2LW7A

Nmr solution structure of human hisrs splice variant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
170
structure length
170
Chain Sequence
AERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKALEEKIRTTETQVLVASAQKKLLEERLKLVSELQDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREEVDVRREDLVEEIKRRTGQPLSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine--tRNA ligase, cytoplasmic
publication title NMR solution structure of human HisRS splice variant
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 36
structure length 170
sequence length 170
ec nomenclature ec 6.1.1.21: Histidine--tRNA ligase.
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
A PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2lw7A01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 2lw7A02
1ADYA 2VQFO 1DK1A 4K86A 5LMNO 4JI5O 2I4OA 3T1YO 1ADJA 1EVLA 4YRGA 2I4NA 4LFBO 2HHHO 3OTOO 4RDXA 4JI0O 4NCXA 4YRPA 1G1XB 1KOGA 1A32A 1NJ5A 4YPFA 3SDLA 4JYAO 2ZT6A 2Q5HA 4AQYO 3A31A 3IKLA 4NXMO 1NYRA 4X65O 5BR8O 2UXCO 1AB3A 4HVCA 5C53B 2UUAO 4ZTUB 4YRRA 4LF8O 4X62O 4DR3O 4LFAO 1N32O 3IKMB 1NJ1A 4EO4A 2JRIA 4DV7O 5A2QN 1H4SA 4YRLA 4YRQA 4B3RO 2UUCO 1G5HA 4JI3O 2UUBO 4DR1O 4YRSA 1XNQO 2Q5IA 4KR2A 3JAMN 3J80N 3R66A 2UU9O 1FYFA 2I4MA 3J7AU 1HNWO 4TTVA 1D2DA 4HWTA 2ZM6O 4KR3A 1FKAO 2ZT5A 1WU7A 1HNXO 2DJVA 5IT9N 2J3MA 3M8AA 1N36O 2J3LA 4LF5O 4DR2O 2UXDO 4DV3O 3A32A 5H5NA 4OPHA 2LW7A 4GKKO 4KQEA 4LFCO 5LL6Y 3J81N 5FLXN 4JI6O 4JI1O 1XMOO 4G84A 3O65A 4JV5O 2N74A 4YRTA 4HWSA 4TWAA 4DV6O 1N33O 2ZKOA 3IALA 2E5LO 5LMUO 1F7YA 1IBMO 2F4VO 5BY1A 3NETA 1V95A 4YREA 4P3NA 4LF6O 4X5OA 1H4TA 1FYJA 2G4CA 3UGQA 4P3PA 1NYQA 1J5EO 4LF9O 2I4LA 4YRKA 4WI1A 1NJ8A 1IBLO 4DV5O 4K87A 4DV2O 4HWRA 4X66O 1H4QA 4HWPA 2UXBO 1HTTA 3UGTA 3HRKA 5IWAO 4P3OA 4YP0A 2FKXA 4YYEA 4B3TO 4YRIA 1GGMA 4DR6O 1YZBA 4A5UB 4DUYO 2DOSA 1B76A 4NXNO 4B3SO 2Z0AA 4K0KO 4KHPO 4YRMA 2ZT8A 5BXZA 3HRIA 4DR4O 1R6TA 1AILA 1HR0O 4DR7O 4JI4O 1KUQA 1N34O 4OX9O 4Q15A 1X59A 4OPAA 4JI2O 1NJ2A 2PMFA 3RT3C 1XMQO 4GKJO 2ZXFA 1G5IA 2ZT7A 1NS1A 1ATIA 1I94O 4DUZO 3F5TA 4LF4O 1XNRO 1FJGO 1HC7A 4YRCA 4YDQA 4YY3O 1R1BA 4DV4O 1KMNA 1H4VB 4YROA 3UH0A 5C51B 2VQEO 2AGAA 1IBKO 4DR5O 5C52B 4DV1O 4DV0O 1HNZO 4JI7O 4JI8O 3LC0A 4ZTZB 1QF6A 4E51A 4HWOA 1XEQA 1QE0A 4YRJA 1NJ6A 4OLFA 4YRFA 4X64O 1KMMA 2PMEA 4YHHO 4G85A 4K88A 4PHCA 4YRNA 4B3MO 4LF7O 3T1HO 1EVKA 5E3IA 2EL9A
chains in the Genus database with same CATH superfamily
3UV3A 4CCWA 3VJLA 4YPOA 5KYNA 1QWOA 5K4GA 2BCCH 3SPCA 1DUVG 4G2NA 5IYBO 1NP3A 1X1CA 1UJ5A 2F00A 1EVEA 1UBSB 5F7ZA 3BD9A 3KX2A 4Z0TA 2WVJA 3LSQA 3WLQA 3CCJV 4IDPA 1IXZA 3A2MA 4R41A 4J91A 2FZ4A 3BL5A 4JFRA 3QNEA 4IH1A 3H01A 3IHLA 3T15A 1TAUA 1KEEB 3FPCA 4EDFA 3PYLA 1T9HA 3ZLTA 4KGDA 4LOKA 1TCUA 3B85A 2ZZKA 4D80A 1N7GA 3E81A 1V7PC 2VXOA 3GEPA 3PUYA 4H7IA 1MO2A 3WP0A 4NY1A 2PGXA 3BTVA 1XVUA 3KOZA 4LZOA 4V2UA 2X6QA 2WNIA 3CCMV 2RMKB 4D41A 5K0NA 1UUFA 5J2TF 3STUA 2FPOA 3WRXA 1ZJJA 3GT3A 1I7SB 3B8MA 1PFUA 3HZZA 1AK9A 4Q1CA 1YCHA 5J59A 2GYUA 3S0JA 1DK1A 2WWHA 4JASB 1JQ0A 4BWFB 4M1KA 2JKYA 3E1GA 3T5AA 3QE4A 5AW8A 4YO8A 1JG6A 1OXXK 3ZN1A 2PUCA 2HRZA 4F12A 4WZBE 2QVXX 1TJYA 4GQAA 1FYFA 5AUNB 1VXOA 3NT4A 5K4AA 1MPTA 4J7ZA 5BQXA 1Z6XA 4EPTA 1U6IA 2SKDA 2PWYA 2OB1A 5FI5A 4MW4A 4Q0MA 3AM1A 2YWFA 1GL6A 4X1OA 4BWVA 2Y6UA 4E1BA 1UBKS 5BYAA 4MR7A 1BDHA 4Q3OA 1ST3A 4ZD6A 4R8KA 4CETA 3RV4A 3OF5A 4R8LA 4BWAA 5DMXA 3PU6A 2ZSIA 5H16A 1MZVA 1URFA 4OY3A 1U0SY 4LUCA 1TUBB 1XDBA 5EWMA 1XFAA 3KYDB 3CMEV 1CDZA 2MSEB 2RHLA 4UCRA 1URPA 1CJVC 4ZAGA 3WBJA 4DCOA 1K0FA 1IXMA 3K1YA 3BRWD 4U5QA 2VP2A 1MOFA 1QGOA 3L7BA 3ZGVA 3IVCA 4HQKA 3WBBA 1N2HA 4HRVA 4YJ2F 3BCCH 1QQ5A 1LBTA 4XDZA 4TN1A 4RFSB 4DMGA 1FRFS 2W6ID 2PWPA 2FB5A 2ID9A 4YAKA 4NAVA 2X2EA 1N36O 2QSZA 5KYYA 2PT6A 3EWNA 3QTCA 5F3DA 4PC3A 3K58A 3EXIA 4KDCA 3CMMA 1VB3A 3ZDCA 2DWQA 1GADO 1XDSA 3VYWA 4ZOBA 3RIXA 2OHGA 2B1GA 3I52A 2PZSA 3HZHA 1H6AA 3ICVA 3AY3A 5KS2A 3S4YA 3EULA 1CDDA 4IHJA 1B76A 1P7WA 4NJEA 3S99A 3DEFA 1CUVA 3DZGA 2BE7A 4F60A 3MPUA 5E7IA 3RWOA 3FAVB 1E63A 2UZ3A 3UUEA 2VSFA 2ISSD 2JI7A 3L6BA 3L0ZA 3NAMA 5HFJA 5HGXA 1GKYA 1Y63A 4UVHA 5A5VA 4L87A 4MP3A 2BYTA 3RADC 3W5AA 3ZKWB 3FYUC 1NW7A 5M5BA 4PQFA 1XCGB 5EMHA 1QO9A 3EPJA 5J4VA 1K86A 4QPJC 4LHVA 2P4KA 1TO6A 4IEEA 1RM5A 1EVZA 3L8EA 3FNHA 2RDMA 4EGJA 2GHRA 3DVLA 3L82B 5FFMA 3FNRA 2DJIA 3FPBA 4ND6A 4E5KA 2ILVA 2O8VA 1N5LA 1LSJA 3M1LA 2ZRDA 1P72A 3HN7A 4OGQB 4F3YA 4EKDA 3E23A 5G0WA 2A9QA 2OCIA 3KD2A 3V4SA 3UK2A 4ZOQI 1BU5A 3I42A 4FZJA 3LGXA 4TX1A 1ISGA 4ZKDA 4EL0A 1HEYA 1IZ7A 5EZYA 5K20A 3GOQA 4BFZA 5KYUB 2B0JA 2RK3A 4J4BA 2OCDA 3RKSA 2Y0BA 3GFOA 1RHRA 1XCPA 4D9KA 1RI4A 3FZGA 3FDJA 4UNPA 4WOPA 3KLBA 5ALHA 4G8CA 4JJ4A 1PDWA 4BB5A 2W6PA 4FIPC 3DKKA 2D6FA 2KS6A 4J0GA 2AG6A 4HZUA 3CLKA 1P81A 4IO0A 2WLLA 2ZT5A 3RK4A 3VO1A 1Z82A 2JL1A 4LDZA 4J7JA 4MIYA 3L8YA 2EFYA 3P4UA 3W1VA 4EGAA 3L8CA 4G84A 5KOYA 2Q0AA 4A5SA 1AN9A 3PRJA 1Z8DA 3CUVA 2QTBA 4U9UA 2EILC 3C6YA 1XZBA 2E74B 1L9XA 1GL3A 1J1UA 3Q2IA 2F8MA 1O97D 1ZM9A 4KDRA 1NQAO 1DS6A 5LQDA 4WESA 3KJGA 2QRZA 3CZ4A 2XZOA 2OZLB 