2LW8A

Nmr solution structure of eph receptor
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
183
structure length
183
Chain Sequence
b'GSNEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKAPLTVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 4
publication title NMR solution structure of Eph receptor
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 14
structure length 183
sequence length 183
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2lw8A00
2WQ8A 3OB8A 3WF4A 3BN6A 3FL7A 3A21A 4JKMA 3W5NA 2J1EA 1CZSA 2W94A 1ULOA 1KGYA 1IQDC 5IFTA 4XUNA 2E26A 3IDAA 3LEGA 3I3BA 2WZ8A 3J7HA 2WO2A 2B9VA 2CDPA 5FUIA 3VD3A 4A6OA 5EJ1B 4BXSV 4LPLA 5JXGA 2QQIA 3P6BA 4QX3A 2V5DA 3C7EA 2YG0A 2VZPA 2WYSA 3WF0A 4CVUA 3VDCA 2W92A 2Y8KA 4GWIA 2VMFA 3T0BA 1JYWA 1PMHX 4OMDA 4E8CA 2BBAA 2R7EB 2WAOA 2RV9A 3IAQA 2QQJA 3OEAA 2Y6GA 4W8JA 4RN5A 5CZKA 1JU4A 3NQHA 4FI9A 3HEIA 3D3AA 4DUXA 4M4RA 3U37A 3VD7A 4A45A 4W4ZA 5J1XA 3OG2A 4BJ0A 1GUIA 2PQSA 4A42A 4XUTA 2Y64A 3ABZA 1OH4A 3ETPA 2E32A 5A1AA 1BHGA 2VCAA 2W91A 3VDBA 2YFZA 4PQQA 2QQNA 1NAEA 2LS6A 1P8JA 4JKLA 2W5FA 1DP0A 3ACHA 3WNOA 4P5YA 1GQPA 1O8PA 3IIIA 5DMYA 1UXXX 1CZVA 1JZ3A 5JMOA 1NUKA 2YFUA 3LPFA 3DYMA 2ID4A 2KD7A 2JE8A 3I3DA 1TG7A 1JYVA 4P08A 3SEPA 1UWWA 2QQOA 3MO4A 3I97A 1XC6A 4DEQA 4MOAA 3WNKA 4QX0A 3DYOA 1EUUA 2J1VA 1UMHA 1TVGA 1K42A 3HPNA 4IUGA 1KEXA 3CQOA 2VCCA 1UXZA 3SEEA 3I2KA 4QX1A 1JYXA 3HNMA 2WDBA 4ZY9A 3AC0A 4CU7A 2XONA 1CX1A 4BDVB 2YC2A 4XUOA 1W9SA 3FN9A 2XOMA 4ZZ8A 1UMIA 5I0DA 1EUTA 2DCKA 2WBKA 1JYNA 4ARYA 2VOTA 1SG3A 4QB1A 4ET7A 2VZSA 1OT5A 2VCBA 2WO3A 1RYYA 5JXJA 1UY0A 3K77A 2VJXA 4QB2A 3E1F1 1K12A 3GDBA 2VZOA 2VC9A 3ACIA 3WF2A 1L7RA 2VZTA 2RJ2A 1W9WA 1K3IA 2EIDA 3OGVA 4DXRA 2VMEA 1YQ2A 3MUY1 4JHZA 2C9KA 4L0PA 2DDUA 4UI9L 3K4AA 5B4NA 4M4PA 3PUHA 3THCA 4QX2A 3A23A 4CU8A 2VTFA 1LNSA 3GGLA 3CZUA 4DXTA 2OKXA 1XNAA 1XPWA 1F4AA 4CUCA 2YC4A 2ZEXA 3JXSA 3MV01 3FHAA 5CYYA 4HG6B 4LKSA 5F7UA 2VQUA 3I2FA 4UAPA 2Z4FA 2DCJA 2WN2A 1JZ7A 3CDZB 4XVHA 1UY1A 3FHQA 5JXIA 3OGRA 4P02B 4A44A 1HN1A 5LA1A 3LE0A 1K45A 4JX0A 5C71A 4XUQA 1XNTA 2VM9A 3PUIA 2ZEZA 1PX3A 1UZ0A 1PX4A 3VDAA 2JDAA 2C26A 3CIHA 1JZ5A 2ORXA 3MBWA 3K75B 4CU6A 1JZ2A 4TTGA 3K4DA 4RYDA 1T2XA 3K46A 1JZ4A 3MUZ1 2VL4A 2Y6JA 3CMGA 3HJRA 5EJZB 2BZDA 1OF4A 1D7PM 4AAXA 4W50A 2VMCA 3NJXA 5DQ0A 4KI5M 4MGQA 4MGSA 5DPNA 3I2IA 1NKGA 2QQLA 1GOHA 2VZ1A 4Z2AA 1JZ6A 4QDQA 1PMJX 2X09A 1F4HA 1US2A 3IAPA 4QAWA 2Y6HA 2YB7A 2CDOA 2W1WA 4CUBA 3WNPA 1O8SA 3CZJA 1GU3A 2VZVA 3T0DA 2VZUA 3NRUA 3WSOA 1JU3A 1W9TA 5LA2A 2W1QA 1R64A 4XURA 5JR2A 2V72A 4GWJA 3F2ZA 2VO5A 4OMCA 5C70A 3ACGA 2E33A 3W5MA 3LEKA 5LCWL 2HLEA 1UYXA 3T2OA 1W99A 5G05L 3DECA 3OEBA 5G04L 4DXSA 3OBAA 4E8DA 2QQKA 3MV11 3NJVA 1ULPA 1W8NA 4OZOA 1JI6A 1W8OA 4UOJA 3I2JA 1CZTA 2ZEWA 3WNLA 2J1AA 3WF3A 4LQRA 2WUHA 2X10A 3WEZA 4OUEA 4QDRA 4TXWA 4A3ZA 5C7GA 5IJRA 5LA0A 3DYPA 4DUVA 3WNMA 2QQMA 4CU9A 2WZEA 5IHRA 2V4VA 3C7GA 4AG4A 4D8MA 3ACFA 1I5PA 5IFPA 3WQBA 3BGAA 3WF1A 2WN3A 3HN3A 5JXHA 1NX9A 3CKHA 4MADA 1GNYA 5EIYB 2WO1A 1GOGA 3T0AA 3UNPA 2WAAA 2RVAA 3THDA 2W3JA 5IYYA 4KWUA 3T2QA 1UX7A 2W1UA 3I2HA 4D0QA 2Y6LA 1GMMA 4LHSA 3I2GA 2C4XA 1OD3A 2W9XA 3T08A 2W95A 1DLCA 4XZUG 3ECQA 3LPGA 3C8XA 3A7QA 4OYUA 3UESA 2J1RA 2ZXQA 3HNYM 3LEIA 4PT6A 2W46A 2J7MA 1UYZA 2HYXA 2XHNA 4ZXEA 3IB3A 2VR4A 4MO3M 2J22A 3HNBM 1H6XA 3WNNA 3K4ZA 2WABA 2ORZA 2VZQA 2Y6KA 2VMDA 3C7OA 4QPWA 4A41A 2LW8A 3ZM8A 3VD4A 2BERA 1CIYA 1L7QA 1GOFA 2BGPA 1UY3A 3T09A 4CUAA 2EIEA 1J83A 1SDDB 1WCQA 1DYOA 4XUPA 2X05A 1US3A 1SHWB 2EICA 5JUVA 1MPXA 4QDSA 5HPOA 4JKKA 3A22A 4KMQA 4GZ9A 1UYYA 2QBXA 2J1UA 2JD9A 3OGSA 2ZEYA 4QB6A 4P00B 3EYPA 3T2PA 1O59A 2W1SA 4ZZ5A 1UY4A 4ARXA 5DN2A 3UETA 3NNGA 2EIBA 3I3EA 4YPJA 4DEVA 2W47A 4PF1A 1OF3A 2VQTA 2VZ3A 3VD9A 3LQCA 4BK5A 5HXMA 2JKXA 2VZRA 3SKVA 1J84A 2B4KA 2E31A 2L9LA 3C7FA 3HOBA 3SKJE 2J1TA 2J1SA 1JZ8A 5B4XA 3P1IA 4A4AA 3EB7A 4BK4A 1WKYA 1UY2A 3GM8A 1W0NA 3VD5A 4DUWA 3C7HA 2XQXA 1H6YA 2W87A 1JHJA 2BGOA 3GXUA
chains in the Genus database with same CATH superfamily
2WQ8A 5IUQA 3WF4A 1W2UA 3FL7A 4AFBA 1FXZA 2H6CA 1CZSA 4XIOA 4R4ZA 1HB3A 3H50A 3TYJA 4A7ZA 1XSRA 2P5BA 4LHLA 1KGYA 1YEWA 2WWUA 4NMIA 1IQDC 2BNOA 5FLHA 1G6NA 5LEKA 1YQ6A 5BNPB 1PHMA 4NJ4A 2UU8A 4UW5A 1MEC3 2GSYA 4S2HA 2OUHA 4XACA 2LUWA 5FUIA 2RS53 1I1EA 4BXSV 1ENQA 5JXGA 3HAGA 4GXLA 3P6BA 1NT0A 4M00A 5F3EA 2V5DA 4BM8A 1X50A 2YGLA 2D6KA 1YJLA 2IXJA 3I8TA 2RDNA 2VZPA 2WYSA 4E2GA 3WF0A 4X6QB 2W92A 4OI4A 1T6BX 2DU1A 4FVVA 4W6WA 5DG2A 4EZHA 1PMHX 5CFCA 4XF9A 4YGBA 3M7AA 4E8CA 4LO6B 5DAWA 5FYYA 2B9UA 4MHRA 3S5AA 3KV4A 1GSLA 4EWEA 1AVBA 5C3QA 2RDQA 2RV9A 3LB9A 1FPN3 5A33B 4RHV2 1HB2A 2QQJA 4GIQA 3AXEA 3THTA 2XJUA 2QUOA 2YMZA 4RN5A 3N4MA 1YRZA 2D7FA 2ZX0A 3NQHA 2PTMA 3GZAA 4JV4A 1PVC1 1RB8G 4OLLA 2RHPA 1HRV3 4O65A 1YXWA 4IV3A 4DNYA 1PIV2 3L2HA 3VD7A 3NKGA 2RS12 4FTSA 4E27A 1DGRN 4Q4X1 4Q4V3 4YWAA 1VBD3 1MQTA 3VBUB 2XWJB 3ABZA 3ATGA 5GALA 5KHJA 2E32A 2P37A 4PI0A 5HXVA 1VE0A 4BH9A 2NLRA 2Q1MA 4Q0QA 3VBRA 3ZDVA 1BHGA 2VCAA 4BHPA 4BMEA 3VDBA 1OLME 3WW1A 2QNKA 3O7OA 5IK7A 2QQNA 1CIWA 1S2KA 2GDFA 1NAEA 2I74A 2CWMA 4ES9A 5IVBA 3UKTA 1P8JA 3KSCA 4AFMA 4JKLA 3V0AA 4IV1C 5C33A 1WD3A 4QGLA 1DP0A 1YUDA 2ZACA 3ACHA 4KG0A 4YW2A 1KXGA 2VCMA 1H8VA 2ENRA 2VXRA 4YW6A 3JB4C 1C5IA 4XQWA 3J7MA 3WUCA 5C5TA 2QDNA 2HEVF 2YGMA 2R0FA 2R6QA 3MPBA 1SBEA 2W68A 3J8F1 4WZCA 3BYWA 2Q1ZB 2B7YA 2OYZA 3DYMA 4HMZA 4KGGA 3RWNA 2DTYA 2VBPA 1R1A1 2Z5WA 3H8RA 2WZR3 1A8MA 3CBNA 3J26N 2HH9A 1QQP2 2HWC2 4YYOA 1TME3 1NY71 1AR71 4W6YA 2RS33 5TSWA 1AHSA 3MO4A 4UYBA 1XC6A 2A70A 4AEDC 2JB4A 1F5FA 1ZZCA 2VUAA 2K46A 3RJ2X 4DEQA 2GP5A 2WS92 4COWA 1O7FA 4IDZA 3B9CA 4AI0A 4B7EA 4QX0A 4XFHA 4YFZA 5FYBA 4FQZA 2ZS6B 5A3OA 5KHHA 3BOPA 1OA2A 4YW1A 4LO4B 4PLMA 4IUGA 5FZIA 1SDWA 3WG2A 1M06G 2VCCA 4JGZC 2FDIA 2WL1A 1OQDA 1FATA 4Y22A 5DUUA 4AW7A 1JN2P 3MDPA 1W6MA 3HNMA 2ADDA 1AR63 1CJPA 3WDVA 4KBZA 4ZY9A 2XLFA 4ZU7A 1LHWA 2YUEA 4BIFA 1W6NB 4DOUA 1HB1A 2HWE3 1V70A 5J36A 1CX1A 2A7AA 3CL1A 2AENA 2P17A 4OULA 4C1XA 2CWSA 4O61A 3FN9A 2DVDA 1S0GA 3ZYRA 2V5YA 4ES8A 3DGTA 4ZZ8A 1I6XA 2A1XA 1EUTA 1TNFA 3AB0A 1YQCA 4YZ1A 2KA3A 4FPJA 4YNIA 1QJU3 1LKNA 2VCBA 4O7XA 2JG9A 3QD6A 2WO3A 1RUG2 1RYYA 2NMNA 3AJYA 1JTZX 1IS6A 2VOWA 3K77A 3SCHA 3E1F1 1K12A 4ATFA 3KF3A 1YQ5A 1SLLA 4XF3A 3WQ1A 3J4UH 4N43A 4DIQA 4RGGA 2P6CA 3TEZA 4ISQA 4GD4A 4OHZA 4PLNA 2VE1A 1AJOA 2PHDA 4FSJA 4LBQB 2JG8C 5FYVA 5BPXA 3MUY1 1HIXA 3BU7A 5J48A 5DABA 1TEIA 4UI9L 1U5YA 5FRAA 1FV2A 1FNYA 2HWF1 3G6JB 3PUHA 4BQ4A 2RDRA 5KR7A 4HZFA 3U0ZA 3N36A 2RDSA 5GZDA 4L97A 3VBOA 1B09A 4CEWA 3ZMOA 4Z2WA 5J3UA 4XFIA 2G19A 4Q27A 1VBC3 4J6GA 1D0GA 1R082 4DXTA 1A6CA 2OKXA 3O1UA 4UFMA 5I0UA 3UK9A 4BLJA 5J37A 1BEV3 3NAPB 1XPWA 2W2IA 1LTEA 1PK6C 3FHAA 4MGKE 5CKMA 2BV4A 5CYYA 4HN0A 1A8DA 2RR11 4J1XA 5GLUA 2DUPA 5DXDA 5IAVA 3UJQA 3VGIA 3VKMA 2ILMA 2UY8A 3QOPA 3K3NA 5CFDC 2VQAA 1OMIA 1N47A 2C1FA 3MIDA 2VG9A 4HN1A 3TOJA 1O4YA 4BXFA 1UCXA 2WN2A 4DY3A 4JGYA 1JZ7A 1V6KA 2IFRA 2PAMA 3WG1A 1UY1A 3M3EA 2XVLA 1O6UA 4R9CA 1WCSA 3WR0A 3OGRA 1EYBA 1RVF2 5ABJC 2P3YA 5GM0A 5A7PA 4AEJA 2GH8A 4LEJA 4AHWA 3MHZA 1XNTA 4FXKB 2HYKA 2ZEZA 3P3PA 3ZFEA 2X5IC 1UZ0A 4URTA 3Q8EA 2WSUA 5IVEA 4E9KA 1NCQA 1YI7A 1JZ5A 3JD72 1X9TA 3TRSB 1R093 3VHPA 5FY7A 1UO9A 4RS5B 1HXS2 4IE6A 4XXAA 3POIA 2Q8EA 2WNUA 3OGJA 2JDHA 2DVFA 4NPLA 5JPMB 1EY2A 1E5IA 4Z1VA 1G8WA 2OXBA 4GMP3 3R6SA 4AGGA 4SLIA 5FPVA 3BPZA 2Y6JA 3ZXJA 1GZWB 5FXWA 2BZDA 3O14A 4NO4A 2P1BA 4W50A 5DUVA 1O3RA 5FMCA 2VBBA 4MGSA 2YPDA 2UWCA 2CAVA 4HOOA 1AYN1 2ES3A 4Z2AA 2BFUS 3BI3A 2X09A 3QBQA 2FDFA 2RM23 4Y1ZA 1US2A 4Z92B 3JZVA 3BCWA 1JODA 3Q8AA 5F2SA 1F35A 1DZQA 1OFNA 2Y6HA 4BLIA 5HV4A 4K40A 4EZ4A 2CYFA 3I7DA 4Q4W3 4B3NA 4CDUA 5CG8A 3WLUA 1GNZA 2YB7A 2CDOA 1UD1A 2W1WA 5FZLA 2V73A 4DS0A 4TZDA 2HKXA 3HBZA 3DKQA 3MF6A 2BTVC 4M3CF 1XYOA 3IKWA 2DVGA 5DZFA 2ZX1A 3TEXA 4LBJA 5C8CA 1UF2C 2ZABA 3SCFA 4IGOA 1COV3 5FUPA 4Q29A 2JG8B 1V6JA 3F2ZA 3I2DA 1W3VA 2WIIB 4BB3A 2ZGRA 5FMOL 1AL22 5CISA 1PO12 2VD7A 3LDBA 4NAMA 4HANA 1PO23 2E33A 3W5MA 1OUXA 3LD8A 3VBUA 5LCWL 2H6BA 3FFQA 4QMAA 5A70A 4LIVA 1QJX1 3T2OA 3D8CA 1VB2A 3UGGA 3DECA 1DIWA 2GC0A 5T54A 1EP0A 4ZU5A 3GBGA 3OBAA 4BQ3A 1DLLA 2DVBA 4W65A 2WFPA 2WA3A 3RQ0A 2DURA 2CU5A 2XB6C 1VAVA 4DFSA 2O1QA 1TZOA 5FKBA 1XE0A 1VBB3 5C6CA 1TMF3 4HPKB 3LIHA 5H9QA 5IK4A 4IV3C 3KF5A 1MACA 3U4XA 3Q9OA 1AR92 2XBO2 1VBE1 4RFT0 1DQ2A 1A34A 1H30A 2RG4A 1DQ0A 5LY2A 5K7PA 4YM1A 4WVZA 4FPFA 1NLQA 1ULCA 4HK9A 4OUEA 4QDRA 1MS3A 3APBA 4TXWA 5DDJ1 5FY1A 5IJRA 3U78A 4D3WA 4CU9A 5EYXA 2NPIA 4DUVA 1FOD1 3TBDA 3B69A 1WCUA 1L7LA 1VBA1 3S0MA 4MGTA 2GN3A 4LO5B 3ENRA 1AR81 4JRLA 5K0UC 5BYNA 3BGAA 4TYSA 1C5HA 3UJOA 1YLLA 2P3KA 1OLQA 4CDXA 2PHFA 3W9AA 2FHRA 3PTYA 4WVWA 1GBGA 1GOGA 1XYNA 3KCXA 1POV0 4UW4A 4A7KA 5DAXA 3S5QA 2VPVA 3MLLA 2X5IB 4C0BA 5JOWA 1HQWA 1VLNA 4RR3B 4FPLA 4JVAA 4LJHA 1U5ZA 3SISA 4CEYA 1WW7A 3I59B 4D0QA 4AFDA 3ITQA 1RUH2 1ODMA 3LIGA 2B5HA 4LHSA 3SITA 3H3LA 1AL23 4BU2A 3LA2A 3I2GA 4KG8A 1RXFA 4Y20A 1OD3A 3H0OA 4R9BA 2EAAA 1ZRCA 3AJZA 1DLCA 3AYCA 4XZUG 1PMIA 5FV3A 5FPLA 3ZFGB 1HKDA 4AOCA 1GZCA 2DU0A 4K3UA 4M3CA 1LEDA 1MS4A 4COVA 5JSOA 1XNBA 4CCKA 5KWRA 3E6CC 1MZFA 1W8WA 2BWAA 