGA 1FP6A 2NZVG 5HTOA 4EKWA 2P2LA 3O84A 4DOMA 4EFMA 1UBHS 3RK0A 3BJIC 4F71A 1Z45A 4GZLA 4S3MA 3TF5A 4DUZB 2HZBA 3QU5A 4G89A 5SZJA 5TT1A 4X8AA 2MK3A 2RAPA 3I0NA 4XWYA 1M67A 4J1QA 4MQ6A 3FIJA 3NIBA 1XL1A 2WG1A 4XFKA 3RFCA 1AMUA 5FV7A 2I65A 3IESA 2CC2A 3ZCCA 4FIDA 2AX4A 3H0EA 2WUDA 2IXDA 3P1JA 3EXEA 4BQRA 4LWZA 5K01A 3IT3A 2MSWA 4AHCA 1GPWB 4RFLA 1A3CA 2WJ4A 2N05A 1JPUA 4W9MC 2HJWA 5CLIA 4TT3G 2FEKA 5FTJA 3QBEA 5HBGA 1V47A 1HZZA 2HXSA 5EBMC 4EFBA 2FPIA 4BVFA 3AG7A 4WXEA 3R7FA 2YYYA 2O14A 3HLYA 1UBFA 3I2HA 5IDXA 1AR5A 4ZEWA 1E2PA 3UO8B 4L7VA 2F9MA 2NTJA 4B08A 3ZD8A 2V6FA 1AQJA 3OMWA 1NBWB 1C2YA 2AC7A 5DHUA 1VGVA 1KI6B 5JAUA 2YJ3A 5KTNA 3TRDA 2PZEA 3BCRA 3EG9A 4J0CA 4CEIA 4KR9A 3NTVA 3O2SB 2P77A 3FY4A 1SXIA 2AOUB 4LSZA 3ZEIA 3WFZA 3ASZA 3ZWOA 3NM5A 3L1UA 4Q6BA 2IUUA 4ZMSA 5LQUA 1VQ8V 4LNUB 4YMSA 3OEED 2ZYVX 1F5NA 1BC5A 4PA9A 1E3WB 3DBRA 4HRYA 4Y1GA 3RJTA 2OG2A 2N9UA 3EBOA 3VZCA 3BB1A 1UPAA 3C39A 1C7IA 1E62A 1T5DX 1JKMA 4WWHA 2HP8A 5JH7B 3G5AA 4OXXA 1DFIA 2CLDX 1JG2A 1PR3A 1DELA 2OHXA 4JV5O 3L7BA 3QFCA 2CBGA 3ZWXA 3UJ3X 3W4IA 1H8EA 4JI3B 1F2TB 3QVOA 4KMSA 3OTQA 1KZHA 4EJSB 3CRNA 3FH0A 3X2FA 4PFJA 1SBQA 4AWXA 3ZHCA 3O4VA 3IELA 1OJLA 3U37A 1Q2UA 3T7SA 3UJ9A 4OQQA 4OM8A 2X9LA 4UXJA 1GRNA 4BASA 3WIUA 5IJ0A 2PLFA 1YHQV 3OSZA 2GEBA 4FWIB 4IVNA 1Z7EA 3I9JA 1ZINA 3M9LA 3OTOB 3T0FA 4CKWA 1OPXA 2B69A 3TFQA 2X40A 3MJEA 2JH8A 3LKVA 3N76A 1A9OA 1YIJV 1KJ8A 2WLLA 1TIKA 1JI0A 3V1MA 2GBOA 2LJ2A 4K9PA 4P3YA 3TFOA 3W3AH 2IZ1A 4C4YA 4PNEA 1ZJWA 5DYGA 2J87A 2X0JA 3H2BA 2ZR9A 4UOZA 4YO7A 4RMJA 3ZE1B 2J3JA 3BIFA 3F7TA 4AX8A 3RTEA 1FXKC 1D4AA 2PRYA 3P0JA 4YPFA 3LQKA 7REQA 2GN8A 2YXEA 1YCIA 3G59A 3HCBA 3LBAA 4KXQA 3EARA 1KAQA 4LZNA 3O4RA 4TQUS 4H1TA 1GTL1 5ECYA 2JEZA 4B3JA 3CX4A 2CSXA 4GE0A 1QF9A 5TV2A 1ZXBA 5JJCA 1DJOA 3OPYI 3GPLA 5C8XA 2UXCO 1KEWA 1D07A 1WXHA 3PFNA 1SKYB 2W58A 1N8KA 1HQKA 4MVJP 3N2GB 2AN1A 1JHRA 1WPRA 1RI3A 1N32B 4FLUA 2OV3A 2P9YA 4QUGA 3UAOA 2JFHA 1O6ZA 3EHEA 2JI9A 5CVVA 4AUMA 2WIDA 2GA8A 1GUZA 3A11A 3DHWC 1V5IA 4JV5B 1BJKA 1K98A 3F8SA 5DGHA 3FYUA 4EY4A 4MMXB 3U44B 1B6GA 3CLVA 2R7KA 1ROPA 4KXLA 3RTAA 5CDGA 4BNZA 4LG1A 1E2JA 1T34A 3JRNA 4M1ZA 2CFIA 5KNDD 3B60A 3ECSA 4M89A 3NTLA 3RS4A 3GP5A 2WUWE 5ILOA 3ON5A 4HBZA 4BNNA 3QE9Y 3G0HA 3NBFA 4V2UA 3A25A 2G0TA 4QECA 5EHQA 1SQPH 1NBMD 1VCIA 5G0TA 16PKA 3T3IA 3UHOA 1RTKA 2DLCX 2OORA 4DR5B 2NPFA 3GVPA 1OCOB 3BFKA 3FJ1A 3K30A 4JK3A 4F4DA 3HP1A 4FBMA 4EL0A 2XI4A 2R7LA 1KIFA 2X5NA 5CH8A 3STWA 2XOKD 2C1XA 1G21A 3STUA 3H9UA 2JI7A 1X1AA 1XE3A 4FEYA 2OBBA 1G9SA 3NO4A 2IYTA 5F21A 1ODCA 1T1IA 2UYCA 1Y5RA 3BFRA 3KNZA 3EJWA 4UARA 2UUAO 5K4AA 3VH2A 4EENA 1E9BA 2ZBDA 5DW3A 4I1OA 5ALXA 2AG5A 3M99B 4HAZA 4RIEA 1ENOA 4Q01A 2GSDA 4O4HB 1F9EA 1XDZA 1UBJS 2Q6AA 1F4MA 1A8UA 1JAXA 2VATA 2Z5VA 1YVUA 3MT7A 2CH7A 4PBSA 1KOGA 2ZANA 3E15A 2GYVA 3PUJA 4JHLA 1SOVA 3P2IA 3SHWA 3VQTA 2PRJA 1IBSA 2I8CA 4GYYA 2QD5A 1BS3A 3NTRA 2AXNA 1U6IA 2BOVA 5JNRA 1JWAB 5FDFA 3GZ4A 2R1VB 4AK9A 1ULSA 3E8GA 1YXBA 1VMEA 1VMAA 2ZITA 3LBHA 4MNTA 1JR4A 1KVQA 1SOAA 5CFNA 2EFDB 4NESA 1RC1A 2NUPA 3RU9A 2XNHA 2XMBA 2I03A 3DZDA 2G04A 2QWRB 3T7CA 3UNXA 4BLRA 2YIDA 3LUPA 1BGVA 4P35A 1W2WB 3AR9A 4UAUA 3BVOA 1U9CA 3BHNA 4QQRA 2RK3A 2J6CA 4DT1B 3CUSA 2RGCA 4I9NA 3W2HA 1VQMV 3U56A 4KYVA 4PGHA 4AQYO 3OZVA 4QTTB 4AF6A 1TA9A 1W49A 1DTSA 4MROA 5IT9A 1R9JA 