2XZDA 4RD4A 3CSXA 4MO2A 1EN5A 4U5XA 4JI0B 5CH8A 1P39A 2NQTA 4F9TA 4ENWA 1O4WA 1YMVA 3HL0A 13PKA 3R1IA 2C1ZA 1YONA 3F9RA 2IYOA 4KIWA 1NVMB 2VBCA 3NHBA 3VQXA 5K3EA 4UUPA 4BMZA 2XF2A 4HPWA 4IL6Z 2WUGA 3G5UA 3QFFA 2VYVA 3A70A 5JATA 2WYWA 3TQIA 5IKPA 3PWSA 2ZWVA 3KOUA 3REOA 1U9YA 3G2QA 3I1IA 1JIXA 3UMVA 4FFSA 1SQPH 1XTSA 2H1LA 4CF3A 3LLCA 1IUOA 1F48A 5LXTF 1A96A 4Y0NA 1PW5A 1A1VA 3HYTA 2HBQA 2UVPA 1K5QA 4BFTA 3ZRWB 1RIFA 3BFPA 1TEZA 4REMA 4CIVA 3L72H 3SBXA 3H18A 3Q4HB 5I45A 1NL3A 1CX9B 1J8VA 2X0LA 2VQ3A 2H0RA 3GHHA 2I7DA 1RAGA 1VHJA 1XEWY 1UJWB 1F1JA 4M1WA 2WIKA 4JUFA 4WFIA 5HQ3B 5TQ0B 1D5CA 4GPIB 3UA4A 3JASB 4BO8A 3BEOA 2GKSA 3BJIC 3QZUA 1VQ1A 1YHYA 5KWJA 3TLGB 5KYTA 4UCUA 4EVIA 1I2ZA 1VL8A 5B12A 4PLYA 4HAWA 2PT7A 1YR8A 4C6TB 5IU6A 3PICA 4Z3KA 3TTUA 5REQA 4BUJA 1RM4A 3NIGB 3L06A 1SIOA 2AKYA 1OTHA 1TKBA 5DBHX 2GWHA 3ZY2A 4GBGA 1XNRO 1RJEA 3ABSB 1FX1A 5AW6A 1XVTA 4GAEA 2VF7A 1FB5A 4CT4B 4BN4A 1FQKA 3AWIA 2E1RA 1IY9A 3VX3A 3V4LA 3A7DA 1A32A 1THZA 5KAMA 1MOZA 5BSWA 3H5RA 1ECPA 4JF3A 4MCJA 2YHAA 4CI0B 1Q16A 1C7ZA 4XIIA 5CA0B 3ORRA 4R1OA 1IIRA 1E1RG 2GLTA 2A0XA 3H13A 2OBNA 4WCFB 4QG7A 4LOLA 2MSNA 5D00A 4MUIA 4KQXA 1RCFA 2J5XA 2GD1O 1MC5A 8OHMA 1SVNA 5DHQA 1UT6A 4FHFA 1GZUA 2M32A 2GT1A 1GG8A 2WDZA 2AX3A 2GCEA 4I6GA 5AKLA 3G9TA 2YMMA 1NT2B 1N34O 4I1PA 1RMTA 3T9FA 1YVEI 2R8PA 3O9MA 4PLWA 1VJCA 1G9SA 1BMFG 1TQHA 2QX8A 3WX0A 4LDRA 4DMRA 1UBCA 2A9RA 3DV0A 3D2BA 4JS0A 1QAOA 1GO3F 3QJGA 4A82A 2PUVA 1XP5A 5BWCA 3FROA 3CSUA 2R7MA 3BD6A 3DL0A 1N3IA 2EW2A 5JXJA 4BMDA 3PFIA 4RD3A 1ZX3A 4JI6B 1VF5B 3T94A 4KR6A 5FL7G 5DN6A 3QO7A 5AVWA 1DTWA 1LLUA 3AEKB 4PHGA 4RKEA 1A2BA 5IG2A 2H1OA 2AW9A 1VHLA 4IBOA 2O7NA 1O96B 1ENZA 4GM0A 5JBIA 2MINB 1WS6A 1GTOA 5GWXA 2IX3A 2JRLA 2WTAA 3LPNA 6ADHA 4TQDA 4HRYA 2Z0AA 2ZETA 1LPMA 1XRPA 4E13A 4Q15A 1U2EA 1NVGA 5B30A 2HN9A 2WLIB 3NPAA 3CUSA 2NSDA 1FP2A 4QBHA 2Q27A 1YRQA 1KKLA 2C9YA 1B0ZA 1W36C 5EXSA 4H7EA 1TPZA 3RIGA 1PJAA 4L9WA 5K3FB 4ZHQB 8GPBA 4AZSA 3C7TA 2AMFA 4R2HA 4DVGA 1XF1A 3OE7G 1K4CC 4DIDA 4JBHA 2VKTA 3I55V 3HVIA 3IDAA 1VPWA 2PAFA 1QF9A 1KYTA 4QAQA 1TK2A 2OIEA 3UPUA 2ST1A 4GMFA 1REQA 2FX2A 1W0KD 4P53A 5HNKA 1SUDA 3GNLA 3MRXA 2PUHA 3WP1B 2DVMA 4XD2A 3WKCA 4E31A 3CEIA 4BIIA 3QTLA 3OEEG 1CUIA 2EIMB 2H9IA 3F7OA 4UULA 4JJ7A 2XYRA 2NUBA 1WP9A 1MB9A 1OXTA 3G8BA 4M60A 4J8PA 5L4SA 2V6GA 1U99A 1V11A 3X1MA 5AH0A 3L07A 1BE6A 4UU0A 4Y2PA 5HJEA 5J23A 1E62A 1E5XA 2OCKA 3VKUA 3HXQA 3LCUA 1QZTA 4XDJA 4IEFB 3O92A 2ZDQA 2ZIAA 1UMBA 3ZBUA 4W5WA 3AH8A 1S5HC 1VE7A 3IP5A 5E7MA 4KACA 2P9HA 4RPKA 2BEWA 1ZY2A 4UVGA 2QW1A 3IB3A 1QRUA 5IW8A 2ODPA 3UZUA 3TLXA 4BX2A 4AKIA 2OBMA 4XIFA 2H7XA 1W94A 2WVHA 1YD7A 5A3QA 1MRNA 3IDQA 4GP6A 2QLBA 2XCSB 4O4IB 4GXQA 1QIIA 2X5OA 4BVAA 4E2WA 3OE4A 3TW8B 2W2LD 2FWNA 4NG4A 5CCXA 1G21E 5FBHA 4J1TA 3D0QA 4OI0A 1FCJA 3B36A 3EGDB 2Q9AA 4OJTA 5ELMA 3DG9A 4PSVA 3KV1A 4YMIA 5L40A 1VYVA 4LMRA 4MUBA 1V3UA 1HDGO 1XL0A 3L02A 3EDOA 4WF9V 4QE7A 2JAOA 1DPFA 1M83A 1I6LA 1L7MA 2WYIA 1R4MB 5B3JC 4UTNA 3EOAI 2UYHA 1A77A 1MIOB 3QXGA 4BQPA 4H16A 4XX0A 4XFKA 4D99A 2R85A 2RGGA 4ER3A 2JRIA 1RPTA 3WGOA 1NATA 2V8OA 3VYVA 5FFNA 3BZBA 1ECFA 4DDTA 3MAAC 2O2DA 3WY9A 2PEYA 3NHAA 1JWBB 3L8MA 3GA0A 2WA3A 1IG3A 1H9BA 4KO8A 4TLLB 3RVNA 3DBHB 5IT4A 4A6PA 3EYAA 2I8AA 4WZZA 3GFFA 1U63A 1ZCAA 3DL4A 4QGAA 3T52A 4B3TB 5JH7A 4EZIA 4FGWA 1QYVA 4I9HA 1KO8A 1WXHA 4KJXA 4I1IA 2C7VA 2JFQA 5KX5B 3C6KA 3HNOA 4GU5A 3Q8MA 1WA8B 3KKYA 5I3CA 3IESA 1NN5A 1K75A 4LHZA 5A4KA 1O6CA 4MV7A 4O4JF 2D3OW 1RFGE 2INGX 2WMDA 3C16C 5AW2A 1UKBA 1OI2A 4UEJA 4BIMA 3G2LA 4KOAA 5EQJB 1BE1A 2YVAA 1UEJA 1JCHA 3VQYA 3AR8A 5CH3A 1L5GB 3PPVA 4DEVA 3B6ZA 3PTAA 1YVRA 4QDJA 1PT5A 1IWOA 4XDKA 2GEVA 1SG9A 1VHDA 3HKCB 2ZM6O 2AEEA 5B1DA 2DG2A 4EP1A 1R9JA 5J63A 3AGQA 3NNDA 2XUHA 1IG0A 1LPAB 2OZKA 3RWRD 1SVKA 2Y1GA 3TUZC 4X5OA 1QLEC 1G17A 2X42A 3O8NA 2IEGA 3NDPA 5I9LA 1BGXT 4E3WA 3C3AA 4GKBA 1XZLA 3N8HA 2V45A 1CZKA 1Z0UA 4MNTA 5FV7A 1VL2A 2FOIA 1HLFA 2PX2A 2EAUA 4ZCTA 1I7QB 4DDVA 4YUYA 4TZTA 5G02A 4XM2A 1PNKA 1IL0A 3IP7A 3EARA 1Q1NA 1QTIA 5ALMA 5K0SA 1PDOA 5FORA 1YE5A 1Z28A 1GARA 5D3KA 1G8SA 1Z3CA 3QMVA 4ZN6A 1UFVA 2J0EA 4DLUA 2R65A 1EDEA 5JCPA 1GZ4A 1P0QA 2XRFA 1XREA 2XRYA 5KNCA 2RNBA 4GYYA 2IXAA 4PYNA 3SFZA 5DOZA 2HGSA 3K70D 4KBFA 5B66Z 3S68A 2H7YA 1S3GA 5B1SA 4D98A 2YWEA 1IMOA 1AKWA 4CH4A 4CT0A 1PZEA 4TKUA 3SC3A 5ES4B 3BXFA 4YJFB 1L0BA 4M0CA 3FNEA 2QN6A 4GPEA 4AUEA 3UHFA 1YBFA 2Z98A 2CL6X 1YKGA 4RPCA 2WD7B 3SC6A 1Q19A 2H9AA 5CBHA 3OQJA 3L75H 2ZJ5A 3U48A 4L4SA 3CPSA 4FONA 3W4JA 1UDWA 1XTJA 4H60A 4ARCA 3ZZ1A 5JAMA 4K26A 1JG2A 1EJ0A 1S4MA 2HDNB 2YI9A 1WV1A 3H42B 4EAQA 5TPWA 3KKMA 2C7PA 3KHUA 3WIVA 2UU9B 4ZVMA 3M6VA 3ZK9A 2RJOA 2E89A 1XD2B 1ZLXA 1LSSA 4AUNA 1KAEA 3J80N 4U8GA 3UEOA 3HBFA 1P3JA 5HZGA 1LDMA 1H2BA 3L0OA 4RGYA 3N3AC 3PCRB 2I7CA 2G82A 2C78A 4TTTS 5I4KA 1SVIA 2O8DA 1DAGA 1E1KA 3VXKA 4Q9KA 5CD1A 3JALA 1X14A 5H82A 3MGBA 4P4TA 4JELA 5A9SA 1SKQA 1UBOS 4CKCB 3I1FA 3AHHA 2PQ6A 1M76A 1T4GA 4KO3S 2OM2A 4ZYUA 4HKTA 2XSZD 3NO4A 2OVBA 3CVYA 2OBXA 4UM5A 4NRDA 1BZYA 5JMPA 3U44B 1TK9A 4IQ0A 3RS0A 3OX1A 2O2HA 4BMVA 4UDXX 4RHTA 