1IGOA 2JD4A 3M2MA 2ZPXA 3R4DB 2J1RA 5FMBA 1PZ8A 3UKNA 4KQ7A 2QJVA 4ORFA 3LEIA 2ZMLA 1JYIA 3VZKA 1UZVA 4E2SA 2CGNA 1J1LA 3JQWA 4RHV1 1UYZA 3CF6E 1IOAA 2XKOA 4GALA 1RUE2 1SMVA 3IB3A 2VR4A 1YIPA 2WWJA 1H6XA 4O9EA 1LHOA 1GWKA 2ORZA 4QPWA 5L19A 4LOSA 1JXNA 2PFWA 4CRQA 1PIV1 3T09A 1V9U2 2RS11 1BMV2 2EIEA 2ZOEB 5JPNB 2PLV2 4MXVA 3GNEA 4Y5Z0 4XETA 4FQ4A 1UKRA 4JKKA 4KMQA 4S2GA 5I0TA 1JOBA 5JSPA 1OA3A 2D6NA 4QXHA 4RSUA 1Z78A 2ZEYA 3GJBA 4F8AA 1PVC3 3D6EA 3INAA 4UT5A 3GBWA 3THPA 1GYKA 2R072 2FQPA 3PVOA 2P3IA 2Y38A 3AP9A 2QZ2A 3AMNA 4XFCA 2XR4A 4XZPA 4B29A 1WLTA 5FZBA 4PHZA 5JWPA 5DN2A 3UETA 1E5HA 4IL7A 1LRHA 4YZ3A 2EIBA 1T6GC 1WLDA 2IXKA 3ZSEA 1RUJ1 4DEVA 3BIWE 4EV0A 4IV3B 1GANA 3E5UA 3PL0A 2AUYA 1OF3A 5FP9A 3VBOC 4GMP0 2VZ3A 1OXCA 3EMRA 4UW3A 4LA2A 3LQCA 4AL9A 4IV1A 3V0BA 3PMEA 5HXMA 3N7JA 5J96B 1MQTB 4PCRA 3WT3A 5F1RA 2YBKA 1BVVA 3BALA 4IETA 2IXLA 2P3JA 3PU3A 1G86A 3IMMA 1J84A 5KC6A 2PHLA 2HWC1 3JB8A 3DF0A 2GNBA 1YI9A 3C7FA 4IE0A 4XTPA 2R49A 3VBRB 1JZ8A 1HJFA 3UGFA 5LZ6A 3PUQA 2IVJA 3PUAA 1IPJA 2WS91 1G9AA 4MX3A 4Q2FA 3USSA 1WGPA 1Y7BA 4GKYA 1KRIA 1A3KA 1HRI2 1JHJA 2K0GA 2J1VA 4JGYC 3PVEA 2FMDA 3POWA 3VBHC 4BMBA 1V9U3 4AEDA 3V0AB 3ON7A 1RHI3 2VMIA 3A21A 4JKMA 2GC1A 3W5NA 2W94A 1ENRA 5C3OA 1R1A3 1I5ZA 4YRDA 3OUIA 3SLIA 1GZWA 5IFTA 3ES1A 4JGZA 1H9PA 1VRH1 4QT6A 1EAH2 4AWDA 4XFAA 3ZPYA 1FMD2 2CDPA 4A6OA 1NA1C 3CJXA 3POSA 3G7DA 2WJSA 4GJYA 1QOTA 1S2BA 1VJ2A 2R073 3TN93 4QX3A 1MS5A 2NYYA 2YG0A 3C7EA 2D6MA 5A3PA 1PZ7A 1KJLA 2OS2A 3TAYA 1RUD1 3N9OA 3VBFA 5A6QA 5FO7B 1QEXA 4XXPA 5FYIA 3T0BA 2FD8A 1X33A 5JI7A 2B8MA 1ALYA 4OMDA 5C8WA 1D4M2 1Z7S3 3FUQA 3ZYPA 3SCGA 3FJSA 2R7EB 2AZ5A 4L92A 5FZKA 2WAOA 4P5HA 3LKJA 4CE8A 2VW1A 4EE2A 3AVRA 3OEAA 3POJA 4RGKA 4XYXA 4Y22B 4W8JA 4CXWA 3M3CA 4HETA 5KBFA 4A7YA 1REFA 4G3YC 5IVYA 2P2KA 1BLZA 4I01A 5FYZA 3ZN6A 1FV3A 1SLAA 1YJKA 3FUOA 3P5BA 3N7KA 3ZVXA 4UFJA 5F9TA 2WNOA 1WA6X 4A45A 1R081 4LBMA 5J1XA 3DKWA 1HQLA 3KVBA 2YPJA 2PQSA 4TLGA 3DUIA 4ZS3A 2JDZA 1V6NA 3ETPA 2HWB2 2EXKA 3NV2A 3VKNA 3QLQA 4Q4Y2 3N9LA 2JG9B 4I09A 5A1AA 5FZMA 2H0VA 2Q8OA 4K8RB 1H2LA 2W91A 4BE3A 2IUWA 3AK0A 4E2QA 2ATFA 2ZGQA 4FFHA 4QPGA 3N9MA 1LGBA 2ZGUA 4N43B 3BTXA 3AMQA 4HONA 5E6HA 1C8M3 3AP5A 4BPZA 1DGLA 3VBSC 1PK6A 4QD2A 1BBT3 3P3NA 1SFYA 4YZ5A 1NXD1 2LS6A 1Y9QA 4MH0E 2QQPA 1JBCA 2W5FA 1KJRA 4YGCA 5CFDA 3CO2A 3W59A 2BYVE 4FOVA 4P5YA 1QOSA 3PURA 3WCRA 4XJAA 3VBOB 4FPYA 3B9IA 2VUCA 5DMYA 4CEWB 1MEC2 1UXXX 3O12A 4KL1A 4OHYA 2XVGA 2TEPA 3AMPA 1S0JA 2R1DA 2RS52 4IXLA 4QPIC 5JMOA 2CGPA 3RSJA 2QE3A 4QKBA 2VBDA 2EA7A 2ZGMA 5ABJA 3JD71 2VY0A 2KD7A 1JYCA 1GQGA 1UYPA 2OUJA 4P08A 4PBOA 1CD3G 1UWWA 1RUI1 4YVWC 3U07A 3I97A 4JDOA 5FZEA 1OVPA 1ND2C 2Q4SA 1QJY3 2X5IA 4QQHA 4MOAA 5LEJA 2EVXA 4JZRA 5C8CC 3O0WA 2K2SA 2GP3A 3DYOA 4LKDA 1FPN2 4JGYB 1UMHA 5FO9B 5BNNC 3HQRA 4DY5A 5FYSA 3CQOA 5L9BA 4NRPA 4HSJA 1NLSA 1UXZA 1ENXA 2O14A 2R30A 4K8FA 5FXXA 2DBNA 4CDXC 2ZZQA 1HRV2 2D5HA 1ACCA 1JYXA 2C5DA 5BNQA 1CAVA 1UMZA 2SBAA 4Q4V2 4V1PA 5FXVA 3RWKX 1VBD2 3D0JA 4QHZA 3BU0A 1NXMA 3NJZA 3WOGA 2YC2A 3ZFEB 4BDVB 4XUOA 3MW3A 1W9SA 4Q0UA 1AX2A 2QKDA 1AZDA 1NCQB 4N53C 4CEYC 4FFGA 5CNAA 3ZFFA 5L36A 2CSGA 1CVNA 4JQRA 5EXOA 1U12A 2DCKA 3AYAA 3V65A 4GULA 4ARYA 2VOTA 1SG3A 4QB1A 1H4GA 2VZSA 2AYHA 5FQ0A 2WNUB 1OT5A 2V4AA 1GWLA 2VW0A 5JSRA 5ANQA 5JZGC 2B45X 5JXJA 1V6OA 1UY0A 1ZA4A 5H9RA 4N90A 3ASIA 3O1SA 2IZWA 3EXUA 5DZEA 2VC9A 4LBOA 1AYN3 4D7YA 5ANNA 1PGSA 1RUF1 3DV8A 3LSEA 4WM8C 3ZIWA 3DPRC 1L7RA 4IEUA 4R8HA 4FPCA 1PO11 4F7ZA 1AYM3 4NHYA 3KWVA 2A6ZA 3R0RA 1Q3EA 4JDNA 5APAA 4AFAA 2EIDA 3OGVA 4DXRA 3FLTA 4FCAA 3AZVA 4L0PA 5CIRA 1XE8A 3OSDA 1WZXA 5B4NA 1OOPC 1W28A 1IKQA 3LA3A 4LR4A 4A2UA 5L7OA 4MZUA 3A23A 2BGCA 5GKAC 3WP6A 1POQA 4CU8A 4IGPA 4OI0A 2VOXA 2VTFA 4Y3OA 5FWEA 1LOEA 4P9YA 4C90A 5LBEA 3CZUA 2WZR2 4CDUB 4YGDA 1TME2 1ULEA 2DCZA 2RS32 1OKOA 5FZ6A 1XNAA 4CDQA 4XDQA 1AXYA 1AR91 2ZAHA 5F39A 2ZEXA 2XPJA 3O1TA 2DCTA 4CP1A 1H8TC 4D94A 5FKCA 1ASJ3 5F6KA 2HEWF 4MUVA 4XAEA 1QJX3 2W52A 1OQ1A 1UPIA 4LKSA 2G4IA 2VQUA 4G4FA 2Z2SB 4C0HA 2JXAA 3I2FA 1G9BA 5FY8A 2DCJA 1SQ4A 1W2NA 4QXCA 4CCEA 3CDZB 4YFWA 3MEPA 1ZBA3 3LDKA 2WR9A 4P14A 4XFGA 4Y4YA 4D6RA 3FHQA 3KMHA 4UWDA 1AR62 2R043 1JMUB 5IW0A 4XQDA 1VAMA 4P02B 4A44A 2HWE2 1EV13 1VBE3 3QH7A 5EQUA 4JQTA 5K0UA 1K45A 5T5JA 5ISLA 1GICA 1ZRIA 4L99A 3IBMA 4TN7A 4AZZA 3O1MA 1PGW1 3N3HA 4Q8LA 4AQSA 1XNCA 5C71A 3PUIA 1NG0A 1W9YA 1W03A 5LK5A 5FPUA 4QKDA 2B42B 1PX4A 1VBA3 2JDAA 4ZONA 2PQQA 1QJU2 3CIHA 4N7IA 1RUH1 2GZWA 3LZZA 1XU1A 5FZCA 5GJ6A 1JZ2A 4XBLA 3ZIXA 2GALA 3ZDSA 2PHXA 2DVAA 4AEMA 5C8CB 1C28A 2X29A 1U5IA 3FBYA 1W39A 2WLPA 3K4DA 5F32A 1DQ1A 5JVVA 3U1XA 3UKVA 5I0RA 1T2XA 3FLRA 2O0OA 3R4UA 4FPOB 1JZ4A 1CAXA 3FE5A 3MUZ1 5IVCA 1YFWA 4W6XA 1S0DA 4OQ9A 3CMGA 2GC2A 3T4HB 1WWYA 4CYDA 2E63A 1CAWA 3D4KA 4AAXA 4CDXB 3GBFA 3B93A 3BTAA 3RI9A 4META 3WHTA 4BISA 1FNZA 5DPNA 4COYA 2QQLA 3IIAA 1QXRA 2FCVA 2ZHMA 4CZSA 2VZ1A 2PHRA 2UURA 1VBC2 2VXJA 1PMJX 4FFIA 4I30A 4Y33A 3U10A 1RINA 4AQTA 4B1MA 2XGXA 2XXZA 1LOBA 4C91A 1BEV2 1RITA 3HD8B 3K2OA 1L3JA 3JBG3 1MVQA 1W8ZA 4R52A 3WVJA 4CEYB 3ZYHA 3E6DA 1IS5A 1ZA7A 2G9ZA 4K6BA 1O8SA 1BMV1 5I8SA 2BVBA 4UFIA 2VZVA 1BXHA 4WM7A 2Y6FA 4Y20B 2VZUA 3WQ7A 3T0DA 2OW4A 3PMSA 5LK7B 2PLV1 1IQAA 3Q8FA 5IVVA 1W9TA 1XSQA 1N3QA 4BA6A 2IC1A 1SBFA 1W6QA 4L9BA 4M3CB 5GLZA 1LGCA 2PHWA 5JR2A 3PHMA 4H7MA 3DN7A 2ZMKA 1DGWX 4GWJA 3VBFC 5C70A 4H2AA 5KHIA 1POV3 1IKPA 4N9IA 2BOJA 5LBBA 1DGWA 1E5RA 1O4ZA 1WW6A 3HT2A 3CNAA 1KFUL 3OEBA 3AP7A 1VAKA 4XILA 5G04L 4AVBA 1E5SA 1QKQA 3N7MA 3ILRA 4XC9A 4OFGA 4E8DA 1DBNA 3ACLA 2F4PA 4IEXA 3MV11 4Y26A 3MGUA 3T1LA 1OFSA 1R092 4UOJA 1JI6A 2GNMA 1CZTA 3LEMA 2G9FA 2ZEWA 4Q26A 5T52A 4AI2A 1VMFA 3PJYA 4LLOA 3WF3A 3RGBA 3KT4A 4INDA 3H1MA 3AKPA 3KLSA 4D7TA 3HR9A 3MIHA 5A6ZA 1V0AA 1DYPA 1E57A 2DYCA 5LBFA 2Q5TA 2X10A 4H3WA 3WEZA 5FOJB 3OPWA 5C7GA 4A3ZA 2WZEA 1DZTA 1RJ8A 3W20A 2V4VA 3ZLIA 3RZZA 4D8MA 5L73A 1I5PA 4HL0A 4P9JA 3T2TA 2A6YA 3I49A 1XQNA 3GCWA 1AX1A 1OQEA 3MIBA 1WBLA 3WQBA 5LY1A 2ET1A 1WD4A 4QPGC 2XG3A 4GQ7A 5D2AA 5JXHA 1HRI1 3CKHA 4NIHA 1GNYA 4KBBA 5D1IA 5EIYB 2RJLA 2RE9A 4Q1PA 2WO1A 2RM22 4OI1A 1DCSA 4PLOA 3AZWA 1ZRRA 1DQ5A 4XHBA 3K51A 4R9AA 4Q4W2 4AI9A 4AVSA 5FY0A 3NNFA 4LUKA 5FO8B 1O3SA 1VB4A 3BODA 5AFEA 5IYYA 5KXEA 1VMJA 2VNGA 1GFF2 5CB7A 4YG0A 5F2WA 5FR3A 3I2HA 3BUCA 3VBHA 1QIQA 3V0BB 4IV1B 2JDUA 3PUSA 2Y6LA 3BIEA 1EAH1 1BVP1 3BTZA 2ZBJA 2A6WA 3DEMA 1FMD1 2C4XA 3PNAA 4KH9A 4EJRA 1PZ9A 5A1LA 3OD4A 1COV2 3D82A 4MYEA 5FWJA 3BOWA 2UY9A 4ATEA 4X6RB 4GB31 1UU5A 3CJIC 3HT1A 4OCTA 1PO22 5FZ3A 3KHBA 3LFMA 3A7QA 2XJTA 5LRRA 4FBFA 4MGIE 1D4M1 1NA1A 5EPAA 2WZPP 4IEPA 1RGSA 1DYKA 1MR5A 3PJQA 4XJWA 3RG0A 4PT6A 4NOTA 2W46A 4YM0A 4AEDB 3TEYA 1VRH3 1YC61 3H9AA 4FTBA 2HYXA 3EQEA 1X9PA 2XHNA 5FZHA 4ZXEA 1YCIA 1XE7A 1GP5A 3WG4A 1Y9MA 1VBB2 1TMF2 3K4ZA 2WABA 3ES4A 3OY8A 1BYHA 1W8FA 3H3UA 4AGVA 2LW8A 2YV8A 3K48A 1RUC3 1XYPA 3OBTA 2BERA 2LRPA 4IE7A 4JGZB 5EJ3A 3H7YA 1RUD3 1GOFA 2BGPA 2XVKA 5L9VA 1R1ZA 4SBVA 1N1TA 5A6YA 1WCQA 2UYBA 3WDXA 2E7AA 1QDOA 1YIFA 2UWBA 4XUPA 4IERA 2X05A 5FPZA 3QACA 5FP3A 3ZFFC 1PGL1 2HWB1 4QXBA 5JUVA 2WFF1 4Q4Y1 4QDSA 4AI3A 1SZBA 3VBFB 2FCUA 3OBZA 2ZCWA 1CPMA 1RMU1 2A73B 2XJRA 3VDDC 2XKPA 2Z79A 3MLKA 4QB6A 4B4RA 4B7KA 5A3WA 4HVRA 4P00B 3WV6A 3T2PA 3I2OA 5E8AA 2YZ4A 1J1TA 4WVVA 3BVCA 5JIAA 4XF0A 1H2KA 1BCXA 1LOFC 4J25A 4QQPA 2VTXJ 2MNGA 5DUWA 1W0OA 3AZYA 2GU9A 1ND3A 2OPWA 3ZN6B 3VBSA 4LE3A 5FZ0A 3VZMA 3WXPA 2FDHA 1H1IA 1MEC1 4P9GA 4TSVA 2R061 2VQTA 3UYJA 1GKBA 3K3OA 5FMDA 3GF6A 4LK7A 1S55A 3MW4A 1MZEA 5ACA1 2D93A 3M70A 5FMOS 2ZGOA 2MEV1 4LKFA 4ASMB 4HVQA 1TQ5A 1V6IA 2VVEA 5AC91 1LU2A 2D5FA 2Y34A 4LUMA 2E31A 2HWD1 1H2NA 2L9LA 2MHFA 2Y0IA 4YG6A 3HOBA 3SKJE 3ZSMA 3ZPOA 4CCCA 2J1TA 4N7UA 1BZWA 4QPIA 3P1IA 5LASA 4A4AA 3EB7A 4BK4A 1WBFA 3V64A 1WKYA 4JDMA 5E16A 3VLBB 4FFFA 4QPGB 1UY2A 4CPBD 5FZGA 3ME2A 4O9GA 2X53S 1FPN1 1PK6B 4OHVA 1SCRA 2XQXA 1XJAA 1SFNA 3B5LB 1H6YA 2ET7A 2GAUA 3FX3A 4N9HA 5T5LA 3SH5A 3GXUA 3MFAA 4ZXKA 4UBHA 4YVWA 5F3CA 1QH7A 4IE4A 4CP9A 1ZRFA 4RQPC 1ND2A 4NPMA 3BN6A 3O0XA 5CFDB 3ZXFA 1B35A 1ZBE1 4Q0VA 1HRV1 2J1EA 4IEZA 4AQ6A 5C4WA 3RPQA 3VB9A 1W3XA 2WWSA 3B3QE 2PAEA 5BNNA 3GHNA 1RUI3 1PVXA 4B4QA 1C1FA 4LO8A 4ZPIA 2XDVA 4XUNA 5BUVA 2RMU3 1AX0A 2FBEA 3LEGA 3OYWA 5T50A 5ABJB 1S4CA 2FDJA 4XABA 3VD3A 2QQUA 1H1MA 2BJSA 3NSTA 5EJ1B 3GYDA 4LPLA 4NR1A 3H1WA 3RZKA 1QH6A 1W8HA 2WRAA 4YW4A 5AVPA 2XH6A 4LBLA 2DBIA 4IEYA 1PM4A 1PVC2 4CVUA 2Y8KA 4GWIA 1W2OA 3A0NA 1Q8VA 4P9IA 4N53A 3VL8A 1JYWA 1UNBA 2OA2A 1S0IA 5LATA 5T5PA 3M4FA 3KCYA 1UL9A 4Y24A 5T5OA 3SNMA 3PLQA 1C1LA 3NNJA 2BBAA 1WLCA 4NWVA 5FZ9A 5HCFA 4OQ8A 2VNOA 1EPWA 3IAQA 1V6MA 3OD0A 4LE4A 3SC7X 5JZGA 2Y6GA 1BK1A 2D6LX 5FUNA 1QNWA 4PI2A 4DB5A 2FDKA 1JU4A 1F9KA 4FI9A 1CAVB 4WM8A 3RMYA 3DPRA 2KXLA 3HEIA 4YSFA 3D3AA 4DUXA 1JW6A 4CCDA 4M4RA 3OCPA 3U37A 1D0HA 1S0CA 4JRAA 4M01A 4QKFA 3V56A 3MW2A 2XUMA 1J58A 1YWKA 2WZR1 3POBA 4NHLA 4W4ZA 2ZGNA 4MVTA 4BJ0A 1OOPA 3ZFFB 1RUF3 2RS31 3ELNA 5C9AC 2OPKA 4XDPA 5F8PA 5I8TA 3NWKA 4A42A 5KXDA 4XUTA 4AGRA 2GN7A 5FQ0B 1YO8A 1W6OA 2XJVA 4GH4C 2PAKA 1Q5OA 5HCBA 1VMHA 3KQ4B 4WM7C 2Y60A 1F8VA 2WLQA 1ONAA 1W8TA 1GZTA 2VH9A 5LW9A 2AACA 4IESA 3GZEA 