1OA0A 1EMDA 1E3IA 4TYNA 1YL5A 2A1UB 3I0MA 1G7CA 3REOA 1R8JA 4J0GA 3P8ZA 5FWXA 3I9V6 3GJ4A 4NFYA 3SBDA 3R9XA 1Y4MA 1DRUA 1DPFA 1GCIA 2ZBVA 3IX7A 4J29A 2HR1A 4B7CA 4P5PA 1SS3A 1J99A 3LNCA 1S9DA 2ORVA 2WNHA 2F95B 1ZONA 4MRAA 4ZCTA 4G5YA 3VHQA 1P1CA 3GH3A 1LW7A 2P35A 1SUWA 2Q21A 4JUBA 3ZWCA 2D7CA 2XA2A 4TXNA 4AY3A 5KAFZ 3PJFA 3LHIA 4FFKA 3PEFA 4QZVA 4EK9A 3PWTA 1ZWLA 4X97A 2QJRA 4OIFA 2QTOA 5F2OA 2EX3A 4FN5A 5AI6A 1S7CA 2I2XB 1EN4A 3GFBA 4O4LB 3NHBA 3T1QA 4LJSA 4EB0A 4ENRA 3U80A 4LNAA 5EYPB 3U9LA 6CHYA 1RTTA 3JXEA 1AHIA 4D3XA 4A9AA 1RLOA 3AH8A 3MMNA 2FSVA 4ZI7F 1VI6A 3UKJA 3E8BA 5ALSA 3UG6A 3RIYA 4DG8A 1IOLA 1Z16A 5G1OA 2PKRA 3UXHA 2I54A 3RODA 1YE5A 1Y48E 5BR4A 4DSUA 4CM7A 1T2CA 1P84F 1NJGA 1NQTA 3IDSA 1ISPA 3N7UA 1XNQB 2P9BA 1JYFA 1E2EA 2HX1A 2QP9X 2ZWAA 3FI0A 4LUCA 4X1OA 4NBNA 2YMQA 2VN8A 3CNHA 2CJFA 3L18A 3EMBA 3I4CA 3PQ5A 4RS3A 2ZUBA 4ZCLA 3RFVA 3GX1A 3W8FA 3LT1A 2HWXA 1S6YA 5JJIA 4DA8A 4KRYA 2ZXWC 4AB1A 1BHSA 2X2FA 1P33A 1JLSA 1WZCA 1G5HA 3C6KA 4KWCA 3X1MA 4TV8F 3SQLA 4ARZB 3U3XA 3DMHA 3CCBA 3E82A 4LH6A 4UUMA 4YRFA 1R0KA 3ELUA 3H8WA 4MOWA 4RANA 5HQ3B 4NDZA 1TAUA 2ACEA 4FT4A 1G42A 4UM5A 4L72A 4CIXA 3QI2A 4DSTA 3C0KA 1XKXA 1OXSC 1BEZA 4D4GA 4PG8A 2QL9A 3S99A 4ISBA 2EFJA 2EFCB 2AC4A 2W8BA 2I2AA 2CVZA 3M2TA 4ARBA 4JEUA 5JRDS 3OQ1A 2F8LA 1TCBA 3QKIA 5CYFA 3H17A 3IBSA 3U1TA 4UOEA 2JJ8A 1Q83A 5HMLA 2ETNA 2EXXA 1MD9A 1GTVA 5LMNB 4HNGA 4Q37A 1W94A 3B1VA 4KVFA 4BX3A 1EHYA 5J1TB 2XGOA 5ALTA 1F0NA 1UBLS 1FVXA 1YFJA 4QDTA 3DZCA 3GRKA 1XA4A 3B9RA 4D9EA 2H7XA 5JUWA 2RGAA 1OX4A 1W6UA 2CV1A 3LDDA 4PD4F 1JU4A 1TT5A 4GUAA 3S7TA 3RFXA 2REQB 4Z1MG 1JPVA 4LJ8A 3SZRA 1VRWA 5JJJB 1AI6A 5ITVA 4JSTA 1GT6A 1FVHA 1MV5A 4GQIA 1E4EA 1GUBA 4BLSA 1JKJA 2PX0A 4ZALA 2FR8C 4YGYA 1NT2A 3H5RA 5FP0A 1G41A 1T8SA 3KBOA 1SA0A 3L75H 1Q22A 4PPNA 3D9QX 4E7OA 3G6EV 3BA8A 3AB3A 3HN6A 2XPCA 2UZIR 3LX8A 3IR5A 5TX7A 1JT9A 4CTNA 3R9WA 3HSSA 2XRMA 2OZPA 3SJCA 2UYOA 3RUAA 1U7DA 1RSZA 2PJRA 2OC4A 2YN4A 2JFWA 3PEVA 2EJBA 2DJIA 1JR3D 3E9DA 3SZGA 3VV2A 1K9SA 4U39A 2J7KA 1AJQA 4PSKA 3TSCA 1E2GA 3NUGA 1E3QA 2DFNA 3WZMA 4RTKA 4MR7A 1MOSA 4JASA 2YHIA 3GWZA 3TKLA 3WAKA 4X6YA 2YBEA 3I9OA 5CT4A 4UVIA 3UMYA 2QMZA 1DRVA 2CHUA 2H1HA 2NTYC 4KOAA 3QJYA 4PCAA 3EPJA 4RHFA 4KFCA 3D8TA 4AULA 4XWAA 3H1HH 4ZQIA 4HVLA 4I9QA 1GN6A 2ZDHA 3TQTA 3DHVA 4E1AA 2LGWA 2Y9MB 2B36A 2B7BA 1X1RA 1S2GA 2W2XA 3CNLA 4JA0A 3N28A 4HDKA 4PR0A 4FZ0A 1DEHA 3UAGA 4AF7A 2OBMA 1AS3A 2CL5A 2JL1A 1W4AA 2D00A 3KBBA 4OKNA 2Q99A 5TS3A 5IK2A 3KR0A 3I23A 1MBZA 1SQGA 4FLVA 2LXNA 3FNRA 2JA2A 2CMGA 4RD4A 5B7GA 5A2QA 3THOA 2JJQA 3VC3A 3H19A 1EIZA 3AVYA 5LMUO 1L7BA 1ZGHA 2HXYA 3F67A 4JT9A 5M3BA 2FWAA 5G3YA 3ROKA 1DIHA 3GLHE 3P2JA 4NYIR 4Q7LA 1WUYA 3O8OB 1J0AA 4EGSA 3DYBA 1FVOA 2AFHA 2DCUA 2X0FA 3HCFA 1LLCA 4XPIA 3FCYA 4QUBA 1IUNA 1EDEA 2WAAA 3R44A 4EZBA 4JUFA 2PZ8A 1Z6AA 3KLPX 3AXSA 2I3ZA 2CHFA 3HGMA 5AVSA 2MYNA 4Z0TA 2ZU0C 2NOAA 521PA 4R2XA 3MRXA 1DUSA 4BNTA 1DGSA 1QQ5A 2YVQA 3WA7A 4S2EA 1HY3A 4QGGA 2NXWA 3C5EA 4YUYA 1OHHG 3N2NA 3NFRA 3N86A 3F5SA 3P30A 1JNYA 4PZAA 2QAGA 4FMDF 1Q6IA 2FUCA 3P9PA 3A7DA 1MTZA 1ZI6A 2Q46A 3R24A 3BMOA 3K8QA 3WRYA 3ZI0A 4PHCA 4C87A 1U31A 1GPBA 1RKBA 1NKVA 2FPGB 2WFLB 1G1XB 1ZD5A 3PEEA 2ZYUX 3VZPA 4TL6A 3K6SB 4J49A 3DAYA 3E3LA 5FBRB 821PA 1KEUA 3ORYA 4OGLA 1DWPA 1I2DA 1WXIA 2G0AA 2JKZA 3QX8A 3ZDXB 2C1EA 