2AQ8A 2H1SA 4OJKA 3ZS9A 2ILTA 4WKGA 2WJAA 3QKSA 3U4HA 3P9NA 2TMKA 1WQ1R 3PWZA 4EY3A 3CNOA 5JSHA 3IAEA 2J6CA 3O82A 2RHDA 6REQB 1OBFO 1TEXA 1Q22A 4DA8A 5L3RA 1OCCB 5TARA 4KQGA 2PL1A 4BO1A 5B2EA 2ETVA 3K04A 1AVMA 1ZESA 4UPEA 2VRWA 3BE5A 4MWOA 3JSNA 1PG0A 2OC9A 1C9KA 3G2MA 4RWZA 3BMCA 1XKTA 3G02A 1O6GA 4DUYO 2ZUTA 4N1AA 1JKMA 4YMTA 2Q69A 2FW1A 3FZYA 1EXVA 1JSZA 3SX0A 4ACBA 4WKBA 1OSNA 1J8QA 3FTFA 1JFTA 2F17A 2XYQA 1T6BY 4ZPJA 2OUIA 2O1SA 3OE5A 4X3PA 4NESA 5CPBA 3VGPA 5JYEA 1W34A 3R0ZA 3GJSA 3SHWA 1VLJA 2WKRA 1ZZGA 3P2IA 1Y76B 3ZIAD 2AN9A 3H3JA 4EFBA 5HM6A 3H3FA 3EDCA 4YRLA 4PZEA 1PV4A 3CZPA 1G5QA 3KFXA 3LT1A 5KNLA 1DRUA 1ZUIA 4EPXA 1M8PA 1WU8A 4JLAA 1KB9F 3KHKA 2DQYA 1E3LA 3P0HA 1Q5PA 1TYBE 1YSCA 4HFNA 2EFEB 4CCSA 3N2GB 2VBGA 1LPPA 4RD2A 2P0EA 4PR0A 3O4JA 1JH8A 2JLYA 3FNFA 4XGQA 1IXSB 1B8NA 3G1WA 2DQZA 4MS1A 4FD2A 1VPVA 5DM6V 1EFUA 2F67A 2VT6A 1OCCC 3ZNOA 3PLNA 1F5NA 3RVBA 3AMVA 3R8CA 3O9OA 1L5SA 5AWFC 3BCSA 3TDMA 1IZZA 5G1NA 1I0HA 1XCLA 2P9FA 4FSDA 5CB4F 5GIOE 2AOTA 5GONF 4B4VA 1FVHA 4L28A 3CHXA 3ELUA 1FS5A 4M21A 5EZQA 1YRHA 5G2OA 3UO8B 1HT0A 2O57A 3ZDAA 2B4KA 4MRRA 1E0KA 4Q02A 1S6YA 3VHRA 5IZ4A 5JWRA 2XAAA 1TTHA 1ZVKA 2QV0A 1Q7RA 1PNOA 3SYLA 3E0QA 3PENA 1YZKA 3MWJA 3CZ9A 4PLTA 2H7VA 2PSSA 1JZTA 4F1KA 2HU2A 3K5NA 3DVAB 3V4OA 4CKEA 4ZAZA 4R1PA 3KELA 1VGQA 3LV8A 3ZKAA 3OJEA 4OMDA 1FDWA 5CFMA 2EFCB 1RP1A 4A03A 2X86A 2WPNA 4OOEA 4LJ4A 1C1XB 1RRGA 1PFWA 4KSYA 1DEOA 5FWXA 2MMGA 2RGAA 5K7SA 3NTVA 2QTWB 4RY8A 1IOZA 3SXUA 2PZJA 5MGBA 1NR5A 4EG7A 4LGCA 2CXRA 3SWWA 4N03A 4H3HB 1RQ7A 5CX1B 2PKCA 4Q1FA 2WI8A 3JAMA 1A5AB 2EHDA 2WD9A 4G4JA 1KDOA 2WW8A 3HXOA 1L7QA 1U65A 3UV7A 4PE5B 1CRWG 1BMTA 2EEPA 1L5YA 5F23A 4PQEA 4Q4JA 3R0VA 3HDHA 3ZJVA 3D8HA 2QMUA 4KNYA 3BXPA 1AB5A 4IMIB 5AP9A 3P5SA 3AG4C 5JV5A 1P61B 3C5HA 5B64A 3ITEA 4BGDA 1HQYE 4R1NA 3AQIA 3CN9A 3ADCA 2NO4A 1VKHA 5BR4A 1PSZA 2QQFA 4AYXA 4NS4A 2ARHA 3IP3A 1W25A 2XXAA 1HYHA 3JAKA 2C0QA 2IHTA 2W22A 1JWLA 4HNAB 3CO5A 2GDZA 3R6DA 4FBGA 3V7NA 1Z73A 1KO7A 4KH1A 2ZJ3A 2EX3A 4DWWA 3MJHA 3X2EA 3N0XA 2ORYA 5HRAA 2O2GA 1QUFA 4TVOA 4PN3A 3F8TA 1QLHA 3I2HA 3C3TA 3DHWC 2VT7A 4CV0A 2CTRA 1Q2XA 3GCXA 1CR6A 2WUVA 1TJ3A 3VNAA 3K6KA 5AMXA 4GPTA 2F7SA 4X0EA 1DG9A 2BHSA 4K6GA 4YRZA 2XPCA 2O54A 3OEWA 2KWIA 5CDSA 4MW9A 2HYIC 4L6IA 3BCUA 4X3CA 1DC4A 4LF9B 1SRYA 1ZI6A 2G72A 2G08A 1HYGA 1NQVA 3CH6A 4M9XA 3G6EV 2C83A 1JKXA 4FZVA 2ZR8A 5G3ZA 3C7DB 3LUTB 2FPXA 4BV3A 1GQFA 4RGBA 2ZBEA 1BDMA 4WPGA 1CW2B 3BOSA 1UXJA 5AI4A 2VHYA 1PR4A 4U7GA 1DU4A 3HVRA 2QVBA 2WJZB 1YZHA 5ER9A 1XN4A 4L50A 4Z0HO 2JVIA 3IJ5A 1Y6FA 3O0TA 4FDAA 2NPIA 4CMBA 1QIFA 3HYNA 4ZQCB 4YT8A 4HWGA 4YV7A 1NVVQ 3NNSA 5LZ7A 4JOBA 1R9GA 2PWAA 1Z74A 4ND4A 3NHLA 4FX5A 2D74A 3KTOA 3DBRA 3QX7A 3M70A 1E3EA 1Y8ZA 2DQ4A 2P5YA 1QTQA 2W2NA 3FCAA 5TNXA 3IUSA 3GRRA 2AKAB 3PUIA 3VV3A 4HL6A 4G86A 2BMEA 4MVUA 4AXXA 2VJYA 1JW9B 4L2IA 4ZVOA 3F6BX 2QTOA 4S35A 1MJHA 3U61B 4OX9O 2V7VA 1M74A 1KFBB 3KYCA 4FFPA 4DV4O 3B3FA 4GC5A 4Q48A 4I3FA 2CTQA 3GVMA 3V80A 5JG7A 3CXCU 3OECA 1JKJB 4Q7LA 3VQWA 4IJVA 1JR3E 3GG9A 2WIDA 1FQOA 2C2HA 2YVQA 1U1IA 2Z6QA 4EO4A 3H04A 3OW2U 3HB0A 1GAQA 1PT7A 4AZWA 3SSNA 1G2IA 1NUUA 1ADCA 2VHUA 4MEBA 1JVSA 2VYCA 2QVGA 3E7DA 3MLAA 2QR2A 3ABRB 4Q37A 4QDTA 2HIMA 4Q1DA 5B6JA 3NEPX 2Q3LA 3RC3A 5IM5A 3PUZA 1CB7A 5I8PA 1J22A 2WQ6A 1W0KG 4X66O 2Q8VA 1EM8A 1APBA 4E33A 2O7SA 1QXSA 2A0WA 1M1YE 4II2A 1UEXC 3CLRC 3SDSA 4G5FA 2WSBA 5K8LA 2X0NA 2V7QA 1RFLA 1MUUA 5T4BA 4MYCA 3PQEA 4DLAA 3UGTA 1CRQA 4LX0A 4YV1A 3C14C 3K1ZA 3M3PA 3LYLA 3MZ0A 4MMZB 4Z53A 1OY1A 4Z3OA 3AEXA 1WY7A 1P77A 2FQYA 5E9AA 3NKVA 1NZJA 5KOIA 4BKPA 3TIIA 4XPZA 2JGDA 3FB7C 3M6IA 3AKCA 2JIZG 1IVYA 2IDMA 5K0GA 2H08A 3G1UA 3O4IA 1RJWA 2B20A 3TETA 1VGVA 1ULTA 3RG2A 4IFTA 5EPOA 2VOJA 3AHEA 2Q1SA 4I5SA 4RZ3A 2ADFA 2I33A 3PJSK 3UBTA 3K5MA 1RM3A 2A9JA 3DO5A 1HTWA 2BBTA 1A9RA 3U6BA 1BKYA 3QOYA 2C2ZA 2WJVA 1ECLA 1YS4A 5HBRA 5BSVA 2ZAYA 5C1BA 3FHLA 1M93A 4UQLA 4UBJA 2W43A 5F33A 1ZVVA 4QXQA 5KYVA 4DLRA 1PL8A 2DWPA 1G291 1W4AA 3RC1A 4XSVA 2H2FA 2NN4A 4ILEA 4CKWA 2DR2A 4I81A 3SSOA 3N2IA 1HYBA 4FJ0A 3S5UA 3E27A 4RKQA 2EARA 1Y3IA 1NMEA 2AC7A 1FUIA 3E48A 1OT5A 3WLSA 3T4EA 2WSSA 1PS9A 4NL4H 1PNQA 2OPHA 1D09A 4E09A 4RACA 1ESZA 3WXMA 5EC2C 3AG6A 3BGVA 3OH8A 3K08A 4LX8A 2HWXA 2G83A 2JGJA 2NP7A 5CDFE 3DL2A 3OCXA 5JCZA 4L8JA 1VQ7V 1Z6AA 2FJPA 4DUPA 1O8BA 2X9GA 1GH6A 2JFBA 4HEA1 3LY8A 5EESA 2OFXA 3E86A 4I4NA 4IDFA 1VBFA 4ESEA 1HLDA 1Y37A 4O4LF 4R3WA 4F9FA 4YRNA 1M2KA 1PQYA 4DR6O 1GU0A 2F1RA 2EBFX 4JBXA 4PZ0A 5TRTA 4DYDA 5FF9A 3BPSA 3UQ8A 4CXMA 3PFNA 3W7AA 3HB7A 2IY8A 5ENZA 4D3FA 1AKVA 4V3BA 3DOFA 3E7FA 3NASA 2PVCA 3EVTA 4ZT2A 2P35A 4PC2A 3R66A 4QNHB 4XASA 1UBRS 1JS1X 1SC4A 3ITNA 4NV1A 3BGWA 4QECA 4J3JA 5DLPA 5LB2A 1ZMTA 2PZKA 3P32A 2ERYA 4WXEA 2XUZA 3VNQA 4ILKA 1KXJA 3O21A 3CZRA 4B87A 1RAHA 3SZUA 2FKNA 3FZEA 4OAOA 2IDZA 2G77B 2ACKA 3T0FA 4DHWA 2FGKA 4ZZ3A 1YZUA 1VTKA 4V39A 4EOGA 2CJWB 2HSWA 2P40A 4O2AB 5IZCC 1NU1H 4ZALA 3HUFA 1KOJA 4MGZR 1F9EA 5F12A 3UMGA 5JHHB 3HFSA 1A2OA 2ZWMA 4C6RA 3PUJA 3LWZA 1KMCA 1GZDA 1SOVA 1YMUA 5JQGA 2K2WA 3IMKA 1U6KA 3DXFA 1W19A 2YY7A 