3T30A 1OPMA 2QZ3A 3AL6A 3O0VA 1W6PA 2GMPA 1UIKA 3R4SA 4J1WA 5A32A 1IS4A 1QJZA 5FZ4A 1ZZ6A 3J8F2 1SFPA 1XXNA 5EWSA 4B1LA 2VUJA 2AH2A 5F6LB 1RHI2 1H8TA 1UZZA 2BUKA 2CY6A 2WA4A 1K5MC 1R1A2 4AHYA 4BWOA 1AR61 5B2GB 3PVNA 2A3WA 4AXOA 1YHFA 2W39A 1LULA 1GQPA 2HWE1 2JX9A 1WMDA 5L7OB 1O8PA 3IIIA 2GH2A 4MGZE 2JIJA 1WMEA 1CX4A 1XB9A 1NZIA 1FI2A 1QJFA 3ZXAC 4AVVA 1JZ3A 1ZVFA 3ZMNA 4URAA 3DXTA 4CXXA 2YFUA 3LPFA 4GWMA 3TN92 3NMBA 4WVMA 4CDQB 1X7NA 3BB6A 1QY4A 1SPPA 1F15A 1X36A 2UWAA 4QXKA 4YM2A 1TG7A 3R05A 4Q4X3 1QOOA 1X8MA 2ZAAA 1LECA 4P9LA 3SEPA 2D97A 2VTXA 2QQOA 2VMGA 3ZOIA 3B7MA 1Z7S2 3TNPB 5M0TA 4CCNA 4FAHA 4QPYA 3WNKA 5A7OA 1O5LA 4WV8A 2WNVC 3FHIB 3WY6A 2XLGA 4E4SA 3GZTB 2YHJA 4JHTA 3ZYJB 1EUUA 1IG0A 1TVGA 3AP6A 3HPNA 1UU4A 3BKZA 1J59A 2IVIB 3WDYA 1KEXA 3IT8A 3WP5A 3B94A 4K1YA 3MYXA 4L11A 3SEEA 1QQP1 2Y33A 2WO7A 4DMIA 1N3OA 3I2KA 5FBZA 5K0UB 3PVBB 4PF5A 3LOIA 3O1OA 1VBC1 2WDBA 2ETEA 2VNRA 1VALA 1OVSA 3AC0A 4DRVA 1XNKA 4CU7A 1GV9A 3MLJA 1IHMA 3RYPA 2XONA 3M1HA 2ZKLA 3VKLA 1PM7A 3KS7A 4IE5A 4QM8A 1HB4A 4K7JA 3FC0A 1AF9A 1A78A 1ODNA 4NVPA 3J8F3 1NQDA 1UMIA 1HN0A 2WBKA 4MLOA 1V6LA 2F4LA 3QH6A 2JDNA 4YVSA 3B00A 3NJYA 3ST7A 2VVFA 1C8M2 1LOGA 4BOWA 2KM2A 4N8MA 5FY4A 4P9XA 2YY1A 2HEYF 1AR73 1CAXB 3GDBA 1BBT2 3OGGA 4NHKA 2VULA 3WF2A 1NE4A 3HIFA 2A3YA 1CAWB 3WX5A 3E6BA 2VZTA 4I0BA 2RJ2A 2BRTA 3OPTA 1W9WA 1K3IA 4HBNA 4RL7A 4U36A 2VMEA 1YQ2A 4JHZA 1JHNA 5C3PA 2Q30A 3IN9A 4KU7A 5JOZA 5JIUA 3LGRA 3HVDA 1KDKA 5F3IA 3NVCA 1CR7A 1X8EA 1STMA 1RUG1 3M3OA 1UX6A 2OQ7A 3AMMA 1LNSA 5C5UA 4PIZA 3E5QA 1CGPA 3VZJA 4K1ZA 5JOYA 2FDGA 2D6OX 4NIDA 3RFRA 3RRDA 4GH4B 3RYRA 1F4AA 1Q43A 4CUCA 2Z42A 4I3GA 1QJY2 2YC4A 2YBSA 1REEA 1BK0A 3JXSA 4QU2A 4WM7B 5FYUA 5F3GA 4CDWC 3Q8BA 1W2TA 4DRRA 3WINE 4HG6B 3RZHA 3KV9A 4LBKA 3D0SA 1C8NA 1W6QB 1HX6A 5FY5A 3L2YA 1DG6A 4BCUA 5FPXA 1J3QA 4Q5OA 4Z07A 4IEOA 2Q0AA 5FFOC 1UQXA 1JUHA 3S7EA 2VAUA 1CAUA 1KS4A 4XJZA 4IEWA 4XVHA 5FAXA 2FMYA 5BNPC 5JXIA 5CEHA 4L2NA 4AI1A 4M3CE 1HN1A 3LE0A 1TNRA 2LTNA 4ZHNA 2VVDA 1QDCA 1MVEA 4FT8A 4B4PA 4Y1UA 4ZU4A 2R32A 2VOKA 4JX0A 1LB2A 2HWF3 4BQ5A 4XUQA 2D3RA 2UYAA 1ND3C 1O4TA 4OUMA 4BQXA 1DQ4A 3KQRA 5A3MA 2DUQA 2ARAA 3AL5A 1OLMA 1SBDA 4DPNA 1H9WA 3MBWA 2VECA 4CU6A 2EXIA 5K9YA 3RVHA 3W58A 2XMLA 1RVF1 1DF0A 1O5UA 1AYN2 2BOIA 3AZXA 1COV1 3MF9A 5H9PA 3AM2A 3IPVB 3K46A 5F37A 1AYM2 2RR13 4LORA 1UZYA 1PO21 4OVEA 3HJRA 3UGHA 4LIUA 5F5CA 1OF4A 4AEKA 2EF6A 4AVTA 1D7PM 2GNTA 2SLIA 3ILNA 4XFBA 5A7WA 3GCXA 5IT6A 3AKTA 4MGQA 1LR5A 1UKGA 4BIOA 3I2IA 2XQRA 1GOHA 2BU9A 2ARBA 3CJIA 1HXS1 4R9DA 3AXDA 3WW4A 4ASLA 4CSWA 3NNLA 3M3QA 5FPBA 1JZ6A 3OPZA 4UF0A 1B35C 1VBB1 1TMF1 4QAWA 2Y26A 5C4WC 4EWDA 2G1MA 2R1BA 1W06A 4GB33 3VBHB 4HXCA 5FP7A 4QQOA 4LXLA 1ASJ2 1Q8PA 2JIGA 2BEOA 3CZJA 1QJX2 4Y1VA 4JC1A 3NRUA 4CUGA 2YXSA 3WSOA 1JU3A 2IWGB 3LOBA 4LMFA 4RD7A 3WQ0A 4NRMA 2GMMA 2DCYA 1ZBA2 1R64A 3OJBA 2V72A 1D4VB 1WMXA 1HLCA 2D40A 1F31A 4QGMA 4HKLA 2R042 2VO5A 1NA1B 3PDQA 4OMCA 3N9QA 5EZWA 3ACGA 2P6HA 1OLRA 5JCTA 3E5XA 3AX4A 3CEWA 1WMFA 1EV12 1VBE2 1UYXA 2HLEA 3LEKA 4LNVA 4XOGA 4PQ9A 5A3UA 2Q8DA 1OI6A 1HV1A 4XCAA 1W99A 4Y4RA 4AR2A 1G9FA 1KITA 5EP9A 3EBRA 5JDBA 3VDDA 3KCCA 1VBA2 3OY8B 2TUNA 3U4SA 5A6XA 4COUA 1W8OA 4FPEA 3I2JA 1AL21 2V09A 5CBLA 5JMCA 3N7LA 5DAPA 1RXGA 1LOFA 5A7SA 3WNLA 2J1AA 1RMU3 2NM1A 3N9NA 3H7JA 4I02A 2WUHA 5GZGA 3VHOA 4NUBA 2F17A 4NIAA 2YU1A 5FZ8A 4EN7B 4S2FA 2A5ZA 5FYCA 2B46X 4BQWA 1G9DA 1UN1A 2AC1A 4QU1A 3WNMA 1AUYA 5L9RA 3POEA 3ETQA 4LBQD 1KDMA 3C7GA 1S0EA 5FXZA 3SHRA 2KR2A 5IFPA 1GWMA 1JH5A 1NCRC 2R0HA 5HCHA 4QQ2A 2OZJA 1HW5A 3ZXGA 2WN3A 1WCDJ 2QQVA 2YDEA 3GJAA 1MS9A 3SMHA 3D5OA 4MG2A 2CGOA 2WSVA 3HN3A 4NHMA 4MADA 5BNOA 1N1YA 2XBO1 2R063 3M8LA 4KWLA 1Q8SA 2XLAA 2ZHKA 4COZA 1W9FA 3UNPA 5ACA3 2CAUA 3AFGA 1ULGA 2NZ9A 3C3VA 3JBG2 1LHUA 2BBVA 2MEV3 3LCPA 1ND3B 2P4EA 2QVSB 1OKQA 2RVAA 5AC93 3H1YA 3HQXA 3VBSB 4LT5A 1K5JA 2HWD3 1N1VA 4NWWA 1IZ3A 3T1MA 4PDWC 3USUA 3MZHA 2VNVA 2FZ1A 2ZGKA 2Q1FA 4RQPA 3GZUC 3H8OA 2BW8A 4A3XA 2WKKA 1GMMA 1ULDA 4UW6A 3TWIA 5D8AA 1SLBA 5A3LA 3OBRA 1LOAA 3T08A 4FPHA 2W95A 5I0SA 5FBJA 4WZFA 3ECQA 1PNGA 3RZMA 5EV7A 4XW3A 3LA7A 3LPGA 4QPIB 1RJ7A 5DDJ3 3HQUA 1CPNA 1ZBE3 3C8XA 1UW8A 1FOD3 2C24A 5FDBA 1D2SA 3UESA 5D21A 3ZR5A 4ITCA 2ZXQA 4FPGA 4Y5TA 3MICA 1N3PA 3WDTA 1AR83 2WQZC 3RI8A 3I3MA 3E97A 5CG9A 4YVWB 3LAGA 2TNFA 5CVRA 5GZFA 4CP9B 4CPBA 2I45A 1ND2B 1UZWA 3KZ4C 2J7MA 2ZGLA 1B35B 4BYYA 1PNFA 3NAPC 1ZZ9A 1JYTA 1WW4A 5C4WB 3OTFA 2J22A 3HNBM 5JR7B 2ZGSA 5BNNB 2QCSB 2VMDA 2Y6KA 3C7OA 2B39A 2QQWA 2WT1A 4XPVA 3VZOA 3VUOA 3AKRA 1MS8A 1NOVA 2IXIA 5FZOA 3OYWB 4YGEA 4I2OA 5FZFA 4Y5SA 1J83A 3FLPA 1DYOA 4KWKA 1Q56A 4AVCA 1JOPA 2OVUA 2BP6A 4QX7A 1ZZ7A 1RUE1 2W08A 2XJSA 1MPXA 3DCQA 3Q8CA 1NZCA 4GZ9A 4E4HA 1RUJ2 2AEYA 4YVSC 3RMXA 1UPSA 1YFYA 4N53B 3OGSA 1C3HA 1XNDA 3POYA 1SLTA 5C9AA 4YW7A 2NQYA 1V9U1 2WQ4A 4HK8A 2W1SA 3EO6A 5E88A 1RHI1 3AFKA 4GH4A 4X8PA 5GLWA 1RC6A 1W8UA 2DFBA 5JZGB 1LU1A 2IXHA 5J98B 1CONA 4ARXA 3WG3A 2PXJA 1QWRA 5FK7A 3CHXA 4M0HA 3NNGA 1UIJA 2F6BA 4RHV3 1IG3A 1LCLA 3DPRB 4WM8B 5IAXA 4RS5C 1H2MA 5CA6A 4YPJA 4CXYA 2VOVA 1EPZA 4PF1A 4NHXA 3O5SA 2JB8A 2PHUA 3AYDA 3ZYFA 1K5MA 1GP4A 1W0PA 3J7NA 4CCLA 4BK5A 1OOPB 2R071 3TN91 3I4IA 3JU9A 5FCCA 1KD7A 1PIV3 3POGA 1KFXL 4HKWA 5DUXA 2GMEA 2RS13 3S6PA 4ONUA 1OA4A 1W6OB 2AGSA 3SKVA 1D2QA 4OHXA 3FBMA 1LESA 3HMYA 3J7LA 3ZSJA 3ZSKA 1NCRB 1S0BA 5B4XA 1QNYA 1ZYBA 1W05A 3F95A 4CCMA 5KXCA 1Z7S1 1LENA 4F3JA 1HQNA 4H55A 3GM8A 1W6PB 2G9GA 5A32B 4BQ1A 5H9SA 4TWTA 3VD5A 1VRH2 4Y1XA 3O1PA 5EHDA 2W87A 2LM3A 3TNQA 1H8TB 2BGOA 4RGAA 2E7TA 4ISRA 5IWFA 2ZMNA 4XFFA 3AVSA 5FPAA 4FOYA 3VKOA 5K8SA 3OB8A 1O3TA 4AF9A 4QKNA 1HJGA 4PIYA 5AVAA 1O3QA 2WNVA 3HN1A 4OZXA 5FYTA 2JE7A 1RUC2 1ULOA 1GZ9A 3RZJA 3IPVA 4PDWB 4QHOA 5FZAA 1RUD2 4I0WB 5IVFA 5FZ1A 2RJKA 1WCKA 3IM0A 3JCIA 3UL2A 5DZGA 1XU2A 2DTWA 2E26A 3IDAA 1RUJ3 1QXPA 4HT1T 3I3BA 2WZ8A 4NIIA 3FWEA 1S0FA 3J7HA 4WVMB 5A1FA 2YU2A 4ASKA 3VN4A 2WO2A 2B9VA 4RFRB 3SQOA 1SPPB 2BNNA 5I93A 1CN1A 1RIRA 2QQIA 5T3NA 5C3SA 3WW3A 1UOFA 1ZZ8A 3WP4A 2BQPA 1C8M1 3VDCA 2XL7A 4EROA 1QQP3 2DUOA 2HWC3 2VMFA 2E7QA 3KVAA 1WW5A 1BBT1 2EIGA 1SLIA 2JEMA 3H42B 1LHNA 3BPSA 2WS93 1LAJA 3ZX7A 4XMAA 4EN0A 2QTWB 3A0KA 3AP4A 1IPSA 1QJEA 3I54A 3VV1A 1BJQA 5I8YA 5KXBA 1IPKA 2ZZJA 3H8UA 4H7LA 4FXGB 4AK3A 5F5AA 3LDRA 4EQVA 2ZGPA 3OG2A 4CA9A 5LRSA 4OUSA 1GUIA 2CTVA 4AYUA 2A6XA 4AFCA 1DU3D 2JICA 1QJY1 2Y64A 1OH4A 4S2DA 3WCSA 3O1VA 4YVSB 4DO0A 2WC2A 3KD4A 2D98A 1ZZBA 3ZYIB 5CKNA 5JOXA 4Q0PA 4OHWA 2E53A 2N7GA 1MZ5A 1LHVA 4YW5A 4G9SB 1VR3A 2O8QA 1RL3A 1RUG3 2YFZA 4PQQA 4QM9A 4CDWA 3MI8A 4HFSA 4RR3C 4UBGA 1LOCA 3S30A 4K9SA 3PTRB 3PU8A 4XEZA 2ZX3A 1ZM1A 3WNOA 1ZNPA 2E6VA 4UFLA 5K4LA 1RUI2 5T55A 1CWPA 4LK6A 3UT0A 2RMU2 5IK8A 1WLWA 2EAKA 5A7NA 3T4VA 5FZ7A 2EXJA 1RTVA 3ZFGC 3LWCA 3SH4A 1CZVA 1NYWA 3CLPA 1MZ6A 5BNPA 3H3ZA 1NUKA 4R4XA 2Q8CA 1GNHA 2EALA 4XMIA 2LALA 5FYMA 4AVAA 2ID4A 2YYOA 1R083 1OPOA 2BFUL 2JE8A 2QFEA 3I3DA 3ZXLA 4BQ2A 3ZN4A 5FREA 1JYVA 1REDA 1LJ7A 2XUEA 3AKSA 4HSLA 1UU6A 1YFUA 1H0BA 3NNMA 4NPRA 2A71A 2JWPA 2K9ZA 1AYM1 5C3RA 1Y43B 4EYUA 2RS51 3IZOA 3O1RA 4ZKTB 2ZKNA 1CAUB 3KB5A 1K42A 5BY5A 2FZ2A 2PYTA 1ZREA 5A33A 4AHXA 3AYEA 4I0AA 4XJ9A 5BNOC 2ZHLA 4XCBA 3U11A 4QX1A 1LGNA 2BNMA 2ZX2A 3AMHA 4M0NA 2C6SA 1WA4A 5GZEA 4FAGA 1RVF3 3KHCA 1RUF2 1S2EA 1AL0G 3OOXA 2JDYA 4LA3A 2XOMA 1KQRA 4CP2A 3ZO0B 5FJKA 5CFCC 1Q8OA 1ASJ1 4WBBA 4C8DA 4XBNA 5I0DA 1JYNA 4EWAA 4JCKA 4ET7A 5D8AC 4X8NA 4AHZA 2HJIA 2XJQA 2VW2A 3JD73 3NV1A 2OT7A 3UV9A 4NROA 2VJXA 4QB2A 1HXS3 1QXJA 1ZBA1 2VZOA 4Q4V1 3POFA 3ACIA 3S7IA 3LFIA 1VBD1 3ZYGA 4HKOA 1OH3A 5A3TA 4KU8A 1ST8A 1OUSA 5GLTA 1YQ8A 2R041 1MS0A 4F83A 5A7WB 1OURA 5DG1A 1EV11 4MHUA 1VIWB 4KGQA 2C9KA 4GWNA 5HBAA 2DDUA 2I07B 2XJPA 3CJIB 2AREA 3K4AA 4M4PA 1MQTC 1W2AX 1G7YA 3THCA 4PJYA 3NV3A 4UF0B 4QX2A 2JKBA 4OI2A 2TBVA 1ZRDA 3ZSLA 2ZTNA 4Q8KA 5LA9A 3GGLA 3B02A 3VBRC 3RZLA 4Q4X2 2PA7A 3LF7A 3ZXEA 1HV0A 4B8EA 5BXXA 2DF7A 5ERLA 3ZXKA 3HBKA 3SXWA 4YLZA 3S57A 1G9CA 3MV01 1F5JA 3VZNA 2OQ6A 2A3XA 2BVVA 3IDEA 1Z0HA 4Z8BA 5GZCA 3RNSA 3DL3A 4QGNA 2PN5A 4Y1YA 2NP0A 2VQ0A 4BZ4A 5F7UA 3H8XA 1PGW2 4U2AA 5A3NA 4UAPA 2Z4FA 3RYKA 5F5IA 5JI9A 4MXWB 4MSVA 5SV5A 1QHDA 4LO7A 5F5QA 1OBNA 2DWRA 3NV4A 1XRUA 1TME1 3FMGA 2JDPA 2PELA 3KGLA 3PIJA 4QX8A 1YNAA 4YG3A 2XHKA 4Q0SA 2IFWA 1PO13 3L9JT 4FP2A 5E89A 2ZGTA 3WZ1A 1UOBA 5LA1A 4DINB 1NCRA 3B01A 3VDDB 3JBG1 4NAOA 3U75A 5SV8A 1DZRA 1OHFA 3LSDA 2VM9A 1W6NA 1UOGA 5IVJA 2HBTA 4CTEA 1PX3A 4QX5A 4XJ8A 5KHKA 2VU9A 3JQXA 3VDAA 3X29B 3TEWA 1JOJA 4LOTA 5FP8A 2C26A 2VUDA 2X8KA 3VKFC 4FPKA 2ORXA 1LEMA 3ORJA 4JTNA 5AFBA 3JUUA 2WINB 3K75B 1SLCA 1NY72 1AR72 1WUVA 5FLJA 1AR93 2XBO3 4TTGA 5DAQA 4PDWA 1NQJA 2C9AA 4RYDA 4I3PA 3VHRA 2GC3A 2E51A 3HWJA 5FIXA 4JTOA 1POV1 2VL4A 4V2VA 4XF4A 5EJZB 4YW3A 1W04A 3MIGA 4PBPA 4LBQA 5BNOB 1QJU1 2VMCA 3NJXA 5FP4A 1DQ6A 4KI5M 5DQ0A 3VL9A 3RDIA 2YROA 3M3IA 1NKGA 2JJ6A 5LBCA 1Y3TA 1U0AA 1J3RA 4FOWA 1GR3A 1SEFA 3N9PA 4Q1RA 4QDQA 3IWZA 2PHTA 2ARCA 1F4HA 4GJZA 3IAPA 1Y9GA 2OIIA 1CESA 5E1RA 5FLIA 1FAYA 3USUB 1DGRA 2JG9C 3KT1A 3MIEA 4MGYE 5FYHA 4NRQA 4D6QA 4DXZA 4YZ2A 2D3SA 5CFCB 1F2NA 4RQPB 2D44A 4XAAA 3ZN5A 5I91A 1ENSA 5KC5A 4NIGA 4LLFA 1OD5A 