4U2GA 4IIBA 4HNAA 2FZCA 1FS0G 1RMTA 2CNLA 1T6NA 3OT1A 4MS4B 4PVDA 4NMHA 3MAJA 5DBOA 1XVUA 5AJVB 2DMRA 2J8ZA 2HO4A 4RY0A 4RZHA 4UUPA 4BUZA 3TL3A 5HJ2A 1ZRSA 1DO8A 1DRKA 5BPFA 4KKXB 2OXFA 3P3PA 2WOOA 4MQFA 4RJ2A 3EASA 3VYTB 2ODNA 1HT3A 4DLYA 4U9UA 4BVJA 2D4AA 4JL8A 1KSJA 4N5HX 1TU4A 1YE8A 5CU7A 4J9YB 2ETXA 1FS6A 5FPTA 4QLBA 3DEIA 5BNWA 4FXOA 3QFHA 1F3OA 1XMOB 3UMRA 4E2YA 4QARA 1RQGA 2RK6A 1V55B 4Z99A 2VHYA 2M98A 3CLHA 1J95A 2XECA 5DE3A 3T1VA 4LMRA 3EIUA 1THZA 1EWYA 1S2NA 3K2EA 2NXCA 1BJRE 1JH8A 2XUZA 3K73O 3IPLA 4H59A 5E9WA 5HG0A 2C5AA 1MX1A 3PX3A 4URHA 4AUKA 1G59A 3P9XA 2PSSA 1QQTA 5ENVA 3SEAA 5LU8A 4QUJA 3RYTC 4BWFB 4BP8A 5JXIA 3ER9A 3LZCA 4CKYA 2X9NA 3K4QA 4Z49A 4J7ZA 5CXUA 5JI3E 5BSVA 1JDZA 1YBHA 1YHZA 3LH5A 3GJ5A 3UBTA 3GQVA 1L4LA 3L7DA 4HEJA 4OFXA 1HZZC 2J6HA 1H2HA 5D3QA 4HI0E 1K6EA 2FQXA 4L16A 5ALFA 2FW7A 1QC5B 2W4QA 1MZPA 2P1DA 3W8RA 4NS4A 3NT5A 3VYWA 2CLMB 4HPJB 1OC4A 4JVOA 3ANTA 1E3MA 3OZEA 2JIZG 1LA2A 3RVNA 2HPZA 1RPZA 3KKOA 2W4IA 1N2SA 4NE7A 3WMXA 4FNOA 2YJ6A 3ZTWA 2DAPA 3CX3A 3S1LA 5HZHA 3N6RA 1ESEA 2EIKC 1C8VB 1NVXQ 6REQA 1HEIA 4JI2O 4KPUB 4D7TA 1XTQA 3D6FA 5E9AA 3W4KA 3ETJA 1PV0A 2BELA 5L8VA 2AT1A 3USCS 1S5JA 3EGXB 1HKHA 2O8FB 3WSVA 1RMYA 2RHDA 5JZBA 2WJGA 4IKOA 1HDRA 3IODA 2SKEA 1C0PA 1GPMA 1ZA2A 3JQFC 1OBFO 1IIRA 2ZAGA 4JR0A 3SX2A 1EFVA 3AY7A 1YULA 1VB5A 3FGNA 1OASA 1UPBA 5KWJA 3IRUA 3OZGA 3KPUA 3PPIA 3CSSA 4WESB 1E8NA 3ICWA 5EP3A 4D26A 1WZ2A 4WOBA 4EY8A 4CFYA 1YDEA 4BUCA 1QRUA 1XZDA 3L7YA 1RYEA 5DBFA 4B31A 2ZJZA 3SDBA 4O2AB 4J0KA 2V74B 2POQX 4IIGA 2CMFA 2Z9CA 4EPTA 1A2KC 2ZWIA 1NLYA 2WSLA 4LJAA 1QRSA 1IUPA 5U4XA 5AJUA 5AKZA 3EQ9A 4R71A 1AI7A 1QUEA 1Y3FE 1M93A 4P3XA 1E64A 3DSQA 2IDMA 2WJJA 3ETLA 4TTQA 4EO9A 4ZI7B 1KKCA 1L5QA 3R5JA 4MVJF 5JS7A 3U09A 4PS1A 1ZRHA 9MHTA 3W7TA 4KGXA 3C7CB 2C88A 1W88B 3FTQA 3H8SA 1AB3A 4Y2XA 1MC5A 4C4XA 1FMFA 3EC2A 3W1WA 1SUFA 3U48A 1V1MB 1JJAA 2A35A 2O6HA 4DB4A 4IHJB 4P7GA 4LKOA 5DI3A 1MDBA 4GVPA 2II6A 1QZTA 2ZRCA 4V03A 1PNLA 1P2VA 4H13B 2VYVA 3B3FA 4NDAA 3EVDA 3UBMA 4WKPA 3PGVA 2O48X 1P0MA 2P67A 2YZKA 4BMXA 3TE7A 3VO9A 1FSFA 3AVPA 1SZPA 2I4LA 1GUAA 1YVPA 1YA4A 4JI2B 2D5IA 2FN3A 1QFSA 4PX3A 5AR1A 2C4UA 4I4NA 4R1OA 3IEVA 1FDWA 4WFEA 1CRLA 4BMCA 3G2IA 1SHUX 2B61A 2R6GA 4KVAA 3K96A 5IEJA 3AR6A 4ZQCB 3LBIA 3P0IA 4UULA 4H4DA 1WDKA 5A7HA 1HQYE 1IRXA 3FA2A 1X8JA 1C0LA 1ZUNA 3UMGA 1E20A 1IHUA 4ZKDA 2BHTA 2PX6A 3B1WA 1E8DA 4TMYA 3HGTA 3JYNA 3IO5A 2QUBA 1E2KA 3UK6A 3FB1A 2VTDA 1V4VA 3OTIA 1J7KA 2JAXA 3RSFA 2B1GA 1WMSA 2BHLA 4FWTA 4N82A 4CZZA 2ZWPA 1R0WA 3N7AA 4B76A 4BV8A 2VT3A 2F90A 4G4JA 1I36A 1LDEA 2FZWA 4QE7A 1N2GA 1PS9A 3T35A 5K0ZA 4LWSB 2HC9A 4LN1A 2IJKA 3DBLA 1FDOA 3NT2A 4HN2A 5EI5A 5FBVB 1SRQA 1RQNA 3NWEA 5H16A 5JI2E 1QCYA 1Z7WA 2D54A 1U04A 1NQAO 1R5BA 4Z0NA 2EAUA 1SCKA 3FSGD 4W6ZA 4QRHA 2XZTA 4WOKA 1COZA 4E51A 3RQIA 1QIDA 4EFDA 3NBKA 3REQA 2A9FA 2I6XA 4M53A 2I8LA 3AJAA 4ND4A 1PUJA 1AUXA 5JROA 1CHDA 4FLZA 1IY2A 2LV8A 4YUWA 4X44A 3W4JA 4M49A 2OY0A 3ZY6A 3BAAA 1D8AA 2QD4A 1N0WA 1PFGA 2I4MA 3AKCA 4OBBA 3UH1A 2IPOA 3CZ5A 2QDKA 4EVRA 1KKDA 4UM9B 1AV6A 1PLKA 2X5JO 4URXR 2QEXV 4TN5A 2OIGA 3WLOA 2I34A 3D2CA 1YR7A 1RZVA 3F9IA 4O59O 5F9HA 2NO7A 2AEMA 2CHVA 3QELB 3VQYA 1T4GA 5EMKA 1Z74A 1Z4OA 1MA0A 2V7UA 4MAFA 3E3AA 4K35A 3WK4A 4K5QA 4BQFA 1G19A 2OM2A 2BE3A 1GM5A 1SZJG 1GDDA 4JB8A 5JWOA 3LIPA 