3NPMA 3U49A 1E8DA 4C21A 1O08A 4B76A 4LWSB 3BSFA 4RYLA 4JN6B 4TT3D 1ZL8A 3FPSA 3V5NA 1P6UA 4QTYA 3GGPA 1XK7A 1YZBA 1SOWA 4LKRA 2GPJA 4AP5A 3O8OA 4CQMA 4WBNF 1FLVA 3G71V 4US1R 4MAFA 5B7NA 4MZXA 1MOQA 3QYJA 4M99A 3AY0A 1ODIA 1YI0A 5FUYA 3T3MB 3E05A 4L72A 1MO3A 3C6XA 3O2SB 2F43G 3FSGA 1DLBA 3QTTA 4ZODA 1OA0A 3KOOA 3C2QA 3GRFA 5EE9A 5D3MA 1QK4A 2BR4A 5IMSA 3BWDD 5LL6P 3SQWA 4B73A 1Z37A 2R8EA 3BB3A 5KWSA 5B57C 4R7ZA 4TQAA 1M2FA 1M6WA 2WJ4A 3JXEA 5LP6F 5GOTA 3VPAA 1GGJA 3RRYA 2JFOA 4JI1O 3CFYA 3FR8A 4NZOA 4XVUA 1X86B 2XQVA 2XUMA 1PO7A 2CTWA 2ZB7A 2CLKB 4OHBA 1G0NA 4YQEA 2FSHA 3L4BC 3WMRA 1EA7A 2NG1A 1N4AA 4ZQHA 2XCUA 2IH3C 1RACA 1DIOB 2F2TA 4GI7A 1WUYA 6NULA 4HGZA 1RC0A 3L01A 4YUXA 4BO2A 1NUHA 2HUNA 1V1JA 1USUA 2E6KA 4YCLA 2P7TC 4TXHA 1ZOPA 1J97A 1YFJA 4JJAA 3EFHA 2BDEA 4BUZA 3E89A 4YWJA 3RK0A 2F93B 5KKNB 4RHXA 3U6KA 1NF2A 3KR0A 2A3RA 2ZTUA 1RMQA 5EI5A 2RAUA 4KYTA 4A8HA 5AVVA 2AHRA 4GECA 2YYSA 1MZPA 1Z12A 3C97A 3LC1O 3ZXYA 1B0PA 1E5LA 4MVJF 1R3UA 1FP4B 5EERA 4ND8A 3RHFA 4X7PA 3UJPA 3EA5A 2OYSA 4H31A 4JJGA 4OLJA 4X8OA 5CEEA 2PZGA 3R8FA 1ZA1A 5KNBD 1YB4A 2WU8A 3PITA 1EXNA 4WKNA 5EMJA 3WKDA 2BC9A 4XIJA 2PJRA 3ITDA 1TZMA 4RQAA 3BCHA 3UH0A 4JP1A 3ZX5A 3ZW9A 1EVQA 5E4FA 4JX8A 4D96A 3ZVRA 4C6SA 2IYXA 1D2HA 5KC8A 3ZGLA 5EUBA 3OP1A 4NG5A 2AF4C 5BT8A 5FPYA 1ODKA 3OX2A 4Q19A 4NCHA 3SOPA 3I37X 2XMQA 2MYUA 1MB2A 2NP6A 5HUQA 1J2YA 3RIEA 1VFNA 3BJMA 3VGJA 4OGFA 4ESHA 1X7DA 2A5YB 1FZQA 2BFBB 3ZIAG 3TJMA 1JMYA 3EIXA 3T7TA 1Y8AA 2HEGA 4L07A 2IYQA 4CKBB 1B06A 1NLMA 3A9SA 2VDWB 3PNSA 4O2RA 1IZ9A 2ZDIC 2FFQA 3G5TA 3VKWA 1RABA 3Q2OA 4KL8S 5CNKA 1C4WA 3T7CA 4N5NA 1QCDA 4JYMA 1LC0A 2Y93A 4MDEA 2ZS7A 2GB4A 4X85A 3B78A 2ODMA 3M5CA 2VTBB 5M7EA 2D0IA 1M2VA 5MFPA 4UNRA 1JGTA 2YCLA 1X77A 3LXRA 3I53A 4FFNA 4D8TA 3CNBA 1CUGA 4DYVA 1ZJ6A 2RBGA 5I01A 5CVUA 3K0AB 2BKVA 2CWWA 5KDOA 3WS7A 4ZTUB 4EB6A 3EQZA 3IC7A 2Y0CA 4P92A 5AOBA 2Q45A 4LBVA 2QTTA 1BOFA 3K0KA 4NDAA 5SZKB 4KFCA 4XYEA 1GUBA 4GG1A 4ZQIA 2PYDA 4V0OA 3WDLA 1YCIA 3PVZA 5K3OA 3CUWA 1JTFA 3GJ3A 1Q82W 3V1MA 5KJ6A 3PZRA 2A5JA 4TS9A 3OM0A 1WB5A 3OGIB 4C0AC 4PY2A 4MS2A 1J5PA 4G5SA 1YZLA 3C87A 2CN1A 4LSGA 2B35A 2O1EA 3CX8A 3KB8A 4K8XA 3IIIA 2RJ3A 4HP8A 4HGPA 3KG2A 5FPHA 1BDIA 3H2KA 4FM1A 2XA2A 3DXZA 4QOEA 5M34A 4L3OA 3ABKB 4I99A 4TOIA 3B1ZA 4A8TA 1N2EA 4GD3Q 1OFVA 4BCDA 2EX4A 4X90A 2CFIA 3OJOA 2JVJA 3ESZA 1TU4A 3CZQA 4ZKIA 2NGRA 3ACCA 3MIIA 3ACBA 2ZIEA 1JA0A 1O03A 3TZ6A 3DWEX 2CHUA 5EC8A 4HWTA 5L3FA 2AJ8A 3U39A 2BWJA 3DWFA 3GGCA 3H87A 3G1TA 3BABA 4GUDA 3NWJA 2GYYA 1A8HA 5JZMA 3TAUA 1QH9A 1XAHA 1YRAA 2YJ5A 1VQ4V 4BLSA 4FNOA 4KOEC 4TZKA 4JXJA 3E18A 3QMWA 3B2QA 2GARA 1Y98A 3RG8A 1RKBA 2QTRA 1QHHA 2I3GA 1SURA 3IXMA 2RHGB 2GZHA 1Q0RA 5EG5A 3KZMA 5K09A 3AC0A 2C96A 4UCQA 5C8YA 1EM1A 1TUEA 1CY0A 3PRYA 2IYNA 2OSBA 3RIHA 1YNSA 4TL6A 2C7RA 3EEFA 4P86A 2GRAA 2F9FA 1ZWIC 3LXMA 1VPEA 1WHTB 4GLLA 4HVAA 3HLTA 1DQRA 4UB8Z 1A82A 4OYRA 1T9ZA 1ZVMA 4BWYA 3G0CA 4BMXA 2I91A 2Q5ZA 5DISB 2EJCA 5CGQB 2P3QA 3HB3B 4QYSA 2OAQ1 1RCUA 1R66A 4EY6A 3MF4A 2Z5FA 1PR6A 2QTSA 4RKWA 2QSYA 1PJSA 1T8WA 2IV3A 3FTNA 4R9VA 2Q9BA 4AI8A 1L4FA 2XF8A 4DQKA 4N3AA 1TTQB 3JZDA 4RTMA 3DPSA 4B6FA 5DNAA 1YRBA 3ABKC 1SA0B 3CKLA 2P6OA 4U6SA 1U7DA 1HR0B 2KG7A 3DHYA 3OOSA 3LWBA 3K5HA 3FLBA 1N8RW 3T3IA 1P73A 2QXYA 4QL3A 1JI3A 2Q6VA 1JHQA 1E7YA 3O1LA 3W6NA 2NVWA 4KRYA 4GSLA 1MW9X 1ZG3A 5DM1A 3BORA 5C5EA 2D5AA 2UYOA 3VPCA 1GPBA 3AJ9A 2JASA 3U09A 4Q3KA 3N2LA 3ZWKA 2LVBA 5FLYA 3ZVNA 1T5HX 1U8UA 1M5IA 4U2GA 3EN0A 3CJHB 1U0OC 2HXSA 4YT2A 4LE2A 4Q47A 2RK4A 4LRXA 4PVDA 2M6LA 2GMWA 4BAYA 1IN8A 4QEZA 1YL7A 5DECA 1VMEA 1XCJA 3NI2A 4OSPA 1Y1KE 1K7FB 3M9LA 4Y9TA 4EYSA 4B7EA 4DADA 4UUNA 4I0WB 1CWUA 3NHMA 3RWBA 1UFRA 3A1CA 2EZTA 3BIWA 3M9XA 2FWJA 2GK6A 2A94A 5DM2A 3T95A 5CA1F 1CDOA 3NFYA 1OLXB 2EKDA 1OAOA 5AKYA 3QKRA 4MAAA 1SRRA 3BH0A 1XJ5A 4IDAA 2BE9A 4CM4A 1U0FA 2A5DA 1AT1A 2BGWA 1L7RA 4Q4AA 2YV3A 1HH4A 2GERA 4CG2A 1YB6A 4MQUA 1SVUA 2NM0A 4K6HA 1AI7A 4HV4A 4XCQA 4YRRA 3KXPA 3IKMB 3PZBA 4XUDA 5EQDA 5JSUA 4G0UA 4E4YA 1W75A 2C31A 4UEQA 2KBEA 5ALQA 2WA1A 4YRSA 1ODSA 4HTAA 5A7HA 2RH5A 1DJLA 3CCBA 721PA 2HMVA 1SF9A 4AYWA 1FX0A 2A0FA 1DV1A 4Y7CA 3C1AA 4YH1A 2H4FA 3OZUA 2D3WA 3VR1A 3ZE1B 2FWBA 5IAEA 1O57A 3EVFA 2D7DA 3FVTA 2Q3JA 3B3QA 5AHRA 3TI9A 2QRKA 3B3AA 4EPYA 1PT6A 2L42A 1YB2A 2XW6A 5BQ3A 5H1YA 4BFYA 1N6KA 1OV9A 2PCJA 2GN8A 4EHFA 1L4EA 3TLJA 2LIPA 5FCDA 2OORA 4C30A 2PO7A 2P6NA 3E9ZA 1IHDA 3QVTA 3TUIC 3Q5EA 4D0LB 2YN0A 3HL4A 1A69A 3I1JA 4B3IA 3TX6A 1EWYA 1IBMB 3N6RA 5DGIA 1IN1A 5CN0A 4WLFA 4MQ4A 1F6DA 1EP1B 4QIHA 4ZWNA 2GK4A 4YC7A 4HEJA 5JJBA 3FKSG 2AQIA 4EG4A 2FMUA 3GLHB 2I4LA 1FFDA 4PG7A 1CP2A 1YJCA 2OFPA 5FNVF 4FS3A 4DSNA 2Z08A 2Q1XA 4CEHB 2I99A 1AGYA 4LXIA 2QM8A 5BUSA 5KINB 1RHUA 3AZPA 3COPA 4MQ6A 2WWVD 3MYRA 3RFCA 4KWHA 2HW8A 3VU9B 4UBMA 4XTCS 3K70B 4RL6A 2Y1FA 1R0KA 2B8TA 3CWZA 5AVZA 3UENA 2VJQA 5THQA 4X63A 3AI3A 3JQPA 1PZMA 5LN1A 5IN4A 4PA6A 4WCEV 1JSCA 3ZZMA 4YP1A 3T1NA 5HKAA 2GN1A 1HQKA 4XZ3A 2EFJA 1DJMA 2VSOA 1YBAA 4R1TA 2PGAA 3N6XA 2PE5A 2F43B 4UAGA 5E7QA 1WPRA 3LQQA 2VJPA 1PR2A 1JG4A 2O3TA 5E2AA 3QW2A 3ICEA 1VPTA 