1SCSA 2C0ZA 5D8AB 3WNPA 2DV9A 4N43C 3T3YA 3ZR6A 3NAPA 4XIKA 4D7SA 1GU3A 4XE9A 5DAVA 4CP0A 2J42A 1RUH3 2ZX4A 2WNEA 1FT9A 1VP6A 1H4HA 2YC0A 3J9SA 3NW4A 4YZ4A 4IEQA 5FJHA 3FFZA 2W1QA 4XURA 4QQLA 5LA2A 4A6SA 4KWJA 5HV0A 4L8QA 1BEV1 2EXHA 4UFKA 2CNAA 3ALQA 4AQ2A 4QWNA 3WUDA 2PMWB 4LULA 1GLHA 2W0XA 3KV6A 4CEWC 5LWBA 1J3PA 3MPPG 3URFA 4EN8B 1V00A 2HBUA 1SACA 5FOBB 5G05L 5A7QA 5J09A 1C57A 2HWF2 3IMNA 4DXSA 4FO9A 3WP3A 3N35A 3OUJA 2QDRA 4CCOA 1YFXA 3KGZA 4ZS2A 4NN0A 4FP3A 2QQKA 1UOJA 1RUE3 3NJVA 2NN8A 4LHNA 1X82A 1ULPA 1W8NA 4OZOA 1N1SA 4Z82A 1QMJA 3WDUA 5FZOB 3WW2A 4QHBA 4XJUA 1W90A 3GALA 2ADEA 4LQRA 1QGLA 5HCAA 3OF1A 5GLVA 3WNXA 4BQYA 5FY9A 2RR12 2ERFA 4RS5A 5HI0A 5EYYA 2BPA2 1JS9A 4GAZA 5LA0A 1MS1A 3DYPA 3ROUA 2QQMA 2P34A 5IHRA 3BTYA 5CKQA 1BQPA 4H14A 4AG4A 3ACFA 2PLV3 3WDWA 4LBNA 4RA0A 1R091 3WF1A 2A6VA 2BWCA 5C9AB 2A75A 3EJKA 1FYUA 2XWBB 3NKTA 3GHMA 4P9WA 3U14A 4YM3A 1NX9A 2GNDA 2MPFA 3ZFEC 1AJKA 4FTEA 4GMP1 4D6SA 1QF3A 3T0AA 1NCQC 2D3PA 2WAAA 2CL2A 4UXAA 2AEZA 4XTMA 4GB32 1RUC1 1APNA 1DHKB 2OZ6A 3TB0A 1AXKA 4IGQA 2W3JA 2CV6A 3THDA 2WNUC 1XBFA 2IXCA 2XL9A 4KWUA 4D69A 3T2QA 1UX7A 4DQAA 1VRBA 2W1UA 4JAAA 1K5MB 3KM5A 2FCTA 5J7MA 3MFCA 4XF1A 5CADA 1DFQA 3A4UA 4K20A 5CAZA 3RZGA 2Y0OA 1IS3A 2VMHA 2RM21 1CQ9A 2W9XA 4XQ4A 1C4RA 1M4WA 4IW3A 4YARA 3I3QA 2LROA 2JENA 5JAXA 1W6MB 4AE2A 3AZZA 4Q4W1 1NLRA 3AKQA 2JDKA 3W21A 5FTTC 3IDCB 2I2SA 2D6PA 4OYUA 1OSGA 2JG8A 2R16A 3C2UA 3WHUA 5A80A 2JDMA 3PIGA 1OC1A 3HNYM 2OX0A 1NE6A 3IDBB 4E4ZA 4CDUC 4XDOA 4NE9A 4GKXA 4HVOA 1CJDA 1HRI3 2YBPA 1PGL2 2WNVB 3QCWA 1FX5A 1ULFA 2ZA9A 2WFF2 3ILFA 4MO3M 3WD5A 1U5XA 2ZJCA 4LITA 3WNNA 1ZX5A 2VZQA 4PIXA 1RMU2 3NO8A 4A41A 5CU1A 4E4DX 4EN6B 4C1WA 3KV5A 3ZM8A 2ZHNA 4LHKA 1CIYA 1LODA 2CHHA 3ZKYA 4XHXA 3VD4A 1HDKA 1L7QA 1UY3A 4HPKA 3CU7A 4CUAA 5IK5A 2H0BA 4XBQA 1SDDB 1I3HA 2Z69A 4AI8A 4TLFA 2DFCA 1US3A 4V2WA 1JUIA 1EAH3 1SHWB 1TE1B 2EICA 3NL1A 3VBUC 1AXZA 1FMD3 5L7OC 4CDQC 2AR6A 2O8OA 3KT7A 3A22A 5HPOA 1YYNA 4IQPA 3OUHA 1UYYA 1XOYA 2QBXA 2J1UA 2JD9A 2WYFA 3SH3A 1VPHA 1BKZA 2R062 1O91A 1Q8QA 1QU0A 5KHGA 3EYPA 1O59A 4LTAA 5FK8A 5ACA2 1URXA 2D43A 2JECA 2MEV2 4ZZ5A 1D4M3 4CUBA 1GQHA 3VHNA 1UY4A 5AC92 4LKEA 5IATA 3ZXDA 2HWD2 3EHKA 1S1AA 5LB6A 3I3EA 2RMU1 1RUNA 4HLTA 2ARXA 2WT2A 3ZYBA 1H1AA 1GP6A 2W47A 4RR3A 2BDRA 3RJRA 4MXWA 3FZ3A 3VD9A 3I59A 5FZDA 2WT0A 1I9RA 4AAPA 2JKXA 1KS5A 4FOQA 3ZKUA 2VZRA 5DDJ2 2B4KA 1ZBE2 4GA9A 4EN9B 1FOD2 3ZFGA 4KNCA 2J1SA 2VGDA 4CCJA 5JLVA 3VZLA 5BV6A 1AR82 2HWB3 2WFF3 1W0NA 4Q4Y3 1RUOA 3DXUA 2JE9A 5EFUA 3MIFA 1DDLA 1UAIA 4K21A 3RS6A 4IEVA 4DUWA 4CDWB 2E9QA 2NMOA 3C7HA 4DZGA 4MV2A 4UFHA 5CZKA 1Y4WA
chains in the Genus database with same CATH topology
2WQ8A 3OB8A 3WF4A 3BN6A 3FL7A 3A21A 4JKMA 3W5NA 2J1EA 1CZSA 2W94A 1ULOA 1KGYA 1IQDC 5IFTA 4XUNA 2E26A 3IDAA 3LEGA 3I3BA 2WZ8A 3J7HA 2WO2A 2B9VA 2CDPA 5FUIA 3VD3A 4A6OA 5EJ1B 4BXSV 4LPLA 5JXGA 2QQIA 3P6BA 4QX3A 2V5DA 3C7EA 2YG0A 2VZPA 2WYSA 3WF0A 4CVUA 3VDCA 2W92A 2Y8KA 4GWIA 2VMFA 3T0BA 1JYWA 1PMHX 4OMDA 4E8CA 2BBAA 2R7EB 2WAOA 2RV9A 3IAQA 2QQJA 3OEAA 2Y6GA 4W8JA 4RN5A 5CZKA 1JU4A 3NQHA 4FI9A 3HEIA 3D3AA 4DUXA 4M4RA 3U37A 3VD7A 4A45A 4W4ZA 5J1XA 3OG2A 4BJ0A 1GUIA 2PQSA 4A42A 4XUTA 2Y64A 3ABZA 1OH4A 3ETPA 2E32A 5A1AA 1BHGA 2VCAA 2W91A 3VDBA 2YFZA 4PQQA 2QQNA 1NAEA 2LS6A 1P8JA 4JKLA 2W5FA 1DP0A 3ACHA 3WNOA 4P5YA 1GQPA 1O8PA 3IIIA 5DMYA 1UXXX 1CZVA 1JZ3A 5JMOA 1NUKA 2YFUA 3LPFA 3DYMA 2ID4A 2KD7A 2JE8A 3I3DA 1TG7A 1JYVA 4P08A 3SEPA 1UWWA 2QQOA 3MO4A 3I97A 1XC6A 4DEQA 4MOAA 3WNKA 4QX0A 3DYOA 1EUUA 2J1VA 1UMHA 1TVGA 1K42A 3HPNA 4IUGA 1KEXA 3CQOA 2VCCA 1UXZA 3SEEA 3I2KA 4QX1A 1JYXA 3HNMA 2WDBA 4ZY9A 3AC0A 4CU7A 2XONA 1CX1A 4BDVB 2YC2A 4XUOA 1W9SA 3FN9A 2XOMA 4ZZ8A 1UMIA 5I0DA 1EUTA 2DCKA 2WBKA 1JYNA 4ARYA 2VOTA 1SG3A 4QB1A 4ET7A 2VZSA 1OT5A 2VCBA 2WO3A 1RYYA 5JXJA 1UY0A 3K77A 2VJXA 4QB2A 3E1F1 1K12A 3GDBA 2VZOA 2VC9A 3ACIA 3WF2A 1L7RA 2VZTA 2RJ2A 1W9WA 1K3IA 2EIDA 3OGVA 4DXRA 2VMEA 1YQ2A 3MUY1 4JHZA 2C9KA 4L0PA 2DDUA 4UI9L 3K4AA 5B4NA 4M4PA 3PUHA 3THCA 4QX2A 3A23A 4CU8A 2VTFA 1LNSA 3GGLA 3CZUA 4DXTA 2OKXA 1XNAA 1XPWA 1F4AA 4CUCA 2YC4A 2ZEXA 3JXSA 3MV01 3FHAA 5CYYA 4HG6B 4LKSA 5F7UA 2VQUA 3I2FA 4UAPA 2Z4FA 2DCJA 2WN2A 1JZ7A 3CDZB 4XVHA 1UY1A 3FHQA 5JXIA 3OGRA 4P02B 4A44A 1HN1A 5LA1A 3LE0A 1K45A 4JX0A 5C71A 4XUQA 1XNTA 2VM9A 3PUIA 2ZEZA 1PX3A 1UZ0A 1PX4A 3VDAA 2JDAA 2C26A 3CIHA 1JZ5A 2ORXA 3MBWA 3K75B 4CU6A 1JZ2A 4TTGA 3K4DA 4RYDA 1T2XA 3K46A 1JZ4A 3MUZ1 2VL4A 2Y6JA 3CMGA 3HJRA 5EJZB 2BZDA 1OF4A 1D7PM 4AAXA 4W50A 2VMCA 3NJXA 5DQ0A 4KI5M 4MGQA 4MGSA 5DPNA 3I2IA 1NKGA 2QQLA 1GOHA 2VZ1A 4Z2AA 1JZ6A 4QDQA 1PMJX 2X09A 1F4HA 1US2A 3IAPA 4QAWA 2Y6HA 2YB7A 2CDOA 2W1WA 4CUBA 3WNPA 1O8SA 3CZJA 1GU3A 2VZVA 3T0DA 2VZUA 3NRUA 3WSOA 1JU3A 1W9TA 5LA2A 2W1QA 1R64A 4XURA 5JR2A 2V72A 4GWJA 3F2ZA 2VO5A 4OMCA 5C70A 3ACGA 2E33A 3W5MA 3LEKA 5LCWL 2HLEA 1UYXA 3T2OA 1W99A 5G05L 3DECA 3OEBA 5G04L 4DXSA 3OBAA 4E8DA 2QQKA 3MV11 3NJVA 1ULPA 1W8NA 4OZOA 1JI6A 1W8OA 4UOJA 3I2JA 1CZTA 2ZEWA 3WNLA 2J1AA 3WF3A 4LQRA 2WUHA 2X10A 3WEZA 4OUEA 4QDRA 4TXWA 4A3ZA 5C7GA 5IJRA 5LA0A 3DYPA 4DUVA 3WNMA 2QQMA 4CU9A 2WZEA 5IHRA 2V4VA 3C7GA 4AG4A 4D8MA 3ACFA 1I5PA 5IFPA 3WQBA 3BGAA 3WF1A 2WN3A 3HN3A 5JXHA 1NX9A 3CKHA 4MADA 1GNYA 5EIYB 2WO1A 1GOGA 3T0AA 3UNPA 2WAAA 2RVAA 3THDA 2W3JA 5IYYA 4KWUA 3T2QA 1UX7A 2W1UA 3I2HA 4D0QA 2Y6LA 1GMMA 4LHSA 3I2GA 2C4XA 1OD3A 2W9XA 3T08A 2W95A 1DLCA 4XZUG 3ECQA 3LPGA 3C8XA 3A7QA 4OYUA 3UESA 2J1RA 2ZXQA 3HNYM 3LEIA 4PT6A 2W46A 2J7MA 1UYZA 2HYXA 2XHNA 4ZXEA 3IB3A 2VR4A 4MO3M 2J22A 3HNBM 1H6XA 3WNNA 3K4ZA 2WABA 2ORZA 2VZQA 2Y6KA 2VMDA 3C7OA 4QPWA 4A41A 2LW8A 3ZM8A 3VD4A 2BERA 1CIYA 1L7QA 1GOFA 2BGPA 1UY3A 3T09A 4CUAA 2EIEA 1J83A 1SDDB 1WCQA 1DYOA 4XUPA 2X05A 1US3A 1SHWB 2EICA 5JUVA 1MPXA 4QDSA 5HPOA 4JKKA 3A22A 4KMQA 4GZ9A 1UYYA 2QBXA 2J1UA 2JD9A 3OGSA 2ZEYA 4QB6A 4P00B 3EYPA 3T2PA 1O59A 2W1SA 4ZZ5A 1UY4A 4ARXA 5DN2A 3UETA 3NNGA 2EIBA 3I3EA 4YPJA 4DEVA 2W47A 4PF1A 1OF3A 2VQTA 2VZ3A 3VD9A 3LQCA 4BK5A 5HXMA 2JKXA 2VZRA 3SKVA 1J84A 2B4KA 2E31A 2L9LA 3C7FA 3HOBA 3SKJE 2J1TA 2J1SA 1JZ8A 5B4XA 3P1IA 4A4AA 3EB7A 4BK4A 1WKYA 1UY2A 3GM8A 1W0NA 3VD5A 4DUWA 3C7HA 2XQXA 1H6YA 2W87A 1JHJA 2BGOA 3GXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WQ8 A;  3OB8 A;  3WF4 A;  3BN6 A;  3FL7 A;  3A21 A;  4JKM A;  3W5N A;  2J1E A;  1CZS A;  2W94 A;  1ULO A;  1KGY A;  1IQD C;  5IFT A;  4XUN A;  2E26 A;  3IDA A;  3LEG A;  3I3B A;  2WZ8 A;  3J7H A;  2WO2 A;  2B9V A;  2CDP A;  5FUI A;  3VD3 A;  4A6O A;  5EJ1 B;  4BXS V;  4LPL A;  5JXG A;  2QQI A;  3P6B A;  4QX3 A;  2V5D A;  3C7E A;  2YG0 A;  2VZP A;  2WYS A;  3WF0 A;  4CVU A;  3VDC A;  2W92 A;  2Y8K A;  4GWI A;  2VMF A;  3T0B A;  1JYW A;  1PMH X;  4OMD A;  4E8C A;  2BBA A;  2R7E B;  2WAO A;  2RV9 A;  3IAQ A;  2QQJ A;  3OEA A;  2Y6G A;  4W8J A;  4RN5 A;  5CZK A;  1JU4 A;  3NQH A;  4FI9 A;  3HEI A;  3D3A A;  4DUX A;  4M4R A;  3U37 A;  3VD7 A;  4A45 A;  4W4Z A;  5J1X A;  3OG2 A;  4BJ0 A;  1GUI A;  2PQS A;  4A42 A;  4XUT A;  2Y64 A;  3ABZ A;  1OH4 A;  3ETP A;  2E32 A;  5A1A A;  1BHG A;  2VCA A;  2W91 A;  3VDB A;  2YFZ A;  4PQQ A;  2QQN A;  1NAE A;  2LS6 A;  1P8J A;  4JKL A;  2W5F A;  1DP0 A;  3ACH A;  3WNO A;  4P5Y A;  1GQP A;  1O8P A;  3III A;  5DMY A;  1UXX X;  1CZV A;  1JZ3 A;  5JMO A;  1NUK A;  2YFU A;  3LPF A;  3DYM A;  2ID4 A;  2KD7 A;  2JE8 A;  3I3D A;  1TG7 A;  1JYV A;  4P08 A;  3SEP A;  1UWW A;  2QQO A;  3MO4 A;  3I97 A;  1XC6 A;  4DEQ A;  4MOA A;  3WNK A;  4QX0 A;  3DYO A;  1EUU A;  2J1V A;  1UMH A;  1TVG A;  1K42 A;  3HPN A;  4IUG A;  1KEX A;  3CQO A;  2VCC A;  1UXZ A;  3SEE A;  3I2K A;  4QX1 A;  1JYX A;  3HNM A;  2WDB A;  4ZY9 A;  3AC0 A;  4CU7 A;  2XON A;  1CX1 A;  4BDV B;  2YC2 A;  4XUO A;  1W9S A;  3FN9 A;  2XOM A;  4ZZ8 A;  1UMI A;  5I0D A;  1EUT A;  2DCK A;  2WBK A;  1JYN A;  4ARY A;  2VOT A;  1SG3 A;  4QB1 A;  4ET7 A;  2VZS A;  1OT5 A;  2VCB A;  2WO3 A;  1RYY A;  5JXJ A;  1UY0 A;  3K77 A;  2VJX A;  4QB2 A;  3E1F 1;  1K12 A;  3GDB A;  2VZO A;  2VC9 A;  3ACI A;  3WF2 A;  1L7R A;  2VZT A;  2RJ2 A;  1W9W A;  1K3I A;  2EID A;  3OGV A;  4DXR A;  2VME A;  1YQ2 A;  3MUY 1;  4JHZ A;  2C9K A;  4L0P A;  2DDU A;  4UI9 L;  3K4A A;  5B4N A;  4M4P A;  3PUH A;  3THC A;  4QX2 A;  3A23 A;  4CU8 A;  2VTF A;  1LNS A;  3GGL A;  3CZU A;  4DXT A;  2OKX A;  1XNA A;  1XPW A;  1F4A A;  4CUC A;  2YC4 A;  2ZEX A;  3JXS A;  3MV0 1;  3FHA A;  5CYY A;  4HG6 B;  4LKS A;  5F7U A;  2VQU A;  3I2F A;  4UAP A;  2Z4F A;  2DCJ A;  2WN2 A;  1JZ7 A;  3CDZ B;  4XVH A;  1UY1 A;  3FHQ A;  5JXI A;  3OGR A;  4P02 B;  4A44 A;  1HN1 A;  5LA1 A;  3LE0 A;  1K45 A;  4JX0 A;  5C71 A;  4XUQ A;  1XNT A;  2VM9 A;  3PUI A;  2ZEZ A;  1PX3 A;  1UZ0 A;  1PX4 A;  3VDA A;  2JDA A;  2C26 A;  3CIH A;  1JZ5 A;  2ORX A;  3MBW A;  3K75 B;  4CU6 A;  1JZ2 A;  4TTG A;  3K4D A;  4RYD A;  1T2X A;  3K46 A;  1JZ4 A;  3MUZ 1;  2VL4 A;  2Y6J A;  3CMG A;  3HJR A;  5EJZ B;  2BZD A;  1OF4 A;  1D7P M;  4AAX A;  4W50 A;  2VMC A;  3NJX A;  5DQ0 A;  4KI5 M;  4MGQ A;  4MGS A;  5DPN A;  3I2I A;  1NKG A;  2QQL A;  1GOH A;  2VZ1 A;  4Z2A A;  1JZ6 A;  4QDQ A;  1PMJ X;  2X09 A;  1F4H A;  1US2 