4IDAA 4J16A 1JZSA 1F17A 3I2YX 3O31A 1KYQA 4I5SA 4IQ8A 3GNLA 1N0VC 3C3PA 3G7UA 4LFAO 3IJEB 1FRNA 1G4UR 5LA6F 3E7DA 3GNTA 3QXXA 3BT7A 3JASB 2BN4A 2O0KA 4XJTA 3ZVRA 4B2PA 4XYGA 4AO6A 5B36A 1SC6A 2O57A 1U7XA 1DAHA 2Q6OA 5H3LA 5K0LA 1SZXA 1E3DA 2D0IA 2WA1A 1ZLZA 1EGVB 1FX0B 1V0JA 3C1UA 4BCCA 1O03A 1RQRA 1W0JD 4ME6A 5TARA 3OE7A 3UGQA 2JIBA 3ONVA 3HADA 2NZ2A 4MA4A 1E9SA 1HO3A 1Q2XA 4ZHQA 1XXHE 3KSRA 4JITA 2P2CA 2APJA 2O8DB 4D98A 4KE6A 4BAZA 1UZAA 2OFPA 3M4ZA 1EP3B 2ZG6A 3P9KA 4Q7MB 4CCAA 4ZOLA 1P3DA 2H1FA 4FWBA 5JVDA 3G80A 4CLEA 3ICOA 4BU0A 1LVGA 1FU7A 1KK0A 3LGSA 3DVAA 5G3ZA 2VRNA 3IOEA 3PUWA 3VHXA 1UODA 5IJWA 4X8HA 5AJXA 1NFRA 4Z7JA 2GK3A 5JEEA 1P4RA 1AJPA 3CR7A 3U62A 1H2NA 1QORA 2VJOA 2ZJ5A 2V3WA 3MWEB 4PAOA 2A58A 1C3EA 3ELYA 3VR6A 1SCAA 4EUHA 3U61B 1AGXA 2H2FA 1ND6A 3OETA 4BBAA 2B3TA 1L9XA 1KJYA 5DLPA 3CZRA 1KMHB 4CR6A 4MSUA 3ER8A 2AVNA 2IIVA 2VDWB 4L5AA 3UPDA 1E7YA 2PTHA 4MYTA 3WKAA 2XCRB 1XZLA 2UDPA 1NJSA 1TX4B 5KMGA 2B0CA 3ESDA 5ARBA 4GVXA 1VBNA 1GN8A 2D8AA 2G5GX 3PKIA 2WVGA 4MVCA 1VRVA 1EDOA 3KZCA 1YS7A 2C5GA 4B3SB 2PX4A 2WE8A 4IICA 3DXRA 3VXKA 4D8TA 3OQHA 1HURA 5EGSA 1MP0A 1VYUA 2H4HA 3BUSA 3OUZA 3TRHA 4EI7A 2ZUSA 1GGFA 3CT6A 2JCVA 3DNPA 1NNI1 1UMKA 4R1NA 5C4GB 5BY2A 4E07A 1EVEA 2I99A 2ORIA 1EFHA 3QYJA 4JR1A 5I8WA 2JCGA 2Q1YA 2SKDA 3EW7A 3HFSA 4PNHA 3RLFA 4Y98A 3WK8A 1LBEA 3H1TA 2IVFA 3NGLA 1JXOA 3J7AC 1P5JA 3A14A 3E8MA 1VG8A 1HSOA 3E8SA 5G1PA 3ZLBA 1PQPA 4P4SB 3IEUA 3O91A 1QZZA 1Z4PX 1NXVA 4M8SA 4QATA 5JCJD 4ER3A 3U5TA 1Q1BA 3TR5A 5ALUA 4P38A 2IS4A 1QO9A 1D2HA 1YIOA 3I5MA 4YRSA 1VCNA 4PC7A 2COUA 1E9VA 1TEVA 5DZSA 3EZ6A 2W6IA 4YRNA 5JD4A 1Z83A 4TLLB 4WASA 4YHHB 1JHOA 1H2MA 5FBHA 3BH7A 1WEKA 1WJGA 4B9EA 5EEHA 4XDGA 2D74A 2FMHA 3SYMA 4Y2QA 1MG0A 3URKA 3U3KA 2AN9A 2GXUA 3H5LA 2ZSDA 3N3AC 4OJKA 4RMIA 1C3OA 2DY0A 1QBGA 2ZXUA 3CNNA 4YP7A 2QKCA 4CKBB 1JJBA 4BBPA 3MXOA 2WJ6A 3DZFA 4JEIA 5C81A 4LF8O 1WCXA 4GOOD 4W1QA 4BLWA 1A0OA 5FTMA 3UT5A 4B7KA 3DCJA 1NSYA 3R5KA 2E4UA 3G17A 4IQ4A 3OAAD 5H68A 2DT8A 3G2MA 3D54D 3T7TA 2EU8A 1O89A 4YWHA 1XL0A 3KKNA 4CIAA 4DV7B 5JSYA 2A0LA 5CLFA 2ZAIA 2ZDGA 3BA1A 3FVQA 4WCDA 5DOZA 3T0GA 3G4SV 4MCAA 2VXYA 4BKQA 1U4OA 1XTBA 4PU0A 1ZVVA 1SCUA 2QRVA 3H1KH 2AA3A 2G9ZA 2HA6A 3A4IA 5ERYA 1CB0A 5JISA 4U6SA 1Z7GA 2FFHA 3BL6A 4X45A 5I7RA 3GIWA 1LGYA 5KHAA 4I36A 4MUGA 4EB3A 1BSMA 3QA3E 2OCXA 1SERA 3BJEA 4D8UA 2XNSA 3QU2A 4RVFA 2HM7A 5COQA 4TQGA 3BIJA 4BO8A 3LXRA 4QDXA 3TVDA 3OFJA 3VR4A 4B3HA 1EU1A 1HEUA 1TCCA 2WIBA 1Z6QA 3U3OA 1NTKH 3HRIA 1CUXA 1YZKA 5D7BA 1QMPA 3AG2C 1DAEA 4HZUA 1DF4A 4OL9A 2CLIB 5CYOA 2QWXA 3RAJA 3VZQA 3WJ7A 3CR8A 3MUOA 1XDCA 4BZXA 4MJ7A 3EXIA 1X14A 1SU7A 4YDRA 3VGPA 1AQNA 2GD2A 3OR7C 1EM6A 1GQYA 3ENZA 3A0HZ 3OQIA 1FX1A 2VYNA 3PA6A 4PY2A 5ESWA 2C95A 2JF0A 1DQRA 5SY4A 1M1UA 4DIFA 4K9MA 3FNGA 3GGGA 2QMUA 4DAEA 3HLTA 1G9XA 1Z34A 2QPAA 2B8JA 1JJOA 1DC6A 4CH5A 1E4OA 1OFUA 3B8HA 3MGAA 1V16B 2I3GA 3OOYA 5E3JA 5HJ5A 1W36C 1WB4A 5J4LA 4PPQA 4L5BA 4BZWA 2Q07A 1DT3A 4KO3S 5BYKA 4XYLA 5TMEA 1AGPA 5CFRA 1LSUA 4YAUA 1P4AA 5C51B 2CV2A 1HFWA 3VOBA 4TWRA 1TO1E 2QR5A 4J75A 1VLJA 1KEEB 2ZJ3A 3DB1A 4GM4A 2OCGA 4GI1A 5IKMA 1MO5A 3MWLA 1Q6UA 3MAGA 4NFSA 3YASA 3NKFA 5JY1A 2OBYA 4HQ6A 5LQAA 2O8CA 1RVDA 2E82A 5DNAA 2OV6A 4R9VA 1JHAA 2WZQA 4ERNA 1GN9A 3B13B 1HDEA 3BE6A 3GDHA 3BDIA 3O93A 5D1HA 2O50A 5D3MB 4YRJA 5MGBA 