1AQIA 1UC5B 4JI4B 4UZSA 4WCFC 2YSUB 2NNUA 4JUBA 4PGFA 4ZP1A 4PM4A 3ZPXA 2Q4RA 1G20B 3GPCA 1KDYA 4XWOA 2QX6A 2ECOA 3DYVA 5DO9A 5I8WA 3LCCA 2FJ0A 4U7TB 4MV4A 3O95A 4M9ZA 4MK4A 2QQGA 5EJAA 2Y1XA 4AIIA 5J1TB 5HCIA 4QPDA 2PS1A 5HF9A 1DFHA 2ZJAA 2GCOB 1EE1A 1BMDA 3SYNA 1UEIA 3FPJA 4ZVRA 3QVVA 4JB8A 2GV9A 3FETA 1Y1RA 5HX7A 3R09A 3I8OA 5E7JA 1HQDA 2ZULA 3U40A 4UCSA 3CS5A 1NVWQ 5HKKA 3RVPA 2I2AA 3GGSA 4QASA 2Q5EA 2B8JA 3DWIA 1P80A 3GJ0A 3A28A 1OWOA 2Z6UA 4GLOA 3R75A 3CONA 4CDNA 2I2FA 3KAPA 4X44A 4OHWA 4Z9BA 2IE0A 2NV2B 4PIPA 5HZMA 1SRQA 1G6HA 4AUKA 2JI9A 2QM7A 3R74A 2YC2C 1UOQA 3RUAA 4TL9A 1GCUA 1EVJA 4RE6A 4K9LA 4P7BA 3JQCA 3PX3A 5I7SA 4DV0B 4MI3A 1WNFA 4EAAA 2HA3A 5IYZF 3CLHA 3NWOA 4KQ9A 1S2GA 1TLFA 2Q5CA 3V6LA 2QDOA 1NI4A 1VE1A 5LFAA 1HDXA 1SKBA 1UM9B 4B4KA 4MXDA 3BMXA 2A6PA 4CTOA 4ZK2A 1CPYA 4PDMA 4DLWA 1N6LA 1FNNA 1KOGA 2RCVA 5LCXA 2CJXA 1YVWA 3H8JA 1NXPA 4UNNA 1BWSA 5ICEA 2EOAA 3QP9A 4QJ4A 2RI6A 2G9ZA 2AQHA 2CF6A 5ALXA 2JFFA 4C0BA 1I0IA 2GUWA 3H1IH 1LRJA 3O5AA 2JG3A 3LQ4A 1RBQA 2HJGA 2YFYA 1TRKA 3Q3VA 3KT6A 4LHEA 4P82A 3AF5A 3QJYA 4Q1EA 3L7LA 5ALJA 4ZO6A 1P7YA 2G1JA 1Q2UA 1TYAE 2GR9A 1LLDA 1D2CA 3WGMA 2PL9A 4KQMA 4RO0A 4DR5B 821PA 4CH5A 2WT8A 1Q7BA 3B1YA 4TT3G 4I4TF 3TMYA 1WCYA 2OD9A 2EIMC 3OQNA 1QVZA 1R3KC 3PSHA 2I8LA 3FM9A 3WAGA 3FIUA 3ZCCA 2JLCA 3AEIA 4BGIA 4IWYA 1EJ6A 5I4BA 4PNEA 2JA1A 4GXNA 5J2TB 3WHKA 3P0JA 4I5EA 3F7MA 2GF9A 2BGRA 4OTZA 1BL8A 2HA7A 3NHWA 2IUFA 1KYXA 1O9BA 3CWCA 1ZKDA 1F3LA 3GMTA 2CLLB 1ZD3A 1MGOA 4L16A 3LMKA 5KJCA 3TIFA 4FE7A 4F6RB 4HEHA 3MMSA 1R0RE 1BXZA 4P4UA 1WPXA 4G0NA 3LRTA 4P38A 2YIMA 1I7NA 1S76D 5AHKA 4L3WA 3CCUV 4EGQA 3W5HA 3V9PA 2JVKA 4IRXA 4ZOLA 1L6IA 2AN1A 3DMFA 3LRXA 2AYZA 3X1ZA 2UUOA 4Y0AA 5BNIA 3AG2B 4XVQA 3K0FA 4JBWA 3SJZA 3ZE7A 5ALTA 4YK7A 1VF7A 5TJ9A 4HN4B 4MOWA 2OD7A 5G4KA 2FMHA 3QI2A 1FNSA 3GDWA 3IR5A 3KQKA 4JYAO 3TOXA 1R6AA 2FEPA 3KZKA 3WYNA 2KSDA 5DHFA 3R0XA 5A4MS 1NU8A 4HY3A 2ZYAA 1BQEA 2PVPA 4M7WA 4JJ6A 1UINA 3R8XA 1KETA 1L5QA 5ED0A 4WK0B 2XR1A 3MTDA 2J32A 1WMDA 1JIKA 4ROTA 3N59A 4ETNA 2AOVA 1U8XX 3P2JA 1U2DC 4C5AA 1FFCA 4MUAA 1KMHA 3RYIB 4YJ2B 2N75A 4UQOA 2ODNA 3MJTA 4FYKA 4JYBA 3DAYA 1B6RA 4BO3A 3IEVA 2BFWA 4UNQA 2PT5A 2PTMA 3AFHA 2APJA 2G76A 4W8GA 3IOYA 3HN6A 2BL4A 1KQGA 3RSHA 2FW8A 1GLVA 5PNTA 5IJ0A 1RSZA 2VCYA 2CYCA 1E3IA 4JKYA 1PDVA 3KQQA 5KAPA 2C7BA 2HRCA 2F90A 2CV1A 1X70A 4XH9B 5DT2A 1DCFA 2IDKA 4IJWA 2WG2A 2K2QB 3LUDA 1V1RA 4P7FA 2D06A 3T0GA 5DKFA 3EEOA 2Z1NA 1NFFA 4CCYA 3X0DA 1WAZA 2FSIA 2GM4A 2GZSA 4AX4A 1CRPA 3BHJA 5JAOA 3R3VA 3QWBA 4U2FA 3KTFA 2PKXA 4ZYXA 4X45A 5JS2A 5BN5A 3NOQA 5HP4A 4BKUA 1DDGA 1ZGZA 3RYFA 4MR9B 4A2PA 1CS0A 1K33A 1BIFA 1VIBA 5DNWA 1KZHA 4RWUA 3A1VA 5DGDA 4WTOA 2V9ZA 4U2KA 3HA2A 4WBXC 2XDYA 1W85B 3RYCA 3AW8A 1OXUA 5SV2A 4FWIB 2Q62A 4XR9A 2BMDA 3W7XA 5A7GA 3ABMB 1PBTA 3OJXA 2UYCA 1LLQA 1Z7WA 1PKXA 3K9QO 1OLSB 3L0CA 3G88A 4IYJA 1UKEA 3GZJA 4W1QA 3Q9NA 3UJHA 4FB4A 3K72B 4JXXA 5BVHA 4I9NA 1E69A 5LC1A 4IZHA 5DRTA 2W6IG 1H66A 1WDLA 5DH9A 4ZJUA 1DOHA 1XRRA 3AUKA 5F7XA 4B47A 3FF1A 2C5GA 1LNSA 4K3AA 3R3UA 3D8CA 3ISVA 5FB3A 3KKKA 1U1GA 1Y3AA 6LDHA 4BFSA 1RPOA 3E6AA 4R68A 2RGCA 4AICA 2B6NA 3LUGA 2ID4A 3IAS1 2GJAA 4LDJA 1RSOA 1NSYA 4IS2A 1MOSA 4Y6RA 3I2JA 2J07A 5JTUA 3QYFA 5AVRA 3ZRSA 3RTCA 1ZM4A 3DR3A 4B6PA 2ONZA 2JFXA 4X7RA 4K46A 4JAVA 4Y2RA 1M2GA 2BPOA 4HQLA 4KWIA 2I6FA 4QQFA 1YDMA 1O6BA 1Z4MA 1CU1A 1BEUB 5AK5A 3QSGA 4QODA 3HCCA 1W2WB 5KTTA 3AR7A 3TXQA 3L9XA 3VPSA 3S2UA 5D1HA 2XMGA 4O08A 2PYIA 3UKJA 3ANLA 2WPDD 1A04A 3JQQA 4G67A 4Z2AA 4IDNA 1RJ9B 3SJCA 3WFIA 3ESBA 1T2NA 1L7EA 3OM3B 3NLLA 1NJFA 3HG7A 3LNCA 3CC2V 1XU9A 1JHUA 1VHTA 5DBGA 3ABMC 1N1GA 4BATA 4L22A 1VJDA 2X0RA 5KVSA 1A7AA 2YYYA 2NVBA 3R40A 4IJ6A 3UAYA 2VP0A 1V8OA 3EHEA 4JMLA 2OYQA 2VDQB 4TMVA 4LNAA 2AR7A 4OHRA 3THYB 1P2VA 3MELA 2XAUA 3BWEA 3UIEA 3Q7SA 3KTAA 3WADA 1MORA 3QO5A 1DMSA 3RDPA 5DXAA 2HJFC 4YRFA 2IBMA 2OCYC 3G3EA 4R8SA 5LXTB 4A2WA 4RCYA 5B1YA 1VI6A 4JC4A 1MQAA 4IG9A 3HVKA 5KQSA 3ZN0A 4N8SA 1ORRA 3U37A 4MVJD 2YHSA 2PFSA 1ZHHA 3F5FA 4Y1FA 3X44A 5FOQA 3JU3A 2ZI7A 1KI3A 3MHHC 3C3XA 1GN9A 3NUZA 2QYHA 2LUOA 2VP9A 2YFKA 3QJ5A 4RQUA 5EBMC 4BC1A 3E7XA 2X5JO 4UBNA 5JNRA 4FYWA 4FWTA 4JYYA 5A6SA 2Q5LA 2ZE6A 1OBVA 4BXOA 2JD2A 1DWQA 1JFVA 2AUMA 4OBBA 2D2FA 5KHKA 1E3JA 2C00A 2H1WA 4E11A 4FMCF 1AJEA 1I94O 1YI1A 4YROA 3VNRA 3VH4A 3AGPA 4B3JA 2IJKA 3IELA 4LF4B 1F0KA 4MMYB 4YJDA 1A71A 3H5OA 4DMLA 2H4XA 5IDQA 4GGPA 2WLJA 1NLZA 4CMIA 3OVMA 5IVPA 4CM9D 2Z5VA 1FVXA 3Q3JB 1J99A 2X3UA 3I01A 4XJSA 4GEGA 4CR8A 1YBHA 2GLXA 2Q7XA 3NS7A 1UAGA 2ZSKA 1O0SA 4D3SA 2Q6TA 4LRQA 3D6UA 4WNCA 4XUCA 4UB6Z 2OCXA 2JFZA 2YXYA 3UAGA 2CE7A 4QOGA 4Z4IA 2ZQYA 2P68A 4YMHA 2X76A 1C0PA 2NMVA 2FPKA 4N6NA 3Q6NA 1C14A 3O9VA 3U13A 3WKBA 4UBKA 1H4QA 2Z83A 3LVRE 3IXQA 4PXYA 1AS2A 2QNRA 3HFRA 4YXWD 3SYKA 3T2MA 5M3BA 2GPSA 4H17A 1CJMA 1KDVA 5I51A 1QONA 5TGTA 3QE9Y 2WF6A 2QF7A 5FR1A 4YCNA 3ORFA 5JFTA 1QO0A 5CJJA 5CIWA 1N32B 4B83A 5C81A 3CRRA 4GWGA 3KQUA 4BPBA 2NYUA 2SCUA 1HG0A 3WK9A 1JJOA 1GIAA 2BEUB 3FOZA 3M82A 1Z0DA 2AXEA 3CUYA 3LUCA 3TRJA 3B7GA 4EYQA 2QXUA 1Q57A 3L7JA 1XZCA 2DFDA 