A;  3IAP A;  4QAW A;  2Y6H A;  2YB7 A;  2CDO A;  2W1W A;  4CUB A;  3WNP A;  1O8S A;  3CZJ A;  1GU3 A;  2VZV A;  3T0D A;  2VZU A;  3NRU A;  3WSO A;  1JU3 A;  1W9T A;  5LA2 A;  2W1Q A;  1R64 A;  4XUR A;  5JR2 A;  2V72 A;  4GWJ A;  3F2Z A;  2VO5 A;  4OMC A;  5C70 A;  3ACG A;  2E33 A;  3W5M A;  3LEK A;  5LCW L;  2HLE A;  1UYX A;  3T2O A;  1W99 A;  5G05 L;  3DEC A;  3OEB A;  5G04 L;  4DXS A;  3OBA A;  4E8D A;  2QQK A;  3MV1 1;  3NJV A;  1ULP A;  1W8N A;  4OZO A;  1JI6 A;  1W8O A;  4UOJ A;  3I2J A;  1CZT A;  2ZEW A;  3WNL A;  2J1A A;  3WF3 A;  4LQR A;  2WUH A;  2X10 A;  3WEZ A;  4OUE A;  4QDR A;  4TXW A;  4A3Z A;  5C7G A;  5IJR A;  5LA0 A;  3DYP A;  4DUV A;  3WNM A;  2QQM A;  4CU9 A;  2WZE A;  5IHR A;  2V4V A;  3C7G A;  4AG4 A;  4D8M A;  3ACF A;  1I5P A;  5IFP A;  3WQB A;  3BGA A;  3WF1 A;  2WN3 A;  3HN3 A;  5JXH A;  1NX9 A;  3CKH A;  4MAD A;  1GNY A;  5EIY B;  2WO1 A;  1GOG A;  3T0A A;  3UNP A;  2WAA A;  2RVA A;  3THD A;  2W3J A;  5IYY A;  4KWU A;  3T2Q A;  1UX7 A;  2W1U A;  3I2H A;  4D0Q A;  2Y6L A;  1GMM A;  4LHS A;  3I2G A;  2C4X A;  1OD3 A;  2W9X A;  3T08 A;  2W95 A;  1DLC A;  4XZU G;  3ECQ A;  3LPG A;  3C8X A;  3A7Q A;  4OYU A;  3UES A;  2J1R A;  2ZXQ A;  3HNY M;  3LEI A;  4PT6 A;  2W46 A;  2J7M A;  1UYZ A;  2HYX A;  2XHN A;  4ZXE A;  3IB3 A;  2VR4 A;  4MO3 M;  2J22 A;  3HNB M;  1H6X A;  3WNN A;  3K4Z A;  2WAB A;  2ORZ A;  2VZQ A;  2Y6K A;  2VMD A;  3C7O A;  4QPW A;  4A41 A;  2LW8 A;  3ZM8 A;  3VD4 A;  2BER A;  1CIY A;  1L7Q A;  1GOF A;  2BGP A;  1UY3 A;  3T09 A;  4CUA A;  2EIE A;  1J83 A;  1SDD B;  1WCQ A;  1DYO A;  4XUP A;  2X05 A;  1US3 A;  1SHW B;  2EIC A;  5JUV A;  1MPX A;  4QDS A;  5HPO A;  4JKK A;  3A22 A;  4KMQ A;  4GZ9 A;  1UYY A;  2QBX A;  2J1U A;  2JD9 A;  3OGS A;  2ZEY A;  4QB6 A;  4P00 B;  3EYP A;  3T2P A;  1O59 A;  2W1S A;  4ZZ5 A;  1UY4 A;  4ARX A;  5DN2 A;  3UET A;  3NNG A;  2EIB A;  3I3E A;  4YPJ A;  4DEV A;  2W47 A;  4PF1 A;  1OF3 A;  2VQT A;  2VZ3 A;  3VD9 A;  3LQC A;  4BK5 A;  5HXM A;  2JKX A;  2VZR A;  3SKV A;  1J84 A;  2B4K A;  2E31 A;  2L9L A;  3C7F A;  3HOB A;  3SKJ E;  2J1T A;  2J1S A;  1JZ8 A;  5B4X A;  3P1I A;  4A4A A;  3EB7 A;  4BK4 A;  1WKY A;  1UY2 A;  3GM8 A;  1W0N A;  3VD5 A;  4DUW A;  3C7H A;  2XQX A;  1H6Y A;  2W87 A;  1JHJ A;  2BGO A;  3GXU A; 
#chains in the Genus database with same CATH topology
 2WQ8 A;  5IUQ A;  3WF4 A;  1W2U A;  3FL7 A;  4AFB A;  1FXZ A;  2H6C A;  1CZS A;  4XIO A;  4R4Z A;  1HB3 A;  3H50 A;  3TYJ A;  4A7Z A;  1XSR A;  2P5B A;  4LHL A;  1KGY A;  1YEW A;  2WWU A;  4NMI A;  1IQD C;  2BNO A;  5FLH A;  1G6N A;  5LEK A;  1YQ6 A;  5BNP B;  1PHM A;  4NJ4 A;  2UU8 A;  4UW5 A;  1MEC 3;  2GSY A;  4S2H A;  2OUH A;  4XAC A;  2LUW A;  5FUI A;  2RS5 3;  1I1E A;  4BXS V;  1ENQ A;  5JXG A;  3HAG A;  4GXL A;  3P6B A;  1NT0 A;  4M00 A;  5F3E A;  2V5D A;  4BM8 A;  1X50 A;  2YGL A;  2D6K A;  1YJL A;  2IXJ A;  3I8T A;  2RDN A;  2VZP A;  2WYS A;  4E2G A;  3WF0 A;  4X6Q B;  2W92 A;  4OI4 A;  1T6B X;  2DU1 A;  4FVV A;  4W6W A;  5DG2 A;  4EZH A;  1PMH X;  5CFC A;  4XF9 A;  4YGB A;  3M7A A;  4E8C A;  4LO6 B;  5DAW A;  5FYY A;  2B9U A;  4MHR A;  3S5A A;  3KV4 A;  1GSL A;  4EWE A;  1AVB A;  5C3Q A;  2RDQ A;  2RV9 A;  3LB9 A;  1FPN 3;  5A33 B;  4RHV 2;  1HB2 A;  2QQJ A;  4GIQ A;  3AXE A;  3THT A;  2XJU A;  2QUO A;  2YMZ A;  4RN5 A;  3N4M A;  1YRZ A;  2D7F A;  2ZX0 A;  3NQH A;  2PTM A;  3GZA A;  4JV4 A;  1PVC 1;  1RB8 G;  4OLL A;  2RHP A;  1HRV 3;  4O65 A;  1YXW A;  4IV3 A;  4DNY A;  1PIV 2;  3L2H A;  3VD7 A;  3NKG A;  2RS1 2;  4FTS A;  4E27 A;  1DGR N;  4Q4X 1;  4Q4V 3;  4YWA A;  1VBD 3;  1MQT A;  3VBU B;  2XWJ B;  3ABZ A;  3ATG A;  5GAL A;  5KHJ A;  2E32 A;  2P37 A;  4PI0 A;  5HXV A;  1VE0 A;  4BH9 A;  2NLR A;  2Q1M A;  4Q0Q A;  3VBR A;  3ZDV A;  1BHG A;  2VCA A;  4BHP A;  4BME A;  3VDB A;  1OLM E;  3WW1 A;  2QNK A;  3O7O A;  5IK7 A;  2QQN A;  1CIW A;  1S2K A;  2GDF A;  1NAE A;  2I74 A;  2CWM A;  4ES9 A;  5IVB A;  3UKT A;  1P8J A;  3KSC A;  4AFM A;  4JKL A;  3V0A A;  4IV1 C;  5C33 A;  1WD3 A;  4QGL A;  1DP0 A;  1YUD A;  2ZAC A;  3ACH A;  4KG0 A;  4YW2 A;  1KXG A;  2VCM A;  1H8V A;  2ENR A;  2VXR A;  4YW6 A;  3JB4 C;  1C5I A;  4XQW A;  3J7M A;  3WUC A;  5C5T A;  2QDN A;  2HEV F;  2YGM A;  2R0F A;  2R6Q A;  3MPB A;  1SBE A;  2W68 A;  3J8F 1;  4WZC A;  3BYW A;  2Q1Z B;  2B7Y A;  2OYZ A;  3DYM A;  4HMZ A;  4KGG A;  3RWN A;  2DTY A;  2VBP A;  1R1A 1;  2Z5W A;  3H8R A;  2WZR 3;  1A8M A;  3CBN A;  3J26 N;  2HH9 A;  1QQP 2;  2HWC 2;  4YYO A;  1TME 3;  1NY7 1;  1AR7 1;  4W6Y A;  2RS3 3;  5TSW A;  1AHS A;  3MO4 A;  4UYB A;  1XC6 A;  2A70 A;  4AED C;  2JB4 A;  1F5F A;  1ZZC A;  2VUA A;  2K46 A;  3RJ2 X;  4DEQ A;  2GP5 A;  2WS9 2;  4COW A;  1O7F A;  4IDZ A;  3B9C A;  4AI0 A;  4B7E A;  4QX0 A;  4XFH A;  4YFZ A;  5FYB A;  4FQZ A;  2ZS6 B;  5A3O A;  5KHH A;  3BOP A;  1OA2 A;  4YW1 A;  4LO4 B;  4PLM A;  4IUG A;  5FZI A;  1SDW A;  3WG2 A;  1M06 G;  2VCC A;  4JGZ C;  2FDI A;  2WL1 A;  1OQD A;  1FAT A;  4Y22 A;  5DUU A;  4AW7 A;  1JN2 P;  3MDP A;  1W6M A;  3HNM A;  2ADD A;  1AR6 3;  1CJP A;  3WDV A;  4KBZ A;  4ZY9 A;  2XLF A;  4ZU7 A;  1LHW A;  2YUE A;  4BIF A;  1W6N B;  4DOU A;  1HB1 A;  2HWE 3;  1V70 A;  5J36 A;  1CX1 A;  2A7A A;  3CL1 A;  2AEN A;  2P17 A;  4OUL A;  4C1X A;  2CWS A;  4O61 A;  3FN9 A;  2DVD A;  1S0G A;  3ZYR A;  2V5Y A;  4ES8 A;  3DGT A;  4ZZ8 A;  1I6X A;  2A1X A;  1EUT A;  1TNF A;  3AB0 A;  1YQC A;  4YZ1 A;  2KA3 A;  4FPJ A;  4YNI A;  1QJU 3;  1LKN A;  2VCB A;  4O7X A;  2JG9 A;  3QD6 A;  2WO3 A;  1RUG 2;  1RYY A;  2NMN A;  3AJY A;  1JTZ X;  1IS6 A;  2VOW A;  3K77 A;  3SCH A;  3E1F 1;  1K12 A;  4ATF A;  3KF3 A;  1YQ5 A;  1SLL A;  4XF3 A;  3WQ1 A;  3J4U H;  4N43 A;  4DIQ A;  4RGG A;  2P6C A;  3TEZ A;  4ISQ A;  4GD4 A;  4OHZ A;  4PLN A;  2VE1 A;  1AJO A;  2PHD A;  4FSJ A;  4LBQ B;  2JG8 C;  5FYV A;  5BPX A;  3MUY 1;  1HIX A;  3BU7 A;  5J48 A;  5DAB A;  1TEI A;  4UI9 L;  1U5Y A;  5FRA A;  1FV2 A;  1FNY A;  2HWF 1;  3G6J B;  3PUH A;  4BQ4 A;  2RDR A;  5KR7 A;  4HZF A;  3U0Z A;  3N36 A;  2RDS A;  5GZD A;  4L97 A;  3VBO A;  1B09 A;  4CEW A;  3ZMO A;  4Z2W A;  5J3U A;  4XFI A;  2G19 A;  4Q27 A;  1VBC 3;  4J6G A;  1D0G A;  1R08 2;  4DXT A;  1A6C A;  2OKX A;  3O1U A;  4UFM A;  5I0U A;  3UK9 A;  4BLJ A;  5J37 A;  1BEV 3;  3NAP B;  1XPW A;  2W2I A;  1LTE A;  1PK6 C;  3FHA A;  4MGK E;  5CKM A;  2BV4 A;  5CYY A;  4HN0 A;  1A8D A;  2RR1 1;  4J1X A;  5GLU A;  2DUP A;  5DXD A;  5IAV A;  3UJQ A;  3VGI A;  3VKM A;  2ILM A;  2UY8 A;  3QOP A;  3K3N A;  5CFD C;  2VQA A;  1OMI A;  1N47 A;  2C1F A;  3MID A;  2VG9 A;  4HN1 A;  3TOJ A;  1O4Y A;  4BXF A;  1UCX A;  2WN2 A;  4DY3 A;  4JGY A;  1JZ7 A;  1V6K A;  2IFR A;  2PAM A;  3WG1 A;  1UY1 A;  3M3E A;  2XVL A;  1O6U A;  4R9C A;  1WCS A;  3WR0 A;  3OGR A;  1EYB A;  1RVF 2;  5ABJ C;  2P3Y A;  5GM0 A;  5A7P A;  4AEJ A;  2GH8 A;  4LEJ A;  4AHW A;  3MHZ A;  1XNT A;  4FXK B;  2HYK A;  2ZEZ A;  3P3P A;  3ZFE A;  2X5I C;  1UZ0 A;  4URT A;  3Q8E A;  2WSU A;  5IVE A;  4E9K A;  1NCQ A;  1YI7 A;  1JZ5 A;  3JD7 2;  1X9T A;  3TRS B;  1R09 3;  3VHP A;  5FY7 A;  1UO9 A;  4RS5 B;  1HXS 2;  4IE6 A;  4XXA A;  3POI A;  2Q8E A;  2WNU A;  3OGJ A;  2JDH A;  2DVF A;  4NPL A;  5JPM B;  1EY2 A;  1E5I A;  4Z1V A;  1G8W A;  2OXB A;  4GMP 3;  3R6S A;  4AGG A;  4SLI A;  5FPV A;  3BPZ A;  2Y6J A;  3ZXJ A;  1GZW B;  5FXW A;  2BZD A;  3O14 A;  4NO4 A;  2P1B A;  4W50 A;  5DUV A;  1O3R A;  5FMC A;  2VBB A;  4MGS A;  2YPD A;  2UWC A;  2CAV A;  4HOO A;  1AYN 1;  2ES3 A;  4Z2A A;  2BFU S;  3BI3 A;  2X09 A;  3QBQ A;  2FDF A;  2RM2 3;  4Y1Z A;  1US2 A;  4Z92 B;  3JZV A;  3BCW A;  1JOD A;  3Q8A A;  5F2S A;  1F35 A;  1DZQ A;  1OFN A;  2Y6H A;  4BLI A;  5HV4 A;  4K40 A;  4EZ4 A;  2CYF A;  3I7D A;  4Q4W 3;  4B3N A;  4CDU A;  5CG8 A;  3WLU A;  1GNZ A;  2YB7 A;  2CDO A;  1UD1 A;  2W1W A;  5FZL A;  2V73 A;  4DS0 A;  4TZD A;  2HKX A;  3HBZ A;  3DKQ A;  3MF6 A;  2BTV C;  4M3C F;  1XYO A;  3IKW A;  2DVG A;  5DZF A;  2ZX1 A;  3TEX A;  4LBJ A;  5C8C A;  1UF2 C;  2ZAB A;  3SCF A;  4IGO A;  1COV 3;  5FUP A;  4Q29 A;  2JG8 B;  1V6J A;  3F2Z A;  3I2D A;  1W3V A;  2WII B;  4BB3 A;  2ZGR A;  5FMO L;  1AL2 2;  5CIS A;  1PO1 2;  2VD7 A;  3LDB A;  4NAM A;  4HAN A;  1PO2 3;  2E33 A;  3W5M A;  1OUX A;  3LD8 A;  3VBU A;  5LCW L;  2H6B A;  3FFQ A;  4QMA A;  5A70 A;  4LIV A;  1QJX 1;  3T2O A;  3D8C A;  1VB2 A;  3UGG A;  3DEC A;  1DIW A;  2GC0 A;  5T54 A;  1EP0 A;  4ZU5 A;  3GBG A;  3OBA A;  4BQ3 A;  1DLL A;  2DVB A;  4W65 A;  2WFP A;  2WA3 A;  3RQ0 A;  2DUR A;  2CU5 A;  2XB6 C;  1VAV A;  4DFS A;  2O1Q A;  1TZO A;  5FKB A;  1XE0 A;  1VBB 3;  5C6C A;  1TMF 3;  4HPK B;  3LIH A;  5H9Q A;  5IK4 A;  4IV3 C;  3KF5 A;  1MAC A;  3U4X A;  3Q9O A;  1AR9 2;  2XBO 2;  1VBE 1;  4RFT 0;  1DQ2 A;  1A34 A;  1H30 A;  2RG4 A;  1DQ0 A;  5LY2 A;  5K7P A;  4YM1 A;  4WVZ A;  4FPF A;  1NLQ A;  1ULC A;  4HK9 A;  4OUE A;  4QDR A;  1MS3 A;  3APB A;  4TXW A;  5DDJ 1;  5FY1 A;  5IJR A;  3U78 A;  4D3W A;  4CU9 A;  5EYX A;  2NPI A;  4DUV A;  1FOD 1;  3TBD A;  3B69 A;  1WCU A;  1L7L A;  1VBA 1;  