4E4EA 1MQ9A 1N6KA 1Q6YA 2NVUB 1I4WA 2I62A 3VSEA 3DOIA 1C1DB 1B6SA 1C7EA 4ND8B 3FHTA 3VQXA 3U6KA 2PRKA 4AS3A 3QUBA 3L71H 3GLTA 4DFDA 3EE6A 1KU9A 4DJTA 2Y0BA 3NBUA 5G4LA 2IGTA 4B3TB 1XTRA 4OU5A 3ND6A 4FMDB 2YYSA 1SKQA 4TXMA 3NAGA 5AVJA 1XZHA 1U7UA 2I2WA 1OGYA 2P4SA 4ZVSA 4R1QA 3N7TA 2DHEA 4QWWA 4EKIA 2ZD9A 1R0ZA 5FA8A 5IMBA 3GVIA 3RG2A 3ZH9B 4AZ3A 5LLDA 5F2VO 4LGYA 4RJIA 1WEHA 4A0RA 3D3QA 5K1ZA 3AKDA 2I91A 3DP7A 4JROA 2YHBA 4M54A 4IIVA 4RXMA 3RTBA 1X7WB 3AI1A 4HAYA 1RJEA 1AA9A 3TECE 4NU8X 1Y3CE 4RAIA 5DASA 4E70A 1C9DB 4OY3A 3M9WA 3CKYA 3JVUA 2PVCA 5KNBA 4TTAA 4B3IA 4DR4B 3GFOA 2Q67A 3GVMA 1JU3A 3FW1A 4AJKA 1U0FA 5KU7A 1XTZA 1T8UA 2C78A 4HDSA 5DTJA 3U2QA 1XVVA 3DB2A 5LP6B 3AK4A 4OQYA 2IT1A 3ZLVA 4DMGA 1M5TA 4N6OA 1MH1A 4KP7A 5ICFA 2ZCUA 4QU0A 5K0GA 1GL9B 3DZGA 3JS5A 5ADWA 4LWOA 2BOCC 3C3SA 1WZNA 4F2WA 3F73A 2RB5A 1VMGA 2F59A 4NBSA 1XNRO 2QTAA 3EUEA 4MW9A 1G17A 4UNNA 5E1BA 1IJBA 1M54A 4L2IB 5E3IA 1EZ4A 2VYCA 4GSKA 1ORHA 1CF2O 4TV8B 4IJQA 2OPBA 4LX8A 3F5MA 2JBAA 1MX9A 3HVHA 3B7PA 3Q6NA 4QXQA 4BKRA 2XOKA 3PHBE 1O2DA 3QPCA 4FLMA 3AJRA 5LYYA 5J4HA 3IVRA 1BFUA 3NEPX 1GR0A 1JG7A 1B2LA 4URUR 2IHUA 1X1BA 3KVRA 3FXAA 1L9KA 2X6TA 4JJ8A 2VRBA 3H04A 1U1EA 2OYRA 4QXRA 1F4VA 3RU2A 1KRWA 2DWQA 1W36D 1I4TD 1LNZA 4DMFA 3GLIA 3BGIA 4HNHA 2C03A 3DOHA 3VDXA 2J0VA 2LWIA 3H7AA 2YJNA 3KQTA 4HN9A 4P82A 2QPTA 4A6EA 1OX6A 4X1IB 4B43A 2AZXA 1XTJA 1P6QA 3QOXA 4C78A 1N3YA 3UHFA 4QT0A 5HJ7A 4U2DA 4FX2A 2G5PA 4PYNA 1M5IA 1VMKA 2P2DA 4RLHA 3G0DA 3N8DA 1DI0A 1IMJA 1DLIA 2ATIA 3AKEA 4PSAA 1YCDA 3FOFC 5JNLA 4GVLA 1WW8A 1LS6A 3UK0A 3W5IA 3M9XA 1KDRA 4BLOA 4ZFNA 4HH4A 3TZLA 5LDGA 3DEHA 1N7GA 4OA5A 1QYIA 3F2IA 3KTAA 4Z9YA 4TWZA 2QBYA 3CF0A 5IT0A 1PR4A 1WUIS 2I71A 1C4WA 1FFAA 4M36A 4L76A 1Z9BA 4JJZA 2B37A 4DY6A 1M2VA 2V7BA 3AMVA 1AKTA 4QTZA 3LHFA 3SKVA 3HK2A 2BFDA 4BJ1A 1J0CA 5LD2B 3F3MA 1Y82A 3BREA 1Q1EA 4BFXA 5HCUA 4X6UA 3HDYA 3BFPA 2TMKA 2C1ZA 4J9UE 3VSCA 1QS0B 1W2GA 5F1PA 5AHOA 3BMNA 1YTFB 2WAXA 3DDWA 3I52A 5K6RA 2QP4A 2YS7A 4JKIA 1AB6A 4LSGA 2V7QG 3QWAA 4GLLA 2DQZA 3EEYA 4QGAA 3WQSB 1GVHA 4KDRA 4DQLA 1AB5A 4LOLA 4ZOCA 3KDSE 3U7EB 4YGXB 4RADA 2H8PC 3EOZA 1LW6E 4RO2A 4QVKA 1GNRA 2BFCB 2P3SA 2WYVA 3MELA 3A4VA 2BISA 2FG6C 2JCBA 1U7WA 1R6BX 1U3TA 2BWJA 4RBNA 3WL6A 121PA 1ZSYA 4BE7B 4R4JA 4A8PA 2ONKA 3COWA 3L82B 4CQLB 5AKKA 5DCUA 3FTPA 1PWEA 5HF8A 3GLQA 3V4FA 2ZZMA 3SPGA 1ITZA 1YS2X 2QZPA 4KXMA 1VHQA 1UK7A 1SIWA 4IBOA 3IUSA 5L53A 1AT1A 4L5YA 1SM4A 1VGQA 2OLEA 3T5TA 4HAUA 5FQOA 2WA4A 2JJ2G 4BY9E 1L4BA 5DYYA 5JNWA 5EXSA 3AW8A 1MCZA 3UPUA 2Z6VA 3LCMA 1CVLA 1WB7A 1ZA1A 1Z6TA 4HYTA 3W5VA 1PR9A 1Y81A 4FCWA 4LJYA 4CM5A 5IUKC 5A4AA 1DP4A 1FP7A 2BR5A 3T5BA 2CLHB 1J39A 4V1CA 2ZKIA 5BV0A 4BMDA 3FOEC 1R4AA 4EDHA 5CB0A 2JD1A 4BIZA 1C8BA 1E0SA 2P4QA 4GP6A 4B7ZA 5HZGA 1N3BA 2CGOA 1U2QA 1V11A 4O33A 4KLNA 1KOFA 3V7NA 3GT4A 4HS9A 5EWMB 3JQDA 2NVWA 2QVXX 1U8CB 3HU1A 4QGHA 2AH5A 1KSFX 3E6AA 3H84A 3ZPXA 1DG9A 3NONA 2W6OA 4Y2VA 1MVLA 1H93A 1QCCA 2X7HA 3RJZA 2VNHA 3OZFA 4BNWA 4ZBMA 3ZI7A 4CTKA 3LUGA 4JTDB 3IIIA 5TQ2A 2Y1FA 5JS8A 2RH4A 2FXVA 4BQEA 2JI6A 1RM0A 2WPDD 2HWUA 2A3QA 3H13A 4KU4A 2J5XA 4TWAA 4C89A 1H1LB 4XIGS 2VTBB 1E58A 4N8SA 5TMBA 2WRZA 3OJFA 2PO7A 1W0KG 1EP1B 5JYBA 2PX8A 3PXBA 2A4KA 2YTZA 3E89A 1I3LA 1GRVA 4MP3A 1F1JA 3CH6A 1ONSA 3R40A 2PUJA 1TD9A 4H9GA 2BM9A 2QAIA 1P2SA 2YHUA 3KR9A 4B7XA 4JUAA 4RFVA 4WCFB 3WXMA 3BF7A 4G28B 1SBIA 4ZT7A 2G77B 4PONA 3IDQA 5TLSA 2IHYA 1ISJA 4KHZA 1U28A 4FZ5A 3OOJA 5JWRA 3HA7A 1HPLA 2VKQA 4GOKA 4IG9A 2YDXA 2EVWX 4IHJF 3VU1A 4U7OA 5T41A 2HSZA 1YR3A 3ICQB 2CNBA 3RBZA 3ZV6A 4COOA 2AMYA 4OXSA 4RKQA 1CUIA 4LOIA 3ITEA 1SZCA 5K0NA 4EHBA 1GKUB 3QVLA 1VJGA 4IILA 2C5EA 5DM4A 4QQNA 3ZE0B 2ZSIA 3JV7A 2K2WA 3LKZA 1W5FA 1YHNA 2CXNA 3L7NA 3QX9A 3QX7A 1Y66A 3DTVD 2HBYA 4ABMA 4KQCA 2EBOA 1H2ZA 2RC5A 5JMPA 4CTOA 3CVUA 1Z5VA 5C8YB 1ODSA 3I2IA 1J2JA 2IQIA 3DVLA 3K92A 3PICA 3UG7A 4EHAA 1PGJA 1H1DA 1NVMB 2EZ4A 4CM3A 3LL4A 3RSQA 2C92A 2AKEA 2YUTA 5HS6A 3ABMB 3NUQA 1BYUA 1EX7A 2IZ6A 2R8YA 3CG0A 4G65A 4OXKA 3QLTA 1E9RA 1EWTA 4S0ZA 4LZPA 4RLSA 3MVEA 4GPAA 3L0OA 3ABMC 4ID3A 2FWIA 1J22A 1AJNA 1QO0A 5T6BA 4IUCS 1MABB 4BGDA 3CNQS 2PGAA 4KXYA 4MI6A 4DDUA 2DGDA 1JRLA 1T24A 2ECQA 5KUTA 4YJ3A 1LEHA 2BVNA 1H4VB 2J3LA 1TPZA 2PS1A 3WJ2A 5BUCA 5IXJA 3SM9A 4LBZA 3M3DA 4AKEA 1NNUA 2M2IA 3QU9A 3CLUD 5CA0B 3W7SA 1DX4A 3D3WB 2XDYA 4FHEA 3E61A 2CE4A 3I2JA 5K3AA 4M1OA 1KARA 2FW6A 4FGZA 3RVOA 1JHXA 3LSQA 1WHSB 4E09A 4ES6A 2QRZA 1QIJA 4IS3A 1MEJA 1SIBE 2CE2X 1QVAA 4RDIA 1SUEA 4UCFA 4YJFA 2QS9A 3SVZA 2PQ0A 5FBKA 3VAZA 1VE6A 4IYJA 1OT5A 3FUXA 3OZIA 2DFLA 3JWHA 3ZWQA 5F33A 3TAUA 4MRRA 3DULA 1UBGA 3E1SA 4H6XA 5CAEB 1IZ7A 5EJ7A 3T06B 1EGQA 2G40A 2WJWA 1NNEA 3C4QA 4JLAA 3ONEA 1V7QA 3EA4A 3FR8A 4YLEA 4GM0A 1I51A 2CBZA 2HU5A 3FKSA 5AOBA 3LPCA 3LXXA 3R3XA 4Q1AA 4PRLA 2JFOA 4B3FX 4BP9A 3D64A 5G53C 4RIFA 3R7NA 2QSZA 2YZMA 2P0YA 3QYPA 5BV2P 3PCXA 4YMWA 3FN4A 1B8UA 1I80A 1NLZA 1T1JA 2GAJA 4LW8A 1AHHA 4NONA 2X2OA 2IBZH 2RHLA 4OFZA 1QANA 3HB9A 1E7SA 1BTOA 3AV3A 2ZSJA 1I30A 2XD9A 3C3JA 3PXCX 2PU7A 3NDPA 1ONOA 3QVWA 2QM7A 3W8EA 4S2UA 3ZIUA 1P7YA 2HMYB 1LBTA 5FX2A 1S3IA 2F9FA 2Z3VA 4OYYA 1CRPA 1PVDA 4Z4IA 1YC2A 3N27A 2IV3A 1UMDB 3ISTA 4RXTA 4YRLA 3CPEA 3ZK8A 4BOYA 4E94A 3QWIA 3WL7A 3TLJA 1MQAA 2Z09A 4ALMA 2ZB4A 1U8YA 5LBIA 3RYIA 1EXDA 1AUPA 1JFRA 1GGHA 1AROP 2C2MA 4L22A 3DKKA 3MCWA 3PI7A 1QLNA 2C8JA 1T1GA 1Z4IA 4A27A 3EAFA 4EG1A 1J09A 1HLDA 4MGZR 5FOWA 1KUQA 4BJ6A 2JCXA 1H22A 1KA9H 4IYRA 2Q2QA 4D82A 5A9TA 3GPBA 2EIMC 3DNMA 3VKGA 3SX0A 1Y80A 5AM1A 3TW0A 1TAQA 1MH9A 2PD3A 2AEJA 2C4KA 2JHGA 3OZCA 1YEWA 2QUKA 2R6ZA 2XT9A 1KI4A 3DGFC 1XELA 5J40A 4MWDA 2FPWA 4JQSA 3K32A 1LF0A 1P9NA 3EOBI 4ZT2A 3PE3A 4YDHB 1B7GO 2WICA 2XUOA 3MLBA 2ZSHA 4MQEB 1CQWA 1I08A 2X4LA 3OIGA 4AMBA 1Y89A 3JARA 4N23A 1YTLA 2FFQA 1BS1A 5E2IA 3EIWA 1GPYA 2SBTA 2XB2A 4WFBV 1XZEA 4JP8A 1O4VA 3HL4A 4KAXA 1UBCA 1KZ6A 3FGZA 1AHPA 5F77A 3FLEA 1N1MA 4XARA 2YJ5A 1Z5PA 1NURA 2FW0A 2H9AA 3WQQA 4YIKA 5JPCA 1Y3BE 1I2BA 1XLTA 1DAKA 3EQ7A 4H1UA 3NVDA 3GWKC 3VZBA 1U3GA 2AJTA 2AW9A 2C58A 4OYLA 3RUHA 5LWHA 5CN0A 1HETA 1MUUA 2YMLA 4TYPA 4HP8A 4ABYA 1MMFB 1FA9A 2J30A 4PHZA 2PZBA 2QI9F 3FKJA 4P4GA 5FUQA 3KG2A 5IAAA 1L4MA 1NKSA 2QVLA 2BL4A 4RA6B 3GLFE 1IM5A 5AVQA 3ZW8A 4P81A 3A3OA 5FTWA 5CFPA 5LZ9A 2ZB2A 4HEA1 1OLXB 1I4LD 2HH9A 1VL0A 1T2VA 1WDMA 1YC5A 2AJDA 2WSIA 2XAAA 4LJKA 1ZVMA 3Q10A 4PO9A 1DNPA 1ZI9A 3GHYA 4L0CA 4Z54A 2DPXA 3A04A 1SK9A 3QQPA 4BWAA 1NBEA 2NO4A 2RCVA 2ZK7A 3FJYA 4P98A 5AHXA 1OI3A 3H75A 5FFNA 1RI1A 3TDMA 4NFHA 2BAGA 4FM1A 5TQ0A 1YJ8A 1XMQB 4ZHQF 1DKMA 1XAGA 5CFZA 4N9WA 1UH5A 4YR9A 4D41A 3X43A 3UEOA 2ISCA 3GLKA 1IWOA 1G0NA 1WM1A 3AG4B 2ZI4A 4B3CA 1ZGZA 1QJ4A 1KY3A 1JQAA 