1H8HA 1YCGA 2W2VA 2P9CA 2Y67A 2FSGA 4NV0A 4O63O 4Q4HB 1MB0A 4C7OB 1JHVA 1T8PA 4K9OA 5DEOA 4LRYA 2P27A 2ZYIA 1Z5PA 3QVGB 1P45A 3ZJ5A 1DKNA 3NDIA 3JQAA 1PJ4A 1IUKA 1RWXA 3MTGA 5TT1A 4RK0A 2Y1KA 4WFBV 3TZQA 1VQNV 5IVHA 5H70A 1S5JA 1QB7A 5C5CA 4WNAA 4Q3NA 1U9JA 3PD7A 3U3XA 521PA 3VV2A 4JSRA 2A33A 5C1IA 4BU0A 4LJ8A 1GM9A 2X4GA 1SQXH 2FPIA 3RRXA 5C53B 3LPLA 1N2CA 4TTIA 3FVWA 1NHWA 4PV7A 3VR4D 2G71A 3MT7A 3SKVA 1CRLA 5I7UA 4KXRA 3DVQX 3PWKA 1EFPB 4BFUA 4G0MA 1NW9B 3K03A 3PN1A 4JIMA 2ONJA 2OILA 3PBKA 3H1JH 3TUJC 3WGZA 1NI8A 1NOJA 4A0RA 3SCZA 2IF2A 2B7LA 1Z0ZA 3LT2A 4WHMA 5BN4B 4BASA 1YUNA 4LH6A 3STHA 3DQQA 3BH7A 2Z0MA 4QWMA 3RVDA 4WFQA 4COKA 4MAMA 4MLZA 3JSXA 1KRWA 3RT3C 4GC9A 4NE9A 1JR9A 1HMYA 5T64A 1XN1A 3AR3A 4OM8A 2BH2A 4M9UA 4R1LA 4A92A 1QVFU 5TR9A 5EJFA 3QF4B 5LSAA 2P91A 3OC0A 3JCZA 3R3ZA 1DEXA 1X15A 3G4SV 1OYOA 3I6IA 1GSAA 1OCZB 4F5ZA 3L1UA 3R3WA 1E66A 3GFVA 2C4NA 3WYBA 4QFBA 5A2QN 4WN3A 2ZJYA 4RLHA 3WAKA 1GTZA 1XTUA 2YDEA 1OVMA 2P2DA 4V1CB 1SKMA 4R5HA 3VKGA 3A05A 2BFEA 5LLSA 4HQ6A 2HREA 3PQ3A 3TKLA 7MDHA 3AEUA 4P22A 1XDWA 2X40A 3ZV7A 5K9ZA 4UUBA 1NA5A 2ZIUB 1CERA 5L3EA 1VQ5V 3G0OA 4B4WA 1RZRD 3V1LA 1A5SB 3B6JA 4TS1A 5JDIC 1U1FA 1T24A 4JBNA 4GF5A 1XMSA 1KI1A 3RWMB 3F5SA 2XAGA 3B52X 1WB9A 1GRRA 4AB1A 1X4TA 2FZ5A 1MD9A 2XCLA 4OQ4A 3OFVA 1QHYA 2GVNA 1E1DA 4AS2A 5CJPA 2M1ZA 4NCKA 5HM8A 5T3YA 2A57A 2B8NA 3RVLA 2Z8YM 5B7QA 2VLBA 2F6RA 1JEAA 4IOLA 3DKIA 1E2IA 4Q12A 2GN6A 3PNPA 1Z2CA 2DERA 5SYMA 1E3MA 1QDEA 3DB1A 1ADYA 5EEGA 1ADJA 2RGEA 3TQSA 1EXWA 3WR5A 3KSRA 3KVRA 4NPAA 4LXXA 2QTVB 3KFVA 4B3RO 5LWHA 3UO3A 2NO0A 5L9AA 3I72A 2H1HA 5FQOA 3R3YA 5DDIP 2E4UA 2VHXA 4ISCA 1AK2A 1WQ3A 3EG9A 3JWGA 2ZUEA 2Q6OA 3ILYA 3KLMX 2QAIA 1OCRB 4D6XA 1ISJA 1BROA 1FDRA 3F7YC 3I30X 1E2FA 3KL2A 2E5FA 4U39A 4DPLA 4G37A 2ZBRA 1MNGA 4UV9A 3MOGA 5DW0A 3UAXA 3D6VA 2VQ6A 1NV8A 4EHHA 2NZ8A 4NIMA 2NTNA 2QT1A 4OI4A 3AV0B 2Q1UA 1IZ0A 2XB6A 1Z2OX 1GNRA 2J0SA 1F8FA 3EIQA 5AM2A 4LC0A 3SVLA 5DFAA 4JEMA 1MB3A 2ZZMA 1I6WA 1Y5NA 4C2BA 1EN6A 1X74A 2C2YA 4GL4A 1E2HA 1EX9A 2GM9A 2AD5A 3WGGA 3B82A 4E5PA 4FSXA 4O4JB 4HAYA 1NW6A 1JHMA 3FGNA 2W2OA 5IJ9B 4CIXA 3ODGA 3WL4A 3UJAA 4G5OA 1D0VA 4KBYA 4ATNA 3GPLA 4R16A 4HVLA 2YFHA 2QZPA 1YRLA 2RB4A 1ZJ4A 2KB0A 3ZVKA 2J6HA 4NBKA 2H0QA 3BKWA 5H81A 1T0IA 1D3AA 1XLTA 2PS3A 3AEYA 2WHPB 1G7RA 3HCOA 3VX4A 1IDSA 3LIIA 5E6SB 2DUJA 1K9SA 4A6EA 4QNMA 2V5UA 4N0PA 3M4YA 2HMAA 1VL0A 3FMIA 3O0DA 4B6OA 4NXNO 3SEQA 2CMHA 5HFAA 4YLYA 4MTLA 3VU1A 1MMMA 4M0LA 2WU1A 3QVUA 4DV1O 4WBSA 3OMAB 5AW3A 1OPXA 2PV7A 5LBTA 4Q4CA 3K79A 1P4SA 5E9WA 3DC2A 2XVYA 2VQFB 1DZ3A 1GZ3A 3V2HA 4Q3CA 5CEFA 1WE2A 1TKAA 1FYVA 1BVHA 4QX6A 3BERA 3JQGA 4DR3O 4JFAA 1YOVA 1GQRA 1WLYA 3QENA 1U3GA 4TXLA 3VZRA 2EF1A 4WDQA 1QYWA 4H9GA 2YS8A 3LD9A 2IRWA 1XTKA 3H16A 3EQ2A 3OOWA 3CEAA 4H18A 1W0JA 2UXNA 2OV2A 1ILEA 1Z25A 2WJJA 1RQLA 1U0EA 1QIEA 2EJVA 5FTMA 1ZQ1A 2HT6A 5JANA 1O0CA 1X39A 2H6EA 3IJRA 4ZQEA 1H1LB 1NONA 5LKAA 3GMIA 2GNAA 2VJDA 1SK8A 2WJ6A 3QXHA 4UVEA 1TGOA 3S8YA 3QWIA 2JW5A 2GEJA 4WJZA 4YMWA 4PHCA 3OY7A 3HKEA 1Q17A 1G2QA 7ABPA 1AZWA 2Y1CA 1NRXA 2A0YA 1DQNA 3ET5A 1TU3A 1UMCA 4XGRA 3K53A 4FYYA 2FFRA 1ZUD1 1A7JA 2C94A 2E3CA 1W93A 3DH0A 5AKJA 3R7FA 1YU6A 2PH5A 3HU2A 1NW4A 1FTNA 4D4HA 4TTSA 3TKYA 1D6NA 1TT5A 3BWYA 3HYRA 1T9BA 4WXRA 4QHYA 5ALGA 2IQ5A 5IXSA 1PX2A 2FZWA 3D7RA 3O1HB 1ZD1A 3FBTA 2JCBA 3QK7A 3BQNB 4GYKA 3O26A 4NBUA 2TMDA 3FGPA 1TQ6A 4EVRA 1R18A 4CG0A 1I2CA 3G2NA 4YAGA 1DRVA 1U0GA 2ATXA 4G27B 4U3JA 2NSYA 2FRVA 2PD6A 5TMEA 1SZTA 4KGZA 5DGHA 4BKRA 1S5PA 1SNYA 3FCSB 3BB4A 5C7IO 3AVOA 2MU1A 3FUXA 4YDRA 1N0WA 2X3YA 1LI7A 3CF0A 1NMQA 3THRA 1MEOA 3U9TA 1KE2A 2J87A 4G9EA 3CE9A 3NTXA 1QYXA 2QY9A 3UFBA 4UBOA 1MAHA 1L6RA 3NCTA 1NBHA 1XJWA 1TFUA 1K8AW 3FGZA 1JZQA 1QIDA 4AZ3A 2UKDA 5I9SA 4WOKA 4EYOA 2FP4B 1AK1A 4D5EA 2QENA 2QRNA 1YZFA 4ZCLA 1DRWA 1DC8A 3CINA 5HTKA 4YQZA 3FSJX 3DBIA 2RHTA 1WNTA 2DWOA 1JXOA 4TQGA 1RDFA 5HEKA 1PP4A 3L7OA 2QRVB 4LJKA 5H80A 1JLLA 2HEPA 1EDBA 2WNSA 4NZZA 1U31A 1C3EA 4UHEA 2ZK7A 3JATA 2DFNA 3THXB 3FWZA 1WKBA 2WYHA 1J0EA 4U4AA 4I5FA 5LMZA 1Y5MA 3IUJA 2NU7A 2D0PB 2WKSA 1ZPDA 3OUTA 4QUEA 2G7MC 3P9PA 3L74H 2R44A 5ITSA 3IHTA 3KVNA 2NUAB 1E94E 4M6WA 4HDCA 2BZGA 4H27A 1P9WA 1ZM2A 4LK2A 2YUIA 2VYND 2P22C 4ZT6A 1D07A 3TXXA 4X89A 3AP3A 1SXQA 1US6A 3AIMA 3TD6A 3FPLA 2JS7A 2JBAB 3FCOA 4I6EA 1K7EB 3E8BA 2YEVA 4GOKA 5IT9N 1AQYA 3FJYA 2HIHA 3KWFA 3ICCA 1QFMA 2O2EA 1R8JA 4FBMA 3GNTA 4WNYA 4YRTA 4MKRA 5KJ1A 1LBEA 3A1WA 1V95A 3BM5A 1FDIA 1WD7A 3QUAA 4BX3A 2EATA 2BSXA 3H1GA 3GMSA 3QBJA 4RANA 1G60A 3Q2KA 3HXPA 5A9TA 2IJGX 1GUYA 3EDYA 5LZ5A 3IIMA 4ENVA 5LOVA 3B09A 4KX5A 1FVFA 2REBA 3CVOA 3T7JA 1YV9A 5JCOC 2EVWX 1RI3A 2CMFA 3ND6A 4GW3A 3ZX6A 3NP9A 4FR2A 3FNQA 4Z54A 2G1UA 1PZXA 5E0OA 3W8DA 2PA3A 3H84A 1MDBA 3G13A 3FXAA 4HGRA 2X6AA 2XAQA 4RYDA 2I3ZA 2NLJC 3ZHSA 3UJ9A 2E75B 1MJGA 4N47A 3CF4A 3ZOZA 4HRAA 3L49A 5HW0A 3OCCA 1ETUA 1KU6A 2NVUB 3PC8C 2D62A 3J7AU 2F4VB 4KR3A 2WPDG 5BPFA 3QLVC 4QICA 1Z5WA 4WEOA 3TDKA 4DV3O 4J0JA 4KQIA 3DAGA 1MPXA 1O97C 1YOBA 5CB4B 2BISA 5GONB 1OH5A 3MRTA 2E55A 4DS3A 2B2XA 2ZD9A 5CFRA 1UJ2A 4YREA 