3S0M A;  4MGT A;  2GN3 A;  4LO5 B;  3ENR A;  1AR8 1;  4JRL A;  5K0U C;  5BYN A;  3BGA A;  4TYS A;  1C5H A;  3UJO A;  1YLL A;  2P3K A;  1OLQ A;  4CDX A;  2PHF A;  3W9A A;  2FHR A;  3PTY A;  4WVW A;  1GBG A;  1GOG A;  1XYN A;  3KCX A;  1POV 0;  4UW4 A;  4A7K A;  5DAX A;  3S5Q A;  2VPV A;  3MLL A;  2X5I B;  4C0B A;  5JOW A;  1HQW A;  1VLN A;  4RR3 B;  4FPL A;  4JVA A;  4LJH A;  1U5Z A;  3SIS A;  4CEY A;  1WW7 A;  3I59 B;  4D0Q A;  4AFD A;  3ITQ A;  1RUH 2;  1ODM A;  3LIG A;  2B5H A;  4LHS A;  3SIT A;  3H3L A;  1AL2 3;  4BU2 A;  3LA2 A;  3I2G A;  4KG8 A;  1RXF A;  4Y20 A;  1OD3 A;  3H0O A;  4R9B A;  2EAA A;  1ZRC A;  3AJZ A;  1DLC A;  3AYC A;  4XZU G;  1PMI A;  5FV3 A;  5FPL A;  3ZFG B;  1HKD A;  4AOC A;  1GZC A;  2DU0 A;  4K3U A;  4M3C A;  1LED A;  1MS4 A;  4COV A;  5JSO A;  1XNB A;  4CCK A;  5KWR A;  3E6C C;  1MZF A;  1W8W A;  2BWA A;  1IGO A;  2JD4 A;  3M2M A;  2ZPX A;  3R4D B;  2J1R A;  5FMB A;  1PZ8 A;  3UKN A;  4KQ7 A;  2QJV A;  4ORF A;  3LEI A;  2ZML A;  1JYI A;  3VZK A;  1UZV A;  4E2S A;  2CGN A;  1J1L A;  3JQW A;  4RHV 1;  1UYZ A;  3CF6 E;  1IOA A;  2XKO A;  4GAL A;  1RUE 2;  1SMV A;  3IB3 A;  2VR4 A;  1YIP A;  2WWJ A;  1H6X A;  4O9E A;  1LHO A;  1GWK A;  2ORZ A;  4QPW A;  5L19 A;  4LOS A;  1JXN A;  2PFW A;  4CRQ A;  1PIV 1;  3T09 A;  1V9U 2;  2RS1 1;  1BMV 2;  2EIE A;  2ZOE B;  5JPN B;  2PLV 2;  4MXV A;  3GNE A;  4Y5Z 0;  4XET A;  4FQ4 A;  1UKR A;  4JKK A;  4KMQ A;  4S2G A;  5I0T A;  1JOB A;  5JSP A;  1OA3 A;  2D6N A;  4QXH A;  4RSU A;  1Z78 A;  2ZEY A;  3GJB A;  4F8A A;  1PVC 3;  3D6E A;  3INA A;  4UT5 A;  3GBW A;  3THP A;  1GYK A;  2R07 2;  2FQP A;  3PVO A;  2P3I A;  2Y38 A;  3AP9 A;  2QZ2 A;  3AMN A;  4XFC A;  2XR4 A;  4XZP A;  4B29 A;  1WLT A;  5FZB A;  4PHZ A;  5JWP A;  5DN2 A;  3UET A;  1E5H A;  4IL7 A;  1LRH A;  4YZ3 A;  2EIB A;  1T6G C;  1WLD A;  2IXK A;  3ZSE A;  1RUJ 1;  4DEV A;  3BIW E;  4EV0 A;  4IV3 B;  1GAN A;  3E5U A;  3PL0 A;  2AUY A;  1OF3 A;  5FP9 A;  3VBO C;  4GMP 0;  2VZ3 A;  1OXC A;  3EMR A;  4UW3 A;  4LA2 A;  3LQC A;  4AL9 A;  4IV1 A;  3V0B A;  3PME A;  5HXM A;  3N7J A;  5J96 B;  1MQT B;  4PCR A;  3WT3 A;  5F1R A;  2YBK A;  1BVV A;  3BAL A;  4IET A;  2IXL A;  2P3J A;  3PU3 A;  1G86 A;  3IMM A;  1J84 A;  5KC6 A;  2PHL A;  2HWC 1;  3JB8 A;  3DF0 A;  2GNB A;  1YI9 A;  3C7F A;  4IE0 A;  4XTP A;  2R49 A;  3VBR B;  1JZ8 A;  1HJF A;  3UGF A;  5LZ6 A;  3PUQ A;  2IVJ A;  3PUA A;  1IPJ A;  2WS9 1;  1G9A A;  4MX3 A;  4Q2F A;  3USS A;  1WGP A;  1Y7B A;  4GKY A;  1KRI A;  1A3K A;  1HRI 2;  1JHJ A;  2K0G A;  2J1V A;  4JGY C;  3PVE A;  2FMD A;  3POW A;  3VBH C;  4BMB A;  1V9U 3;  4AED A;  3V0A B;  3ON7 A;  1RHI 3;  2VMI A;  3A21 A;  4JKM A;  2GC1 A;  3W5N A;  2W94 A;  1ENR A;  5C3O A;  1R1A 3;  1I5Z A;  4YRD A;  3OUI A;  3SLI A;  1GZW A;  5IFT A;  3ES1 A;  4JGZ A;  1H9P A;  1VRH 1;  4QT6 A;  1EAH 2;  4AWD A;  4XFA A;  3ZPY A;  1FMD 2;  2CDP A;  4A6O A;  1NA1 C;  3CJX A;  3POS A;  3G7D A;  2WJS A;  4GJY A;  1QOT A;  1S2B A;  1VJ2 A;  2R07 3;  3TN9 3;  4QX3 A;  1MS5 A;  2NYY A;  2YG0 A;  3C7E A;  2D6M A;  5A3P A;  1PZ7 A;  1KJL A;  2OS2 A;  3TAY A;  1RUD 1;  3N9O A;  3VBF A;  5A6Q A;  5FO7 B;  1QEX A;  4XXP A;  5FYI A;  3T0B A;  2FD8 A;  1X33 A;  5JI7 A;  2B8M A;  1ALY A;  4OMD A;  5C8W A;  1D4M 2;  1Z7S 3;  3FUQ A;  3ZYP A;  3SCG A;  3FJS A;  2R7E B;  2AZ5 A;  4L92 A;  5FZK A;  2WAO A;  4P5H A;  3LKJ A;  4CE8 A;  2VW1 A;  4EE2 A;  3AVR A;  3OEA A;  3POJ A;  4RGK A;  4XYX A;  4Y22 B;  4W8J A;  4CXW A;  3M3C A;  4HET A;  5KBF A;  4A7Y A;  1REF A;  4G3Y C;  5IVY A;  2P2K A;  1BLZ A;  4I01 A;  5FYZ A;  3ZN6 A;  1FV3 A;  1SLA A;  1YJK A;  3FUO A;  3P5B A;  3N7K A;  3ZVX A;  4UFJ A;  5F9T A;  2WNO A;  1WA6 X;  4A45 A;  1R08 1;  4LBM A;  5J1X A;  3DKW A;  1HQL A;  3KVB A;  2YPJ A;  2PQS A;  4TLG A;  3DUI A;  4ZS3 A;  2JDZ A;  1V6N A;  3ETP A;  2HWB 2;  2EXK A;  3NV2 A;  3VKN A;  3QLQ A;  4Q4Y 2;  3N9L A;  2JG9 B;  4I09 A;  5A1A A;  5FZM A;  2H0V A;  2Q8O A;  4K8R B;  1H2L A;  2W91 A;  4BE3 A;  2IUW A;  3AK0 A;  4E2Q A;  2ATF A;  2ZGQ A;  4FFH A;  4QPG A;  3N9M A;  1LGB A;  2ZGU A;  4N43 B;  3BTX A;  3AMQ A;  4HON A;  5E6H A;  1C8M 3;  3AP5 A;  4BPZ A;  1DGL A;  3VBS C;  1PK6 A;  4QD2 A;  1BBT 3;  3P3N A;  1SFY A;  4YZ5 A;  1NXD 1;  2LS6 A;  1Y9Q A;  4MH0 E;  2QQP A;  1JBC A;  2W5F A;  1KJR A;  4YGC A;  5CFD A;  3CO2 A;  3W59 A;  2BYV E;  4FOV A;  4P5Y A;  1QOS A;  3PUR A;  3WCR A;  4XJA A;  3VBO B;  4FPY A;  3B9I A;  2VUC A;  5DMY A;  4CEW B;  1MEC 2;  1UXX X;  3O12 A;  4KL1 A;  4OHY A;  2XVG A;  2TEP A;  3AMP A;  1S0J A;  2R1D A;  2RS5 2;  4IXL A;  4QPI C;  5JMO A;  2CGP A;  3RSJ A;  2QE3 A;  4QKB A;  2VBD A;  2EA7 A;  2ZGM A;  5ABJ A;  3JD7 1;  2VY0 A;  2KD7 A;  1JYC A;  1GQG A;  1UYP A;  2OUJ A;  4P08 A;  4PBO A;  1CD3 G;  1UWW A;  1RUI 1;  4YVW C;  3U07 A;  3I97 A;  4JDO A;  5FZE A;  1OVP A;  1ND2 C;  2Q4S A;  1QJY 3;  2X5I A;  4QQH A;  4MOA A;  5LEJ A;  2EVX A;  4JZR A;  5C8C C;  3O0W A;  2K2S A;  2GP3 A;  3DYO A;  4LKD A;  1FPN 2;  4JGY B;  1UMH A;  5FO9 B;  5BNN C;  3HQR A;  4DY5 A;  5FYS A;  3CQO A;  5L9B A;  4NRP A;  4HSJ A;  1NLS A;  1UXZ A;  1ENX A;  2O14 A;  2R30 A;  4K8F A;  5FXX A;  2DBN A;  4CDX C;  2ZZQ A;  1HRV 2;  2D5H A;  1ACC A;  1JYX A;  2C5D A;  5BNQ A;  1CAV A;  1UMZ A;  2SBA A;  4Q4V 2;  4V1P A;  5FXV A;  3RWK X;  1VBD 2;  3D0J A;  4QHZ A;  3BU0 A;  1NXM A;  3NJZ A;  3WOG A;  2YC2 A;  3ZFE B;  4BDV B;  4XUO A;  3MW3 A;  1W9S A;  4Q0U A;  1AX2 A;  2QKD A;  1AZD A;  1NCQ B;  4N53 C;  4CEY C;  4FFG A;  5CNA A;  3ZFF A;  5L36 A;  2CSG A;  1CVN A;  4JQR A;  5EXO A;  1U12 A;  2DCK A;  3AYA A;  3V65 A;  4GUL A;  4ARY A;  2VOT A;  1SG3 A;  4QB1 A;  1H4G A;  2VZS A;  2AYH A;  5FQ0 A;  2WNU B;  1OT5 A;  2V4A A;  1GWL A;  2VW0 A;  5JSR A;  5ANQ A;  5JZG C;  2B45 X;  5JXJ A;  1V6O A;  1UY0 A;  1ZA4 A;  5H9R A;  4N90 A;  3ASI A;  3O1S A;  2IZW A;  3EXU A;  5DZE A;  2VC9 A;  4LBO A;  1AYN 3;  4D7Y A;  5ANN A;  1PGS A;  1RUF 1;  3DV8 A;  3LSE A;  4WM8 C;  3ZIW A;  3DPR C;  1L7R A;  4IEU A;  4R8H A;  4FPC A;  1PO1 1;  4F7Z A;  1AYM 3;  4NHY A;  3KWV A;  2A6Z A;  3R0R A;  1Q3E A;  4JDN A;  5APA A;  4AFA A;  2EID A;  3OGV A;  4DXR A;  3FLT A;  4FCA A;  3AZV A;  4L0P A;  5CIR A;  1XE8 A;  3OSD A;  1WZX A;  5B4N A;  1OOP C;  1W28 A;  1IKQ A;  3LA3 A;  4LR4 A;  4A2U A;  5L7O A;  4MZU A;  3A23 A;  2BGC A;  5GKA C;  3WP6 A;  1POQ A;  4CU8 A;  4IGP A;  4OI0 A;  2VOX A;  2VTF A;  4Y3O A;  5FWE A;  1LOE A;  4P9Y A;  4C90 A;  5LBE A;  3CZU A;  2WZR 2;  4CDU B;  4YGD A;  1TME 2;  1ULE A;  2DCZ A;  2RS3 2;  1OKO A;  5FZ6 A;  1XNA A;  4CDQ A;  4XDQ A;  1AXY A;  1AR9 1;  2ZAH A;  5F39 A;  2ZEX A;  2XPJ A;  3O1T A;  2DCT A;  4CP1 A;  1H8T C;  4D94 A;  5FKC A;  1ASJ 3;  5F6K A;  2HEW F;  4MUV A;  4XAE A;  1QJX 3;  2W52 A;  1OQ1 A;  1UPI A;  4LKS A;  2G4I A;  2VQU A;  4G4F A;  2Z2S B;  4C0H A;  2JXA A;  3I2F A;  1G9B A;  5FY8 A;  2DCJ A;  1SQ4 A;  1W2N A;  4QXC A;  4CCE A;  3CDZ B;  4YFW A;  3MEP A;  1ZBA 3;  3LDK A;  2WR9 A;  4P14 A;  4XFG A;  4Y4Y A;  4D6R A;  3FHQ A;  3KMH A;  4UWD A;  1AR6 2;  2R04 3;  1JMU B;  5IW0 A;  4XQD A;  1VAM A;  4P02 B;  4A44 A;  2HWE 2;  1EV1 3;  1VBE 3;  3QH7 A;  5EQU A;  4JQT A;  5K0U A;  1K45 A;  5T5J A;  5ISL A;  1GIC A;  1ZRI A;  4L99 A;  3IBM A;  4TN7 A;  4AZZ A;  3O1M A;  1PGW 1;  3N3H A;  4Q8L A;  4AQS A;  1XNC A;  5C71 A;  3PUI A;  1NG0 A;  1W9Y A;  1W03 A;  5LK5 A;  5FPU A;  4QKD A;  2B42 B;  1PX4 A;  1VBA 3;  2JDA A;  4ZON A;  2PQQ A;  1QJU 2;  3CIH A;  4N7I A;  1RUH 1;  2GZW A;  3LZZ A;  1XU1 A;  5FZC A;  5GJ6 A;  1JZ2 A;  4XBL A;  3ZIX A;  2GAL A;  3ZDS A;  2PHX A;  2DVA A;  4AEM A;  5C8C B;  1C28 A;  2X29 A;  1U5I A;  3FBY A;  1W39 A;  2WLP A;  3K4D A;  5F32 A;  1DQ1 A;  5JVV A;  3U1X A;  3UKV A;  5I0R A;  1T2X A;  3FLR A;  2O0O A;  3R4U A;  4FPO B;  1JZ4 A;  1CAX A;  3FE5 A;  3MUZ 1;  5IVC A;  1YFW A;  4W6X A;  1S0D A;  4OQ9 A;  3CMG A;  2GC2 A;  3T4H B;  1WWY A;  4CYD A;  2E63 A;  1CAW A;  3D4K A;  4AAX A;  4CDX B;  3GBF A;  3B93 A;  3BTA A;  3RI9 A;  4MET A;  3WHT A;  4BIS A;  1FNZ A;  5DPN A;  4COY A;  2QQL A;  3IIA A;  1QXR A;  2FCV A;  2ZHM A;  4CZS A;  2VZ1 A;  2PHR A;  2UUR A;  1VBC 2;  2VXJ A;  1PMJ X;  4FFI A;  4I30 A;  4Y33 A;  3U10 A;  1RIN A;  4AQT A;  4B1M A;  2XGX A;  2XXZ A;  1LOB A;  4C91 A;  1BEV 2;  1RIT A;  3HD8 B;  3K2O A;  1L3J A;  3JBG 3;  1MVQ A;  1W8Z A;  4R52 A;  3WVJ A;  4CEY B;  3ZYH A;  3E6D A;  1IS5 A;  1ZA7 A;  2G9Z A;  4K6B A;  1O8S A;  1BMV 1;  5I8S A;  2BVB A;  4UFI A;  2VZV A;  1BXH A;  4WM7 A;  2Y6F A;  4Y20 B;  2VZU A;  3WQ7 A;  3T0D A;  2OW4 A;  3PMS A;  5LK7 B;  2PLV 1;  1IQA A;  3Q8F A;  5IVV A;  1W9T A;  1XSQ A;  1N3Q A;  4BA6 A;  2IC1 A;  1SBF A;  1W6Q A;  4L9B A;  4M3C B;  5GLZ A;  1LGC A;  2PHW A;  5JR2 A;  3PHM A;  4H7M A;  3DN7 A;  2ZMK A;  1DGW X;  4GWJ A;  3VBF C;  5C70 A;  4H2A A;  5KHI A;  1POV 3;  1IKP A;  4N9I A;  2BOJ A;  5LBB A;  1DGW A;  1E5R A;  1O4Z A;  1WW6 A;  3HT2 A;  3CNA A;  1KFU L;  3OEB A;  3AP7 A;  1VAK A;  4XIL A;  5G04 L;  4AVB A;  1E5S A;  1QKQ A;  3N7M A;  3ILR A;  4XC9 A;  4OFG A;  4E8D A;  1DBN A;  3ACL A;  2F4P A;  4IEX A;  3MV1 1;  4Y26 A;  3MGU A;  3T1L A;  1OFS A;  1R09 2;  4UOJ A;  1JI6 A;  2GNM A;  1CZT A;  3LEM A;  2G9F A;  2ZEW A;  4Q26 A;  5T52 A;  4AI2 A;  1VMF A;  3PJY A;  4LLO A;  3WF3 A;  3RGB A;  3KT4 A;  4IND A;  3H1M A;  3AKP A;  3KLS A;  4D7T A;  3HR9 A;  3MIH A;  5A6Z A;  1V0A A;  1DYP A;  1E57 A;  2DYC A;  5LBF A;  2Q5T A;  2X10 A;  4H3W A;  3WEZ A;  5FOJ B;  3OPW A;  5C7G A;  4A3Z A;  2WZE A;  1DZT A;  1RJ8 A;  3W20 A;  2V4V A;  3ZLI A;  3RZZ A;  4D8M A;  5L73 A;  1I5P A;  4HL0 A;  4P9J A;  3T2T A;  2A6Y A;  3I49 A;  1XQN A;  3GCW A;  1AX1 A;  1OQE A;  3MIB A;  1WBL A;  3WQB A;  5LY1 A;  2ET1 A;  1WD4 A;  4QPG C;  2XG3 A;  4GQ7 A;  5D2A A;  5JXH A;  1HRI 1;  3CKH A;  4NIH A;  1GNY A;  4KBB A;  5D1I A;  5EIY B;  2RJL A;  2RE9 A;  4Q1P A;  2WO1 A;  2RM2 2;  4OI1 A;  1DCS A;  4PLO A;  3AZW A;  1ZRR A;  1DQ5 A;  4XHB A;  3K51 A;  4R9A A;  4Q4W 2;  4AI9 A;  4AVS A;  5FY0 A;  3NNF A;  4LUK A;  5FO8 B;  1O3S A;  1VB4 A;  3BOD A;  5AFE A;  5IYY A;  5KXE A;  1VMJ A;  2VNG A;  1GFF 2;  5CB7 A;  4YG0 A;  5F2W A;  5FR3 A;  3I2H A;  3BUC A;  3VBH A;  1QIQ A;  3V0B B;  4IV1 B;  2JDU A;  3PUS A;  2Y6L A;  3BIE A;  1EAH 1;  1BVP 1;  3BTZ A;  2ZBJ A;  2A6W A;  3DEM A;  1FMD 1;  2C4X A;  3PNA A;  4KH9 A;  4EJR A;  1PZ9 A;  5A1L A;  3OD4 A;  1COV 2;  3D82 A;  4MYE A;  5FWJ A;  3BOW A;  2UY9 A;  4ATE A;  4X6R B;  4GB3 1;  1UU5 A;  3CJI C;  3HT1 A;  4OCT A;  1PO2 2;  5FZ3 A;  3KHB A;  3LFM A;  3A7Q A;  2XJT A;  5LRR A;  4FBF A;  4MGI E;  1D4M 1;  1NA1 A;  5EPA A;  2WZP P;  4IEP A;  1RGS A;  1DYK A;  1MR5 A;  3PJQ A;  4XJW A;  3RG0 A;  4PT6 A;  4NOT A;  2W46 A;  4YM0 A;  4AED B;  3TEY A;  1VRH 3;  1YC6 1;  3H9A A;  4FTB A;  2HYX A;  3EQE A;  1X9P A;  2XHN A;  5FZH A;  4ZXE A;  1YCI A;  1XE7 A;  1GP5 A;  3WG4 A;  1Y9M A;  1VBB 2;  1TMF 2;  3K4Z A;  2WAB A;  3ES4 A;  3OY8 A;  1BYH A;  1W8F A;  3H3U A;  4AGV A;  2LW8 A;  2YV8 A;  3K48 A;  1RUC 3;  1XYP A;  3OBT A;  2BER A;  2LRP A;  4IE7 A;  4JGZ B;  5EJ3 A;  3H7Y A;  1RUD 3;  1GOF A;  2BGP A;  2XVK A;  5L9V A;  1R1Z A;  4SBV A;  1N1T A;  5A6Y A;  1WCQ A;  2UYB A;  3WDX A;  2E7A A;  1QDO A;  1YIF A;  2UWB A;  4XUP A;  4IER A;  2X05 A;  5FPZ A;  3QAC A;  5FP3 A;  3ZFF C;  1PGL 1;  2HWB 1;  4QXB A;  5JUV A;  2WFF 1;  4Q4Y 1;  4QDS A;  4AI3 A;  1SZB A;  3VBF B;  2FCU A;  3OBZ A;  2ZCW A;  1CPM A;  1RMU 1;  2A73 B;  2XJR A;  3VDD C;  2XKP A;  2Z79 A;  3MLK A;  4QB6 A;  4B4R A;  4B7K A;  5A3W A;  4HVR A;  4P00 B;  3WV6 A;  3T2P A;  3I2O A;  5E8A A;  2YZ4 A;  1J1T A;  4WVV A;  3BVC A;  5JIA A;  4XF0 A;  1H2K A;  1BCX A;  1LOF C;  4J25 A;  4QQP A;  2VTX J;  2MNG A;  5DUW A;  1W0O A;  3AZY A;  2GU9 A;  1ND3 A;  2OPW A;  3ZN6 B;  3VBS A;  4LE3 A;  5FZ0 A;  3VZM A;  3WXP A;  2FDH A;  1H1I A;  1MEC 1;  4P9G A;  4TSV A;  2R06 1;  2VQT A;  3UYJ A;  1GKB A;  3K3O A;  5FMD A;  3GF6 A;  4LK7 A;  1S55 A;  3MW4 A;  1MZE A;  5ACA 1;  2D93 A;  3M70 A;  5FMO S;  2ZGO A;  2MEV 1;  4LKF A;  4ASM B;  4HVQ A;  1TQ5 A;  1V6I A;  2VVE A;  5AC9 1;  1LU2 A;  2D5F A;  2Y34 A;  4LUM A;  2E31 A;  2HWD 1;  1H2N A;  2L9L A;  2MHF A;  2Y0I A;  4YG6 A;  3HOB A;  3SKJ E;  3ZSM A;  3ZPO A;  4CCC A;  2J1T A;  4N7U A;  1BZW A;  4QPI A;  3P1I A;  5LAS A;  4A4A A;  3EB7 A;  4BK4 A;  1WBF A;  3V64 A;  1WKY A;  4JDM A;  5E16 A;  3VLB B;  4FFF A;  4QPG B;  1UY2 A;  4CPB D;  5FZG A;  3ME2 A;  4O9G A;  2X53 S;  1FPN 1;  1PK6 B;  4OHV A;  1SCR A;  2XQX A;  1XJA A;  1SFN A;  3B5L B;  1H6Y A;  2ET7 A;  2GAU A;  3FX3 A;  4N9H A;  5T5L A;  3SH5 A;  3GXU A;  3MFA A;  4ZXK A;  4UBH A;  4YVW A;  5F3C A;  1QH7 A;  4IE4 A;  4CP9 A;  1ZRF A;  4RQP C;  1ND2 A;  4NPM A;  3BN6 A;  3O0X A;  5CFD B;  3ZXF A;  1B35 A;  1ZBE 1;  4Q0V A;  1HRV 1;  2J1E A;  4IEZ A;  4AQ6 A;  5C4W A;  3RPQ A;  3VB9 A;  1W3X A;  2WWS A;  3B3Q E;  2PAE A;  5BNN A;  3GHN A;  1RUI 3;  1PVX A;  4B4Q A;  1C1F A;  4LO8 A;  4ZPI A;  2XDV A;  4XUN A;  5BUV A;  2RMU 3;  1AX0 A;  2FBE A;  3LEG A;  3OYW A;  5T50 A;  5ABJ B;  1S4C A;  2FDJ A;  4XAB A;  3VD3 A;  2QQU A;  1H1M A;  2BJS A;  3NST A;  5EJ1 B;  3GYD A;  4LPL A;  4NR1 A;  3H1W A;  3RZK A;  1QH6 A;  1W8H A;  2WRA A;  4YW4 A;  5AVP A;  2XH6 A;  4LBL A;  2DBI A;  4IEY A;  1PM4 A;  1PVC 2;  4CVU A;  2Y8K A;  4GWI A;  1W2O A;  3A0N A;  1Q8V A;  4P9I A;  4N53 A;  3VL8 A;  1JYW A;  1UNB A;  2OA2 A;  1S0I A;  5LAT A;  5T5P A;  3M4F A;  3KCY A;  1UL9 A;  4Y24 A;  5T5O A;  3SNM A;  3PLQ A;  1C1L A;  3NNJ A;  2BBA A;  1WLC A;  4NWV A;  5FZ9 A;  5HCF A;  4OQ8 A;  2VNO A;  1EPW A;  3IAQ A;  1V6M A;  3OD0 A;  4LE4 A;  3SC7 X;  5JZG A;  2Y6G A;  1BK1 A;  2D6L X;  5FUN A;  1QNW A;  4PI2 A;  4DB5 A;  2FDK A;  1JU4 A;  1F9K A;  4FI9 A;  1CAV B;  4WM8 A;  3RMY A;  3DPR A;  2KXL A;  3HEI A;  4YSF A;  3D3A A;  4DUX A;  1JW6 A;  4CCD A;  4M4R A;  3OCP A;  3U37 A;  1D0H A;  1S0C A;  4JRA A;  4M01 A;  4QKF A;  3V56 A;  3MW2 A;  2XUM A;  1J58 A;  1YWK A;  2WZR 1;  3POB A;  4NHL A;  4W4Z A;  2ZGN A;  4MVT A;  4BJ0 A;  1OOP A;  3ZFF B;  1RUF 3;  2RS3 1;  3ELN A;  5C9A C;  2OPK A;  4XDP A;  5F8P A;  5I8T A;  3NWK A;  4A42 A;  5KXD A;  4XUT A;  4AGR A;  2GN7 A;  5FQ0 B;  1YO8 A;  1W6O A;  2XJV A;  4GH4 C;  2PAK A;  1Q5O A;  5HCB A;  1VMH A;  3KQ4 B;  4WM7 C;  2Y60 A;  1F8V A;  2WLQ A;  1ONA A;  1W8T A;  1GZT A;  2VH9 A;  5LW9 A;  2AAC A;  4IES A;  3GZE A;  3T30 A;  1OPM A;  2QZ3 A;  3AL6 A;  3O0V A;  1W6P A;  2GMP A;  1UIK A;  3R4S A;  4J1W A;  5A32 A;  1IS4 A;  1QJZ A;  5FZ4 A;  1ZZ6 A;  3J8F 2;  1SFP A;  1XXN A;  5EWS A;  4B1L A;  2VUJ A;  2AH2 A;  5F6L B;  1RHI 2;  1H8T A;  1UZZ A;  2BUK A;  2CY6 A;  2WA4 A;  1K5M C;  1R1A 2;  4AHY A;  4BWO A;  1AR6 1;  5B2G B;  3PVN A;  2A3W A;  4AXO A;  1YHF A;  2W39 A;  1LUL A;  1GQP A;  2HWE 1;  2JX9 A;  1WMD A;  5L7O B;  1O8P A;  3III A;  2GH2 A;  4MGZ E;  2JIJ A;  1WME A;  1CX4 A;  1XB9 A;  1NZI A;  1FI2 A;  1QJF A;  3ZXA C;  4AVV A;  1JZ3 A;  1ZVF A;  3ZMN A;  4URA A;  3DXT A;  4CXX A;  2YFU A;  3LPF A;  4GWM A;  3TN9 2;  3NMB A;  4WVM A;  4CDQ B;  1X7N A;  3BB6 A;  1QY4 A;  1SPP A;  1F15 A;  1X36 A;  2UWA A;  4QXK A;  4YM2 A;  1TG7 A;  3R05 A;  4Q4X 3;  1QOO A;  1X8M A;  2ZAA A;  1LEC A;  4P9L A;  3SEP A;  2D97 A;  2VTX A;  2QQO A;  2VMG A;  3ZOI A;  3B7M A;  1Z7S 2;  3TNP B;  5M0T A;  4CCN A;  4FAH A;  4QPY A;  3WNK A;  5A7O A;  1O5L A;  4WV8 A;  2WNV C;  3FHI B;  3WY6 A;  2XLG A;  4E4S A;  3GZT B;  2YHJ A;  4JHT A;  3ZYJ B;  1EUU A;  1IG0 A;  1TVG A;  3AP6 A;  3HPN A;  1UU4 A;  3BKZ A;  1J59 A;  2IVI B;  3WDY A;  1KEX A;  3IT8 A;  3WP5 A;  3B94 A;  4K1Y A;  3MYX A;  4L11 A;  3SEE A;  1QQP 1;  2Y33 A;  2WO7 A;  4DMI A;  1N3O A;  3I2K A;  5FBZ A;  5K0U B;  3PVB B;  4PF5 A;  3LOI A;  3O1O A;  1VBC 1;  2WDB A;  2ETE A;  2VNR A;  1VAL A;  1OVS A;  3AC0 A;  4DRV A;  1XNK A;  4CU7 A;  1GV9 A;  3MLJ A;  1IHM A;  3RYP A;  2XON A;  3M1H A;  2ZKL A;  3VKL A;  1PM7 A;  3KS7 A;  4IE5 A;  4QM8 A;  1HB4 A;  4K7J A;  3FC0 A;  1AF9 A;  1A78 A;  1ODN A;  4NVP A;  3J8F 3;  1NQD A;  1UMI A;  1HN0 A;  2WBK A;  4MLO A;  1V6L A;  2F4L A;  3QH6 A;  2JDN A;  4YVS A;  3B00 A;  3NJY A;  3ST7 A;  2VVF A;  1C8M 2;  1LOG A;  4BOW A;  2KM2 A;  4N8M A;  5FY4 A;  4P9X A;  2YY1 A;  2HEY F;  1AR7 3;  1CAX B;  3GDB A;  1BBT 2;  3OGG A;  4NHK A;  2VUL A;  3WF2 A;  1NE4 A;  3HIF A;  2A3Y A;  1CAW B;  3WX5 A;  3E6B A;  2VZT A;  4I0B A;  2RJ2 A;  2BRT A;  3OPT A;  1W9W A;  1K3I A;  4HBN A;  4RL7 A;  4U36 A;  2VME A;  1YQ2 A;  4JHZ A;  1JHN A;  5C3P A;  2Q30 A;  3IN9 A;  4KU7 A;  5JOZ A;  5JIU A;  3LGR A;  3HVD A;  1KDK A;  5F3I A;  3NVC A;  1CR7 A;  1X8E A;  1STM A;  1RUG 1;  3M3O A;  1UX6 A;  2OQ7 A;  3AMM A;  1LNS A;  5C5U A;  4PIZ A;  3E5Q A;  1CGP A;  3VZJ A;  4K1Z A;  5JOY A;  2FDG A;  2D6O X;  4NID A;  3RFR A;  3RRD A;  4GH4 B;  3RYR A;  1F4A A;  1Q43 A;  4CUC A;  2Z42 A;  4I3G A;  1QJY 2;  2YC4 A;  2YBS A;  1REE A;  1BK0 A;  3JXS A;  4QU2 A;  4WM7 B;  5FYU A;  5F3G A;  4CDW C;  3Q8B A;  1W2T A;  4DRR A;  3WIN E;  4HG6 B;  3RZH A;  3KV9 A;  4LBK A;  3D0S A;  1C8N A;  1W6Q B;  1HX6 A;  5FY5 A;  3L2Y A;  1DG6 A;  4BCU A;  5FPX A;  1J3Q A;  4Q5O A;  4Z07 A;  4IEO A;  2Q0A A;  5FFO C;  1UQX A;  1JUH A;  3S7E A;  2VAU A;  1CAU A;  1KS4 A;  4XJZ A;  4IEW A;  4XVH A;  5FAX A;  2FMY A;  5BNP C;  5JXI A;  5CEH A;  4L2N A;  4AI1 A;  4M3C E;  1HN1 A;  3LE0 A;  1TNR A;  2LTN A;  4ZHN A;  2VVD A;  1QDC A;  1MVE A;  4FT8 A;  4B4P A;  4Y1U A;  4ZU4 A;  2R32 A;  2VOK A;  4JX0 A;  1LB2 A;  2HWF 3;  4BQ5 A;  4XUQ A;  2D3R A;  2UYA A;  1ND3 C;  1O4T A;  4OUM A;  4BQX A;  1DQ4 A;  3KQR A;  5A3M A;  2DUQ A;  2ARA A;  3AL5 A;  1OLM A;  1SBD A;  4DPN A;  1H9W A;  3MBW A;  2VEC A;  4CU6 A;  2EXI A;  5K9Y A;  3RVH A;  3W58 A;  2XML A;  1RVF 1;  1DF0 A;  1O5U A;  1AYN 2;  2BOI A;  3AZX A;  1COV 1;  3MF9 A;  5H9P A;  3AM2 A;  3IPV B;  3K46 A;  5F37 A;  1AYM 2;  2RR1 3;  4LOR A;  1UZY A;  1PO2 1;  4OVE A;  3HJR A;  3UGH A;  4LIU A;  5F5C A;  1OF4 A;  4AEK A;  2EF6 A;  4AVT A;  1D7P M;  2GNT A;  2SLI A;  3ILN A;  4XFB A;  