1T2NA 1U1IA 4DCUA 1E92A 1SXGA 4HLQB 2LQTA 4Q7JB 2PX3A 3TL2A 1WP4A 1YBFA 3QUAA 4UDOA 4IDNA 3UUWA 1JIQA 1EI9A 2IH1C 1EVQA 1C4XA 1IXBA 2LPMA 1L5KA 3CWQA 3AHIA 4NBTA 3CC4V 4JNKA 3CO5A 1R8XA 4K0KB 1YR2A 3OFNG 1QDLB 2JFZA 4QBKA 1KE2A 1S3GA 4TQAA 4K8XA 3T4EA 3U26A 1VF6A 1WOMA 1ZK1A 3ZMUA 1GADO 1CP2A 2DQ4A 3IJRA 3RT3C 4F8EA 5BVGA 2P4EA 1GPKA 1NSFA 4J0DA 5K8UA 2VUIB 3LZ6A 5GINE 1II8A 1L7AA 1BHQ1 3K1YA 1I32A 1JSZA 1QG6A 3PDIA 3DA8A 4QNNA 5TGTA 4PN3A 3PUIA 1GM7A 4NXMO 2LUOA 2X41A 2JFUA 2VZ9A 3SM3A 1B76A 3C8ZA 4A23A 1RSOA 1RS0A 4II3A 4NU6A 4KYIB 3EUFA 3MC1A 2WLSA 1XEWY 1P44A 5KYWA 3AIIA 3GGDA 4A82A 4YFYA 4Z8YA 2TMGA 4LFAB 2QHXA 2JLCA 1GFSA 2QN1A 3TDKA 1Z8HA 3K0AA 3PJDA 3ZXYA 1JX6A 2XCOA 4HQRA 3N2IA 1PFYA 3HP4A 3L0SA 3LOPA 3ZEAA 5LU9A 1I1OA 1O7JA 2MINB 3ES9A 1WZEA 2WTBA 4RFSB 4MR9A 3S8EA 1E2HA 2RAUA 3QXGA 4KK4A 4F86A 4H1VA 1NRIA 1GPUA 1DQSA 1P62B 2PA0A 3UKOA 3VHLB 2QL7A 1UBOS 2DR3A 4OH1A 3L6CA 1G3UA 2HDOA 2JVIA 4P7JA 4HFJA 4YRPA 2NZWA 2JI8A 3FYTA 3I1FA 4ZEMA 2JDID 3D6TB 1FBNA 2XUKA 4GQAA 5IHPA 5CB4B 3NWPA 1WWKA 2WP0A 3ZK7A 2ZUWA 1S4MA 4D6YA 1ID1A 2JFPA 1CUFA 3TBKA 4BRUA 3CCVV 4K8RB 1O97C 4K7JA 1OLUB 2Y48A 3KWLA 3PDHA 1QZUA 1W2BU 1F4LA 2W2KB 2Y3IA 3UQZA 1EGHA 3C7TA 5DXAA 5G0SA 1SCJA 2CW5A 1K6MA 2OXTA 3R0XA 4NJMA 4HQLA 2AWOA 4L02A 4R1TA 1N2OA 3OC0A 3KYDA 4J0JA 1L7RA 1QIKA 4M0PA 2OYSA 4MW1A 4IEIA 4IOMA 4D4HA 5H5NA 1JLMA 1EQUA 1GTJ1 4EOGA 3V9PA 5KHGA 4J3FA 4IZ6A 3VOTA 4DDVA 1NUUA 3SYQA 1QV7A 1DJLA 2B1QA 3D3JA 2R85A 3PQ4A 1Z0DA 2H2WA 3Q3EA 4HSGA 4BE9A 5IJ9B 3HFRA 2WWTA 3SBOA 4Q20A 2NNWB 3M4JA 3V3TA 5CT6A 2JEXA 1NKDA 5M34A 4MVMA 1YKGA 4JVNA 1K4MA 1J8MF 2CDAA 1X8LA 2X42A 4P7BA 2J5RA 3KKKA 4QEDA 2A67A 4WFFA 1UEIA 4YEDA 4XM0A 1Z88A 1TEZA 2RGWA 3D1LA 4CKZA 2G17A 1BVUA 4CRWB 3KB8A 5AVKA 1SJ9A 1JKIA 3C3TA 1ESMA 2FYTA 4WK6A 1K8AW 3C5CA 3Q3VA 2XE7A 1MO3A 2FSHA 3LGAA 3CZMA 2IFTA 1BW9B 1EAYA 4EKGA 1XB2A 1KH2A 4JZ2A 3BMQA 5THQA 3X3HA 5GONA 4NECA 4PE5B 2AG6A 1PQWA 4IMIB 4U4AA 2D7DA 5K0FA 4R6ZA 1XTUA 1XKQA 2BEKA 4JP1A 1O0CA 3RSSA 1V1RB 4G97A 5ERXA 3WBJA 4KQHA 3L8EA 4XCQA 2YW2A 5KYXA 4Q4JA 4H6WA 3T1YO 4U3JB 4BW9A 3R3SA 4RDCA 3SR4A 3V80A 3WK6A 1U0BB 3DV0A 1O6FA 3FDFA 2ZS9A 3AU8A 2X7RB 5K1PA 5CA1A 2VP4A 2Y4OA 4FYYA 2C0PA 3C6ZA 3CCUV 3F3YA 4NEHB 2WQ6A 1E2FA 5IT9N 2VAPA 3AFIA 1S0VA 4OSPA 5DNDA 1M7GA 4DQKA 3GXBA 3WI7A 4OQZA 1IL0A 5K03A 2FZVA 4GNRA 3OQOA 4MUAA 2KSQA 5KNBH 1J49A 3ZGVA 3E22B 1BXGB 4W8OA 5K8LA 4YRAA 1U2PA 1ZLXA 1J8YF 1YD7A 1HNWO 1TJYA 3K8OE 4DIMA 5BW5A 4ZJYA 1US8B 3AL2A 3QU7A 2X6AA 3GG9A 1S96A 4MDHA 5KX5F 2DW4A 1BA2A 1UKZA 2FWNA 1Q86W 1HDXA 4WFGA 2CJYA 2H48A 1XN1A 3A3KA 3ZLTA 3C15C 4NH0A 3QWHA 4CN9A 1Y0BA 2V65A 4QAQA 3AEQB 1L8AA 3QYAA 4UNQA 4RSMA 2R44A 4X64O 3MWJA 3HJBA 1WA8A 2D2IA 1AUVA 1U8XX 1KYXA 5L3GA 3FVRA 1PF7E 4A26A 2HV8A 4B3XA 3H1PA 1Y4UA 5AHRA 5F76A 3T34A 4KSCA 8ABPA 1XZBA 3H9BA 3ZGNA 3PHCA 1GSAA 3JQAB 3CLTC 1UFQA 2GSWA 2J5BA 3SCZA 4B44A 2Q68A 2W0FC 1YACA 2Q9UA 3ZS8C 1L5HB 1XQVA 2RK4A 3FOAA 3NOXA 4IQ0A 5BW6B 3ASNB 3CEHA 1DBSA 1Q1NA 1RPJA 1RQPA 3HB0A 2EILC 3AUXA 1XAIA 4IF6A 4WTOA 1GAXA 1QVZA 4MEAA 4W99A 1JG3A 4UV8A 1TEXA 3EWIA 3CVVA 3DMTC 3H4MA 5FBLB 2ZIFA 3B6ZA 5LOVF 4PTZA 2ZWVA 4YT8A 2ZYRA 3SU8A 4F4UA 1LBSA 3E05A 4MB2A 1TMYA 4ND6A 2Q6LA 4PSDA 1NWHA 4HX9A 4KIGA 3WWCA 2Z6UA 1CUSA 2A59A 2YI9A 3A8TA 4A5SA 2VJMA 4BXOB 4MW8A 3IA2A 4DV3O 2TMYA 