4LF6O 4CQJA 1ZO8A 4RMNA 1H6CA 1XRLA 3H11A 3Q3IA 2ODBA 3K32A 2N47A 2B78A 5JROA 1S1CA 2BEVA 1OCOB 2FG5A 3B4SA 4P9OA 2EWMA 3L73H 1TAGA 3EZNA 4WECA 1V4VA 2BFDB 2HJVA 2VRCA 2PX4A 1VZ3A 4JD5A 1SWVA 4R7GA 3FYUA 4TTPA 4HCJA 3GX1A 4F45A 3IVRA 4QPJA 3AESA 4LF8B 4KYIB 5BWNA 4R05A 3WBFA 4DV7B 1AUQA 3PDIB 2CSUA 3MLBA 2Q7OE 3D36A 3TXSA 4Y67A 1JFLA 3E9DA 4RK6A 4CMEA 4G4IA 3A4NA 1Q6YA 1R73A 2FR8C 2OWOA 1Q6UA 4KG7A 2ZRNA 3EIUA 1D6MA 4KXUA 4MVJG 2VZLA 4M8SA 4P0QB 4PNHA 1H6DA 2OHFA 2GDJA 1UBUS 3F2VA 4Z4QA 2GX6A 4BBAA 1KO1A 3B8EA 1K4DC 1RQRA 3B2NA 2E9SA 4FCWA 3ETJA 2R9IA 3RR2A 1BCRA 1N77A 3PC7A 3IRUA 5BSEA 1DL5A 2Q3BA 2RARA 3BJRA 4K9SA 4EO7A 3KUXA 1JYFA 1KMNA 2BFAA 5JSQA 1W8DA 2ENUA 4FJ2A 3DC7A 5IY5B 1VG1A 2GXQA 2Z6AA 4LY9A 1RFYA 3AEQB 1KMIZ 3DE3X 2I4IA 4UTOA 3BF7A 3H4IA 4LE0A 1M4UA 4BIUA 1VYHA 1T5DX 3KZ1E 4AQYO 2I3DA 2QTGA 3QVNA 3V2IA 2RG7A 4P4LA 3GP8A 3EGXA 4LQDA 2PR7A 2FPLA 4FYHA 4D3ZA 5L3QA 3QVLA 1MX3A 4ON9A 2OTLV 3VVCA 1W49A 3PB3A 4DV5B 2VZEA 4MLCA 1UBGA 2CJYA 4K1XA 2PUEA 2C4WA 2B8EA 3VZQA 1QHGA 1MC1A 2GA9A 1F51E 2JD1A 1IJBA 4BRWA 2WV9A 1PG5A 3DE2X 2YW2A 1IOWA 4ZRMA 1RI5A 1KXZA 4FW9A 1ZN9A 4YCJA 1DKOA 1MENA 2OCBA 1DBSA 1P0CA 4E1VA 2QG4A 1U3WA 2C1EA 4OFXA 4YXWG 4KRXA 4FOOA 1IXYA 1VF6C 2B9ZA 2YINC 1C7FA 2ZM5A 3EXFB 3TTYA 4PELA 4IJQA 3OT1A 1QIMA 3IP1A 5TX7A 4F9GA 1X94A 3HKBB 1EUCA 5NULA 3AP2A 1ISHA 1T0JB 3Q98A 4CLOA 2JLXA 5L3GA 3CB4A 3OPYB 1CUJA 4J03A 2W2MA 1M6HA 3ROKA 5FWYA 4YECA 5F78A 3IE1A 2OA0A 4ERXA 3NHSA 4XTRA 1W88A 5BV2P 4IR7A 3TLZA 2QL7A 1RC1A 5ALWA 1PS8A 3K0DA 1UMDB 3LOUA 4JJEA 4EUSA 2DQ0A 1KZ4A 4MTXA 2AB0A 3IR7A 1T2AA 2HMTA 2EG9A 5C4GB 2WLMA 4F5WA 4D9EA 2VAWA 5JS1A 3K9WA 1DARA 3O94A 4JUIA 3ZWYA 1W4RA 3GZ4A 1EFDN 4LRTB 1FUEA 3CRZA 5AK4A 2OHIA 1QBZA 1L7XA 2XV1A 4M8NE 1EG7A 2R7AA 1TC1A 1E3SA 4S0ZA 5HA5A 1CYEA 5F4BA 2QP4A 1D0IA 1BU8A 3ZV3A 1SXPA 4PC1A 3IQIX 1PK9A 1U2TA 4MSUA 4YALA 1IVSA 1QDUA 5CFQA 3MHTA 3DVSX 4LVCA 4R4JA 1OWLA 1KOFA 5EWJA 5LR6A 4OBXA 2P1DA 2HQBA 4YAEA 5JZ9A 3AUUA 3QPDA 1A8UA 1OR8A 1WPQA 3W6OA 4C0SA 3FBGA 2ECPA 3PIDA 4Q9LA 1P33A 3VR5D 4X1KB 1I36A 3ZK7A 2J4CA 2KYRA 3H19A 4LBZA 4F4CA 3WGTA 2P9JA 4PDRA 5JXGA 4W1RA 1HC7A 3GO4A 2B5UA 2IPOA 2A1UA 3E5NA 4Y2TA 1KR2A 3EAQA 1YHNA 4IL5A 4MR8B 4U3FH 1T3SA 2VXYA 1TF7A 2AR0A 3OJFA 3GRKA 2ZBQA 2F64A 3GUVA 5D86A 5E0KB 4HLNA 2XHBA 2CXHA 2W8BB 1YVDA 4NQZA 4ZT7A 4CLDA 3VSBA 1VLHA 1CUHA 2BIFA 4P7KA 3FTEA 4DAEA 2WIJA 1AKRA 3IUPA 3ZU2A 3INNA 5A02A 3PR2B 4D97A 5JSZA 3EVBA 4NPCA 4JHXA 4DN6A 4NMMA 3A9CA 3G0HA 3NJ4A 2QTAA 2V96A 4DNFA 5HE9A 2HGZA 4UUQA 1N57A 1DT5A 1CQJB 5KNBH 5TS2A 2IIPA 5FYQA 2N9UA 3RJ9A 1PWZA 4G1EB 5GZ6A 4FI3C 4G41A 4LOAA 3U7HB 2X22A 4FC7A 4QSHA 5D01A 4ZOCA 4G5QA 4UUJC 3ZEAA 1QWSA 1P49A 4PLHA 2V1XA 1I24A 4PIMA 3SU8A 3II6X 3OD5A 1EZJA 3K1AA 2XE4A 1M34B 4AF8A 3VR2A 2M7WA 4AJHA 3K0CC 4FN4A 5DP2A 1XALA 3ROFA 1OH7A 2QUZA 1BFUA 1UOPA 2A7QA 4TV9F 1UIMA 2HUPA 3LQ2A 3GLHE 5ICCA 1G3UA 1J24A 3QLTA 3FDZA 3TRHA 1E9BA 2W2KA 3WK8A 1Y74B 2RONA 1GPJA 4ZDIA 3T3EA 2IT1A 4NI5A 4XB2A 1NYQA 4X1YB 3OFNA 3VR3A 4DQLA 5KHIA 1RC8A 4XD7A 4BC0A 3WNCA 1L8AA 3RTAA 1G8MA 4A0GA 1NY5A 2ZRKA 3DTTA 4EJFA 2CUZA 1VSBA 1EFAA 1EM6A 3N5CA 4RCVA 1HA3A 2D2XA 3QFCA 1N78A 4M4SA 3CZ5A 1HRKA 4OP2A 5A4FS 4H3SA 3T5MA 2OV4A 1GPYA 4IDDA 2EBWA 2ZI9A 2M6KA 3ZWAA 1N5RA 3KEQA 4MMXB 2ONKA 3CX4A 3A9RA 1MN6A 1MBZA 1GYPA 1KBQA 2GKOA 3QM1A 4AJEA 3ORYA 1H2NA 1U8TA 1FOEB 1W4LA 4O4LB 4C3VA 3OZDA 3QYAA 3VDMA 1U0TA 2Y0EA 5F98A 4I46A 3ZI4A 4DB4A 4ALIA 2PKWA 4EGSA 5IDWA 5FUMA 4ZV4A 1RHQA 1ESMA 3BQ9A 3NV7A 2A5LA 1G20E 4KSCA 3R7AA 3LTNC 3LBFA 4D3XA 2R6AA 1UPBA 4DR7B 5LQCA 5AQEA 5A3VA 2H31A 2ZAIA 1VJ0A 1Z36A 2FRXA 1G4YB 1DIHA 1ZUHA 2HG5C 4G0WA 4HNTA 1XL6A 4JTCB 2D4AA 2GOYA 1ZRSA 1BQ3A 2QKAA 3H99A 3UG6A 5CAEA 2UDPA 3TBKA 3TNJA 1ZSNA 2IPLA 1QKJA 4KSBA 4HTFB 3RGWS 1PJCA 4HHEA 4WRRA 3CF2A 4Q9AA 1WZEA 5TY0A 3U4GA 3H9UA 3LX5A 2WWWA 1VLMA 2FZKA 2GVDC 1DX6A 2B1JA 3GCGA 3KKPA 4DR2B 4JGBA 2ZYRA 5JAPA 3M6FA 4X71A 3DAHA 3KZNA 3J80A 4DLZA 4G4SP 1V4NA 1X8XA 1U2RA 1HNNA 1EBBA 3SMVA 3FYTA 3T7SA 1PGJA 4J80A 2ZEJA 1PF7E 3U4IA 1P1KA 4J0FA 3OCWA 2R6GA 2IEIA 3FRJA 3EB9A 3HV2A 1QGYA 1A4RA 4UTVA 1ZJZA 4ZYWA 3K15A 1SBYA 2Q2QA 3DLTA 5GM1A 1RHKA 1XTIA 3F74A 2VJKA 1WL8A 2FUG1 2AZXA 5BV8A 1WETA 4O3MA 2ZFUA 3KJHA 5B3JA 1YR6A 3GLQA 4QAJA 1Z7BA 4OCZA 1Q12A 2R9VA 1P8AA 2VVTA 4M8IA 1G18A 4N41A 3L05A 2ZR2A 2YICA 3IQDB 2C2WA 1GKLA 3DBLA 4WBNB 1HT3A 3L0DA 3DDWA 4RU1A 4AK9A 1GP2A 5C4IA 1GFSA 3PXDA 4HG2A 1VARA 1OREA 3EVEA 4HDSB 2BFFA 2JGKA 4UVIA 3K70C 1V1MA 2FSPA 5H4GA 2ZRLA 3ROGA 3HU3A 3CKYA 4MCHA 4PF1A 1MNQA 3R3JA 3I45A 1H69A 2G1AA 3U17A 4JR0A 4G5XA 1UZMA 2CBXA 3W04A 3CWQA 7YASA 5ECDA 1ZRMA 1BQZA 7GPBA 3AERB 5LQKA 5BO5A 4JJIA 4NOLA 3CKKA 4RTSA 1H85A 2GSDA 3IOCA 4WX2B 1TDJA 3FOFC 2V4UA 5KOJA 3F5WC 3ULKA 2EQAA 4QDOA 5EEHA 2PZMA 5B36A 4YQFA 4NAHA 2CYBA 5CFOA 3P94A 3HY3A 3I2YX 4PZCA 3B48A 3AETB 3OAAD 2Y1DA 3C70A 1THTA 2CTPA 3FLEA 3CURA 5IXYA 4GWKA 1VZ2A 3QU7A 4FLEA 4XB6B 1YUMA 2GGSA 1EUDA 4ZIRB 4P0PB 4MI9A 3FWHA 2FQWA 4CM6A 2A5GA 4M0PA 3VR6A 3K59A 5I9IA 2C4MA 3U11A 4DV6B 1YTLA 5JHGB 3D0RA 4LJSA 1K97A 5IANA 3DE7X 3TF5A 3K1JA 