5CT5A 1KR2A 1AH2A 2Z0MA 1MFZA 3PHJA 3H8VA 1Z8FA 3FWYA 3J81k 1OBOA 4GPD1 4PAGA 3RROA 2BGWA 4JZYA 2WMOB 5FB3A 1P18A 1TJ4A 2H8KA 3E86A 3AYXB 3EXFA 3RF7A 4ZZ3A 2OXCA 1DVRA 3FPAA 1V2HE 1SKVA 3KFXA 4LWPA 4KBYA 3QTTA 1X7ZB 4RZSA 3PUHA 4B4VA 1RMQA 4QBGB 4EW6A 4HRAA 4RDXA 3N2KA 3B5JA 2CF6A 3KWJA 3VU8A 3ZDZB 2FW8A 3NIFB 2ZIUB 2UZAA 3FCAA 4LYDA 1Q17A 4O5AA 3SJUA 1JHQA 3URMA 4BWGA 2CLKB 3KKQA 1TQ6A 2Y1XA 1LV7A 1RT9A 3ELBA 4ND2A 5FTKA 2RHGB 3NMUF 3UOWA 3LYAA 4DJAA 4YV0A 3CM0A 2GYWA 1R5NA 2MSNA 2C4WA 2VHJA 2ZYDA 3FNQA 4CMIA 1E96A 5B12A 5I7FA 3LSTA 4V0QA 2DXIA 4OYHA 1QO7A 1JAHA 4F5YA 1MW8X 1SCIA 1TF2A 1TDJA 4LTNA 1ZCAA 4GZ5A 2HW8A 1MAAA 1DC5A 2VP3A 3AR5A 3Q5EA 4M9SA 5T57A 2A33A 4EA6A 2BTEA 4BP3A 4IX9A 3QEMA 4GCZA 3BSWA 5LQNA 2HQSA 1P1RA 2BUBA 2DULA 2XCIA 5AKGA 3SJAA 3LD9A 4YROA 1H8EG 2D1YA 3Q7RA 4H1HA 1NJ8A 4MJXA 4RH3A 4EATA 2FGJA 3F3KA 4OP3A 4E7PA 1LUAA 3MB8A 1YOVB 3C41J 3I6YA 1TECE 1UOEA 1D2EA 4JLMA 3PK0A 4TS3A 2Z2XA 4FGLA 4EJ6A 1VCHA 1QP4A 5IG2A 1Y6XA 2NIPA 3QKRB 4TKUB 3OZSA 3PF8A 5EIFA 4ZDJA 2NPIA 4IDOA 4NBUA 1QH9A 3UB4A 1RDFA 4X24A 4EPRA 1QRDA 3F4LA 4DR7B 2HRCA 1TD1A 2XUHA 3A32A 4A92A 3D2LA 4IOJA 2OBLA 5ITSA 4G4GA 4NJEB 2BLNA 3UKDA 5I3CA 3P2KA 4C3OB 2HCTA 3ROGA 1GUDA 2FGKA 2GNPA 2OO5C 1GM8A 2ECFA 2AI2A 3B2QA 4D25A 1AQUA 2VHVA 2YICA 1PZMA 3OPQA 1U9IC 3TXYA 1ZZGA 2EYUA 3RG8A 2LBPA 5KPDA 4C7UA 4H33A 1N36B 1GNTA 3A2MA 4QOSA 2IC5A 5HKKA 3U31A 3AT1A 5IJXA 3VTFA 2Q0AA 3DLIA 4KFTA 4CE6A 1K8ZB 1DAMA 1KPHA 1YNOA 4OQDA 4HVCA 3PTAA 4R9UC 4L08A 2BMDA 1A4UA 2Z95A 1XQ1A 1WJZA 3LDEA 3N2LA 4G5HA 3HYTA 3KYCA 5C35A 3ML0A 1L8OA 2AC2A 2HZ7A 2VDPB 5HPYB 4CVNA 1XXLA 3SYPA 3APQA 4OQNA 1RCUA 4P4UA 4BO3A 4EUEA 4O63O 4CLRB 1GN2A 1Q77A 4AN4A 1ZQ9A 1AO0A 3KPYA 2VK1A 3CT4A 1NU1H 1CZKA 3KQOA 3IB3A 4YJ3F 4C2AA 1EFRA 3DZHA 4ESHA 4H6PA 4Y6QA 1K3UB 4JC0A 1YA6A 2EHDA 3K94A 2R6FA 4TZ6A 1G2PA 4IHQA 4PGGA 4DCSA 2R5WA 2VSQA 5BUZA 5G0WA 1EUCB 3PVSA 3H8JA 4M1EA 1P9LA 2H57A 3FZNA 4Q24A 5CEEA 1I2MA 1J1UA 1WHTA 4PTLA 5IY5C 3KT8A 5B4VA 3BERA 4S05A 4GI3A 1R6AA 4M9QA 2IVZA 4QHTA 5I7AA 1Z5OA 6NULA 4MI9A 3IALA 5A7FA 2C77A 1TLFA 4ZAGA 1LPPA 4B3RO 1PIWA 4EW2A 1IVNA 1KY5A 1Y8QB 1MENA 1Q3KA 3EWAA 3OOHA 4QLAA 1QLEC 2OYQA 1JLLB 2C83A 2F17A 3UJBA 4CFZA 3F4BA 1T35A 1DC8A 3AF0A 5D8DA 3S8MA 4RX1A 3HJAA 3T0IA 1U0JA 3L1VA 4N76A 3X2QB 1B15A 3L8YA 4X62B 3JD4A 4CT4B 1R4MA 2GZHA 5LMZA 5LZ2A 1MAVA 2PK3A 4P4TA 5J43A 3U16A 2X0IA 1L4FA 3VR2D 2B8NA 3NTXA 3CLUC 1YGPA 3CPJB 2HADA 4MQ5A 4FDTA 3I73A 5C5IA 3SF8A 1AE1A 4R7GA 4AZTA 1R18A 2FH5B 1ZGJA 3GCGA 1WY5A 3QPUA 3VGJA 4ZAFA 1VYHA 2DPLA 5GTDA 2E21A 3LCVB 2X3YA 5G4KB 1SXJA 3L8CA 1VKZA 1ULZA 3B6EA 2ZUFA 1U3CA 2JW5A 1Y1RA 2R96A 3K9CA 5EJGA 4FLWA 1RXYA 4Q3BA 1BU5A 1SUPA 1NJFA 1V7ZA 4JC4A 2OZLB 4OLJA 4DQDA 3ROFA 4I50B 2G63A 4GKJO 2L42A 3V32A 2ZUCA 5EGNA 3P27A 2P3QA 3PXEA 3U1VA 2GBPA 3E5RA 3A9SA 5DSTA 3ZHQA 2J08A 3AG5A 3NOQA 4YMIA 2JJYA 4MV7A 2IDZA 2OT5A 4DLAA 4EF6A 1VF6C 4LTMA 2QT9A 5D85A 5B1YA 5JSZB 2XUQA 2AG8A 4HUQB 4Y6LA 4BFZA 1SZDA 2G5CA 5FWYB 5AVXA 4A0HA 4JBYA 1FFCA 2HUPA 2BMVA 3KU4A 2ZTVA 4C04A 2A1TR 5JWPA 3T54A 5KSWB 1FFTB 1VQPV 1O08A 4H60A 4OHPA 3PBKA 3QIVA 1E89A 1E1CA 2Q27A 5FEUA 1IIBA 2AOTB 2ZPUA 4TXHA 2QTMA 5CBFA 1HSZA 2JLQA 4B3RB 1CE8B 2DUNA 1UBTS 2QQFA 2WJZB 4HF7A 1Z0FA 3V7WA 4L85A 4HGPA 5KWIA 1E1RG 2D13A 4D4KA 2YWXA 2GBLC 2LNDA 1L7EA 3GJQA 4QXMA