3E9QA 4FLMA 1AURA 3AKEA 2IUUA 2Q9CA 3IV9A 1J6UA 3HHEA 3F90A 4N5LA 2EIKB 1IK6A 4OK3A 5LZ8A 2O06A 1XYGA 5FOXA 1SHUX 4JVMA 1INLA 1FK8A 4WWHA 5F2EA 3TIXB 4W9MC 2HVJC 3ASOB 3D1LA 4B3SO 3ETDA 5EMMA 2VDRB 4OQEA 3DOEA 3SJ7A 3EDQA 3EQ9A 3PL5A 2LGQA 3R5HA 1TE2A 2LV8A 1W8IA 4YJ3F 4KXYA 1OXSC 1G21A 2X0KA 4EBBA 5JNLA 4BZZA 4FK5C 1BEEA 3VBBA 1KSFX 5HR5A 3RVZA 3ZCRA 1J8YF 1V16B 2ZBGA 2O2XA 1RQGA 3TECE 2E85A 3H5TA 4I1SA 5ALLA 4XARA 2HSDA 4WCVA 3ZBPA 4EY5A 1IMJA 4R2LA 3L92A 2QJWA 1U2PA 4YUVA 2PN1A 4R2IA 2NPFA 1Q20A 5MN6A 1SHZA 2NV0A 4WADA 5LMUB 3DONA 3IS3A 3U3MA 3LOPA 1OU0A 4NTYA 4A0SA 2JF0A 5CM8B 3GUZA 2ZT8A 3QKWA 5DIZA 4B3MB 2ZITA 3LY5A 2JIDA 2I03A 2D1SA 1XEQA 4REQB 4OJYA 1RE1A 1WVMA 5CBPA 3QWFA 5AK6A 4K86A 3SXJA 1NASA 1WXEA 4I6JA 5EHIA 2MSKA 2HSGA 1XEFA 2GJKA 3VUFA 1B42A 3KAQA 3T5CA 4N82A 2XKAA 4O1HA 3ASOC 2Z1MA 3WC4A 4GMGA 1SQQH 1AF7A 1DG3A 1AH2A 1K5PA 1NJIW 3WLLA 4KWTA 4CFYA 2FEMA 5EIAA 3VM6A 1N75A 1PJBA 4WOJA 1NLFA 5KVAA 4QXRA 1LV8A 1P9NA 4QNNA 2R751 3K0BA 3RJTA 3TZHA 4OIFA 2WF5A 1OYVA 1Z4PX 4H7PA 4ZGGA 1M1ZA 3K9SA 1PJ2A 3SLKA 2R8XA 4JHLA 1TAQA 5AQ1A 4FD3A 1DE0A 1NW5A 3VO8A 1GNPA 1G5IA 2OXCA 1DBQA 2PBRA 3I9KA 3P2YA 4ARVA 3IT3A 3HRHA 2EG5A 3RC2A 5IRCD 3F5DA 4BW9A 5C2JB 2X2FA 2YHBA 3BQMB 1F0PA 5C1OA 4BRSA 4B32A 1T5BA 3AG2C 4HF7A 4CDMA 2IY7A 4J1SA 2I6GA 5IYCO 2JATA 4OFBA 1JT9A 3GNSA 4UBLA 1MB4A 3MWGA 5CYFA 3SEZA 4DA4A 2O8CA 3ZWBA 3U7QB 4N3NA 3CW8X 4Q1AA 2YJ3A 1J1IA 1N92A 1KRXA 1UXHA 5LQSA 3H2ZA 2WAXA 3M6UA 2QL9A 3RFTA 1A97A 1EUZA 2IU6A 5B37A 4L02A 3WMEA 4QC2A 1DKMA 1KR5A 4M1TA 1K5SA 4KR0A 1O4VA 3SXPA 5JXHA 4W1SA 2DY0A 1AHHA 4G0OA 3DMNA 1SCIA 2VK1A 4P32A 3PX7A 2BOVA 2WY2D 3MGAA 2ZP1A 3MAJA 2GPAA 3HRKA 1ZAYA 4NJOA 5I7RA 3K6SA 4ER0A 4MPPA 1JEOA 2OYCA 1VMIA 4KN5A 3JTMA 2JGFA 4ZI5A 1HFJA 2Y92A 1YQQA 4UTZA 2QROA 4C3OB 1XDCA 3PXEA 3O1JC 1J8MF 3DZCA 1VDZA 3RPEA 4EGFA 1YJWV 3WXBA 2XRMA 2OIGA 4UDNA 4M1OA 4LJAA 3EK2A 1FF9A 3QI7A 4AULA 4DMHA 5I7OA 4DLLA 1NURA 3NFRA 4AMGA 4OI2A 3G7UA 4Y2QA 2H2GA 1ONOA 1ZIYA 1MX1A 5F1YA 1N7HA 3FSEA 4LXTA 2YI8A 3RLFA 3V97A 3THWB 3I34X 5KTRA 3HJNA 3BZWA 3GGOA 4LTDA 3MCZA 3BULA 3N0WA 1JF8A 2QTHA 3U1TA 1A4XA 1ZICA 2W2XA 1XAGA 3JWPA 4IGAA 3A0RA 3SE7A 1P3Y1 1WVIA 4UM8B 2X19A 1QJCA 4GEKA 4C89A 2IYAA 3SIWA 4PSUA 4IYRA 4GLJA 1BKDR 5DT9A 4GYWA 5TXGA 4YX9A 4CMKA 3Q3HA 3MUOA 2IK8A 1NOIA 3OT5A 3DFMA 2VXCA 4U02A 3DMPA 2NXEA 4AJJA 2EW1A 2VCHA 3L4JA 1FAFA 5L3CA 2JK0A 3UT6A 4V02A 3SQMA 2QLFA 3W3AD 3LIPA 5ECGC 3RBVA 4L8FA 4IIUA 3ZI0A 4RF5A 4B7AA 2DP4E 1H8ED 2FXVA 2ZJ4A 1RHMA 4CMJA 1YRWA 2FMLA 4N5HX 3ZZUA 3J81k 2CY0A 4LZZA 4YDHB 1W44A 3U0BA 5DSXA 1Q6ZA 3K09C 1L9KA 2CFTA 3ZLUA 1YKFA 5CA1B 1QVGU 1E3QA 1DO2A 3U4AA 3AFOA 5FOUA 3T7IA 3TQOA 1I4DD 3TZCA 3D6MA 4UAUA 3DYBA 4R31A 2YV5A 3TCXB 1FPOA 1E1QD 2RGNC 2REQA 1GTSA 5T8KC 4MV5A 4FDMA 5CCDA 1TKCA 3AVWA 5K0TA 3ELYA 3LP8A 4W1PA 1DTEA 1XNQB 3LL4A 3COVA 1SEVA 1RWQA 4MJLA 1FYDA 1N1MA 3CU5A 1E96A 4IG4A 3GRCA 3Q87B 4OMFG 3RUCA 4UU7A 5IKEA 2XZTA 3TNYA 4CKXA 1HOTA 4HS4A 4C0WA 4FINA 4CMAA 4D0GA 1MW8X 1QLNA 4RABA 1WXXA 2LCIA 4B6QA 1XE3A 1NXVA 2VJBA 3RO7A 1FUKA 5JWOA 2Z9CA 1VMKA 3QMPA 2H65A 4CKYA 4ZVNA 4ZVQA 4NICA 4PLZA 1UAYA 1IY8A 3O8QA 2V7EA 5ULLA 2GEUA 3V8BA 4C5BA 2ZBFA 3ZD7A 4DG8A 4M36A 1NVXQ 1DVRA 1HUQA 3VU8A 4FQ5A 1SQ5A 5LYJF 1Q3EA 4H1TA 2DB3A 3AVVA 3FCYA 4HATA 5LL6Y 2YWDA 1C7RA 2OV8A 3K8YA 1KZ9A 3LTEA 4XW2A 1P31A 1OFGA 3H4MA 1NUQA 4WUVA 4E1AA 1DJOA 2O5RA 4BLUA 1HO3A 4D82A 4A23A 3M5PA 4E12A 3P9QA 1PEKE 2CNWA 5FNVB 2VK2A 3WRYA 1KMMA 2H4ZA 1ECCA 4MVJM 4HAIA 5JSKA 1WG8A 3ZCUA 2Q4EA 3HFJA 2HRRA 4BX8A 3T1YO 3EFOA 4H7KA 4RS4A 1LDNA 2HCBA 3D8SA 5FLEX 3A6JA 2COEA 2ZATA 2O8BB 3EQ6A 3NJRA 3M4NA 4HVTA 1JEQB 3OD1A 3KCXA 4UVDA 1T1RA 4OIMA 3L18A 4FYXA 4RTNA 1MR3F 5KBYA 2BSQA 4CV3A 2WFMA 2AYYA 1QK5A 3MOSA 4NH0A 1CT9A 4KJZA 2RSLA 3E8HA 1TQ2A 3R7WA 4W99A 3TGLA 3O9ZA 1VI2A 4Q18A 4NYMR 3E8SA 4Q93A 4F11A 3TGWA 1O5OA 1U02A 3UJNA 3E5MA 1PKEA 1JHXA 2ETXA 4KUGA 1ZBQA 3ZMZA 1NXTA 4ALMA 3O4FA 4EQ6A 1JYEA 4NZMA 2GF2A 4ZZ1A 1R4AA 1GPLA 4L3VA 1T0HB 1HE1C 1PM9A 3UN1A 1KYQA 2HWYA 3JYNA 4L15A 3GEGA 4H33A 3BXXA 3I9V1 1GTMA 3OF2A 4AS1A 3GU3A 4DG9A 2GXSA 3N76A 7MHTA 5BUZA 1L2TA 4BLTA 3GFTA 4D9NA 1BYUA 4X61A 1OKKD 1GXSA 1O94D 4CMGA 1Q0LA 5IE9A 3BS4A 2QRGA 1AU9A 2FSVC 2AK3A 5HQJA 1KDRA 2QGZA 1N8SA 5CHYA 4FKZA 3T54A 3PGJA 4OXXA 5FL3A 4JEUA 4J3NA 5TMPA 4S1PA 5CT9A 1TF2A 4GYCB 1B6TA 3IGAC 4JLNA 4BBZA 3I4FA 4TQUS 1C4OA 2HHHB 3OTGA 2WC1A 1LK0A 2BFMA 4E5NA 2I2BA 3KSMA 4CRWB 2KBFA 3V1KA 5IYZB 4FDUA 4CR6A 2AMLA 4C0QC 1LQUA 1E9EA 3DKPA 5C0OE 4NCAA 2YL2A 4JKOA 1JQ5A 2DULA 4ZO7A 4TMXA 1MJNA 2J5KA 2W6JD 4F3CA 3DDSA 5K3BA 5HYVA 2Y6VA 4EFKA 1KJYA 3SS7X 1HG1A 1KP9A 5B55A 4IDGA 4LV5B 5C93A 4AX8A 4MUGA 2MR5A 1FNCA 3E1SA 2QVYX 4J75A 1JAZA 2YIBA 4ZVUA 4EFDA 3SPJA 4PN7A 1FPQA 2OFWA 2CAZC 1T0UA 1WHSB 4NOMA 4EB3A 5DI3B 3RFXA 5H9CA 1E6KA 4AJKA 1CUFA 2PR2A 1NZDA 3IPAA 3TL2A 1MV5A 3LA8A 1SM4A 2A67A 3SZMA 2VDMB 1TEHA 2X7XA 2C5HA 2ZCUA 1PIWA 4GXRA 1KKCA 2HKIA 1TB4A 5KJEA 3R77A 3LZCA 3ESYA 3HDJA 4CPDA 2YC4C 4XEUA 4I4TB 5DTRA 2ADMA 3PFCA 5J5AA 4KPUA 4EI8A 2Q7EA 3KWJA 1FXWA 1A0OA 1MQ8B 2DLDA 4FDTA