5A7W A;  3GCX A;  5IT6 A;  3AKT A;  4MGQ A;  1LR5 A;  1UKG A;  4BIO A;  3I2I A;  2XQR A;  1GOH A;  2BU9 A;  2ARB A;  3CJI A;  1HXS 1;  4R9D A;  3AXD A;  3WW4 A;  4ASL A;  4CSW A;  3NNL A;  3M3Q A;  5FPB A;  1JZ6 A;  3OPZ A;  4UF0 A;  1B35 C;  1VBB 1;  1TMF 1;  4QAW A;  2Y26 A;  5C4W C;  4EWD A;  2G1M A;  2R1B A;  1W06 A;  4GB3 3;  3VBH B;  4HXC A;  5FP7 A;  4QQO A;  4LXL A;  1ASJ 2;  1Q8P A;  2JIG A;  2BEO A;  3CZJ A;  1QJX 2;  4Y1V A;  4JC1 A;  3NRU A;  4CUG A;  2YXS A;  3WSO A;  1JU3 A;  2IWG B;  3LOB A;  4LMF A;  4RD7 A;  3WQ0 A;  4NRM A;  2GMM A;  2DCY A;  1ZBA 2;  1R64 A;  3OJB A;  2V72 A;  1D4V B;  1WMX A;  1HLC A;  2D40 A;  1F31 A;  4QGM A;  4HKL A;  2R04 2;  2VO5 A;  1NA1 B;  3PDQ A;  4OMC A;  3N9Q A;  5EZW A;  3ACG A;  2P6H A;  1OLR A;  5JCT A;  3E5X A;  3AX4 A;  3CEW A;  1WMF A;  1EV1 2;  1VBE 2;  1UYX A;  2HLE A;  3LEK A;  4LNV A;  4XOG A;  4PQ9 A;  5A3U A;  2Q8D A;  1OI6 A;  1HV1 A;  4XCA A;  1W99 A;  4Y4R A;  4AR2 A;  1G9F A;  1KIT A;  5EP9 A;  3EBR A;  5JDB A;  3VDD A;  3KCC A;  1VBA 2;  3OY8 B;  2TUN A;  3U4S A;  5A6X A;  4COU A;  1W8O A;  4FPE A;  3I2J A;  1AL2 1;  2V09 A;  5CBL A;  5JMC A;  3N7L A;  5DAP A;  1RXG A;  1LOF A;  5A7S A;  3WNL A;  2J1A A;  1RMU 3;  2NM1 A;  3N9N A;  3H7J A;  4I02 A;  2WUH A;  5GZG A;  3VHO A;  4NUB A;  2F17 A;  4NIA A;  2YU1 A;  5FZ8 A;  4EN7 B;  4S2F A;  2A5Z A;  5FYC A;  2B46 X;  4BQW A;  1G9D A;  1UN1 A;  2AC1 A;  4QU1 A;  3WNM A;  1AUY A;  5L9R A;  3POE A;  3ETQ A;  4LBQ D;  1KDM A;  3C7G A;  1S0E A;  5FXZ A;  3SHR A;  2KR2 A;  5IFP A;  1GWM A;  1JH5 A;  1NCR C;  2R0H A;  5HCH A;  4QQ2 A;  2OZJ A;  1HW5 A;  3ZXG A;  2WN3 A;  1WCD J;  2QQV A;  2YDE A;  3GJA A;  1MS9 A;  3SMH A;  3D5O A;  4MG2 A;  2CGO A;  2WSV A;  3HN3 A;  4NHM A;  4MAD A;  5BNO A;  1N1Y A;  2XBO 1;  2R06 3;  3M8L A;  4KWL A;  1Q8S A;  2XLA A;  2ZHK A;  4COZ A;  1W9F A;  3UNP A;  5ACA 3;  2CAU A;  3AFG A;  1ULG A;  2NZ9 A;  3C3V A;  3JBG 2;  1LHU A;  2BBV A;  2MEV 3;  3LCP A;  1ND3 B;  2P4E A;  2QVS B;  1OKQ A;  2RVA A;  5AC9 3;  3H1Y A;  3HQX A;  3VBS B;  4LT5 A;  1K5J A;  2HWD 3;  1N1V A;  4NWW A;  1IZ3 A;  3T1M A;  4PDW C;  3USU A;  3MZH A;  2VNV A;  2FZ1 A;  2ZGK A;  2Q1F A;  4RQP A;  3GZU C;  3H8O A;  2BW8 A;  4A3X A;  2WKK A;  1GMM A;  1ULD A;  4UW6 A;  3TWI A;  5D8A A;  1SLB A;  5A3L A;  3OBR A;  1LOA A;  3T08 A;  4FPH A;  2W95 A;  5I0S A;  5FBJ A;  4WZF A;  3ECQ A;  1PNG A;  3RZM A;  5EV7 A;  4XW3 A;  3LA7 A;  3LPG A;  4QPI B;  1RJ7 A;  5DDJ 3;  3HQU A;  1CPN A;  1ZBE 3;  3C8X A;  1UW8 A;  1FOD 3;  2C24 A;  5FDB A;  1D2S A;  3UES A;  5D21 A;  3ZR5 A;  4ITC A;  2ZXQ A;  4FPG A;  4Y5T A;  3MIC A;  1N3P A;  3WDT A;  1AR8 3;  2WQZ C;  3RI8 A;  3I3M A;  3E97 A;  5CG9 A;  4YVW B;  3LAG A;  2TNF A;  5CVR A;  5GZF A;  4CP9 B;  4CPB A;  2I45 A;  1ND2 B;  1UZW A;  3KZ4 C;  2J7M A;  2ZGL A;  1B35 B;  4BYY A;  1PNF A;  3NAP C;  1ZZ9 A;  1JYT A;  1WW4 A;  5C4W B;  3OTF A;  2J22 A;  3HNB M;  5JR7 B;  2ZGS A;  5BNN B;  2QCS B;  2VMD A;  2Y6K A;  3C7O A;  2B39 A;  2QQW A;  2WT1 A;  4XPV A;  3VZO A;  3VUO A;  3AKR A;  1MS8 A;  1NOV A;  2IXI A;  5FZO A;  3OYW B;  4YGE A;  4I2O A;  5FZF A;  4Y5S A;  1J83 A;  3FLP A;  1DYO A;  4KWK A;  1Q56 A;  4AVC A;  1JOP A;  2OVU A;  2BP6 A;  4QX7 A;  1ZZ7 A;  1RUE 1;  2W08 A;  2XJS A;  1MPX A;  3DCQ A;  3Q8C A;  1NZC A;  4GZ9 A;  4E4H A;  1RUJ 2;  2AEY A;  4YVS C;  3RMX A;  1UPS A;  1YFY A;  4N53 B;  3OGS A;  1C3H A;  1XND A;  3POY A;  1SLT A;  5C9A A;  4YW7 A;  2NQY A;  1V9U 1;  2WQ4 A;  4HK8 A;  2W1S A;  3EO6 A;  5E88 A;  1RHI 1;  3AFK A;  4GH4 A;  4X8P A;  5GLW A;  1RC6 A;  1W8U A;  2DFB A;  5JZG B;  1LU1 A;  2IXH A;  5J98 B;  1CON A;  4ARX A;  3WG3 A;  2PXJ A;  1QWR A;  5FK7 A;  3CHX A;  4M0H A;  3NNG A;  1UIJ A;  2F6B A;  4RHV 3;  1IG3 A;  1LCL A;  3DPR B;  4WM8 B;  5IAX A;  4RS5 C;  1H2M A;  5CA6 A;  4YPJ A;  4CXY A;  2VOV A;  1EPZ A;  4PF1 A;  4NHX A;  3O5S A;  2JB8 A;  2PHU A;  3AYD A;  3ZYF A;  1K5M A;  1GP4 A;  1W0P A;  3J7N A;  4CCL A;  4BK5 A;  1OOP B;  2R07 1;  3TN9 1;  3I4I A;  3JU9 A;  5FCC A;  1KD7 A;  1PIV 3;  3POG A;  1KFX L;  4HKW A;  5DUX A;  2GME A;  2RS1 3;  3S6P A;  4ONU A;  1OA4 A;  1W6O B;  2AGS A;  3SKV A;  1D2Q A;  4OHX A;  3FBM A;  1LES A;  3HMY A;  3J7L A;  3ZSJ A;  3ZSK A;  1NCR B;  1S0B A;  5B4X A;  1QNY A;  1ZYB A;  1W05 A;  3F95 A;  4CCM A;  5KXC A;  1Z7S 1;  1LEN A;  4F3J A;  1HQN A;  4H55 A;  3GM8 A;  1W6P B;  2G9G A;  5A32 B;  4BQ1 A;  5H9S A;  4TWT A;  3VD5 A;  1VRH 2;  4Y1X A;  3O1P A;  5EHD A;  2W87 A;  2LM3 A;  3TNQ A;  1H8T B;  2BGO A;  4RGA A;  2E7T A;  4ISR A;  5IWF A;  2ZMN A;  4XFF A;  3AVS A;  5FPA A;  4FOY A;  3VKO A;  5K8S A;  3OB8 A;  1O3T A;  4AF9 A;  4QKN A;  1HJG A;  4PIY A;  5AVA A;  1O3Q A;  2WNV A;  3HN1 A;  4OZX A;  5FYT A;  2JE7 A;  1RUC 2;  1ULO A;  1GZ9 A;  3RZJ A;  3IPV A;  4PDW B;  4QHO A;  5FZA A;  1RUD 2;  4I0W B;  5IVF A;  5FZ1 A;  2RJK A;  1WCK A;  3IM0 A;  3JCI A;  3UL2 A;  5DZG A;  1XU2 A;  2DTW A;  2E26 A;  3IDA A;  1RUJ 3;  1QXP A;  4HT1 T;  3I3B A;  2WZ8 A;  4NII A;  3FWE A;  1S0F A;  3J7H A;  4WVM B;  5A1F A;  2YU2 A;  4ASK A;  3VN4 A;  2WO2 A;  2B9V A;  4RFR B;  3SQO A;  1SPP B;  2BNN A;  5I93 A;  1CN1 A;  1RIR A;  2QQI A;  5T3N A;  5C3S A;  3WW3 A;  1UOF A;  1ZZ8 A;  3WP4 A;  2BQP A;  1C8M 1;  3VDC A;  2XL7 A;  4ERO A;  1QQP 3;  2DUO A;  2HWC 3;  2VMF A;  2E7Q A;  3KVA A;  1WW5 A;  1BBT 1;  2EIG A;  1SLI A;  2JEM A;  3H42 B;  1LHN A;  3BPS A;  2WS9 3;  1LAJ A;  3ZX7 A;  4XMA A;  4EN0 A;  2QTW B;  3A0K A;  3AP4 A;  1IPS A;  1QJE A;  3I54 A;  3VV1 A;  1BJQ A;  5I8Y A;  5KXB A;  1IPK A;  2ZZJ A;  3H8U A;  4H7L A;  4FXG B;  4AK3 A;  5F5A A;  3LDR A;  4EQV A;  2ZGP A;  3OG2 A;  4CA9 A;  5LRS A;  4OUS A;  1GUI A;  2CTV A;  4AYU A;  2A6X A;  4AFC A;  1DU3 D;  2JIC A;  1QJY 1;  2Y64 A;  1OH4 A;  4S2D A;  3WCS A;  3O1V A;  4YVS B;  4DO0 A;  2WC2 A;  3KD4 A;  2D98 A;  1ZZB A;  3ZYI B;  5CKN A;  5JOX A;  4Q0P A;  4OHW A;  2E53 A;  2N7G A;  1MZ5 A;  1LHV A;  4YW5 A;  4G9S B;  1VR3 A;  2O8Q A;  1RL3 A;  1RUG 3;  2YFZ A;  4PQQ A;  4QM9 A;  4CDW A;  3MI8 A;  4HFS A;  4RR3 C;  4UBG A;  1LOC A;  3S30 A;  4K9S A;  3PTR B;  3PU8 A;  4XEZ A;  2ZX3 A;  1ZM1 A;  3WNO A;  1ZNP A;  2E6V A;  4UFL A;  5K4L A;  1RUI 2;  5T55 A;  1CWP A;  4LK6 A;  3UT0 A;  2RMU 2;  5IK8 A;  1WLW A;  2EAK A;  5A7N A;  3T4V A;  5FZ7 A;  2EXJ A;  1RTV A;  3ZFG C;  3LWC A;  3SH4 A;  1CZV A;  1NYW A;  3CLP A;  1MZ6 A;  5BNP A;  3H3Z A;  1NUK A;  4R4X A;  2Q8C A;  1GNH A;  2EAL A;  4XMI A;  2LAL A;  5FYM A;  4AVA A;  2ID4 A;  2YYO A;  1R08 3;  1OPO A;  2BFU L;  2JE8 A;  2QFE A;  3I3D A;  3ZXL A;  4BQ2 A;  3ZN4 A;  5FRE A;  1JYV A;  1RED A;  1LJ7 A;  2XUE A;  3AKS A;  4HSL A;  1UU6 A;  1YFU A;  1H0B A;  3NNM A;  4NPR A;  2A71 A;  2JWP A;  2K9Z A;  1AYM 1;  5C3R A;  1Y43 B;  4EYU A;  2RS5 1;  3IZO A;  3O1R A;  4ZKT B;  2ZKN A;  1CAU B;  3KB5 A;  1K42 A;  5BY5 A;  2FZ2 A;  2PYT A;  1ZRE A;  5A33 A;  4AHX A;  3AYE A;  4I0A A;  4XJ9 A;  5BNO C;  2ZHL A;  4XCB A;  3U11 A;  4QX1 A;  1LGN A;  2BNM A;  2ZX2 A;  3AMH A;  4M0N A;  2C6S A;  1WA4 A;  5GZE A;  4FAG A;  1RVF 3;  3KHC A;  1RUF 2;  1S2E A;  1AL0 G;  3OOX A;  2JDY A;  4LA3 A;  2XOM A;  1KQR A;  4CP2 A;  3ZO0 B;  5FJK A;  5CFC C;  1Q8O A;  1ASJ 1;  4WBB A;  4C8D A;  4XBN A;  5I0D A;  1JYN A;  4EWA A;  4JCK A;  4ET7 A;  5D8A C;  4X8N A;  4AHZ A;  2HJI A;  2XJQ A;  2VW2 A;  3JD7 3;  3NV1 A;  2OT7 A;  3UV9 A;  4NRO A;  2VJX A;  4QB2 A;  1HXS 3;  1QXJ A;  1ZBA 1;  2VZO A;  4Q4V 1;  3POF A;  3ACI A;  3S7I A;  3LFI A;  1VBD 1;  3ZYG A;  4HKO A;  1OH3 A;  5A3T A;  4KU8 A;  1ST8 A;  1OUS A;  5GLT A;  1YQ8 A;  2R04 1;  1MS0 A;  4F83 A;  5A7W B;  1OUR A;  5DG1 A;  1EV1 1;  4MHU A;  1VIW B;  4KGQ A;  2C9K A;  4GWN A;  5HBA A;  2DDU A;  2I07 B;  2XJP A;  3CJI B;  2ARE A;  3K4A A;  4M4P A;  1MQT C;  1W2A X;  1G7Y A;  3THC A;  4PJY A;  3NV3 A;  4UF0 B;  4QX2 A;  2JKB A;  4OI2 A;  2TBV A;  1ZRD A;  3ZSL A;  2ZTN A;  4Q8K A;  5LA9 A;  3GGL A;  3B02 A;  3VBR C;  3RZL A;  4Q4X 2;  2PA7 A;  3LF7 A;  3ZXE A;  1HV0 A;  4B8E A;  5BXX A;  2DF7 A;  5ERL A;  3ZXK A;  3HBK A;  3SXW A;  4YLZ A;  3S57 A;  1G9C A;  3MV0 1;  1F5J A;  3VZN A;  2OQ6 A;  2A3X A;  2BVV A;  3IDE A;  1Z0H A;  4Z8B A;  5GZC A;  3RNS A;  3DL3 A;  4QGN A;  2PN5 A;  4Y1Y A;  2NP0 A;  2VQ0 A;  4BZ4 A;  5F7U A;  3H8X A;  1PGW 2;  4U2A A;  5A3N A;  4UAP A;  2Z4F A;  3RYK A;  5F5I A;  5JI9 A;  4MXW B;  4MSV A;  5SV5 A;  1QHD A;  4LO7 A;  5F5Q A;  1OBN A;  2DWR A;  3NV4 A;  1XRU A;  1TME 1;  3FMG A;  2JDP A;  2PEL A;  3KGL A;  3PIJ A;  4QX8 A;  1YNA A;  4YG3 A;  2XHK A;  4Q0S A;  2IFW A;  1PO1 3;  3L9J T;  4FP2 A;  5E89 A;  2ZGT A;  3WZ1 A;  1UOB A;  5LA1 A;  4DIN B;  1NCR A;  3B01 A;  3VDD B;  3JBG 1;  4NAO A;  3U75 A;  5SV8 A;  1DZR A;  1OHF A;  3LSD A;  2VM9 A;  1W6N A;  1UOG A;  5IVJ A;  2HBT A;  4CTE A;  1PX3 A;  4QX5 A;  4XJ8 A;  5KHK A;  2VU9 A;  3JQX A;  3VDA A;  3X29 B;  3TEW A;  1JOJ A;  4LOT A;  5FP8 A;  2C26 A;  2VUD A;  2X8K A;  3VKF C;  4FPK A;  2ORX A;  1LEM A;  3ORJ A;  4JTN A;  5AFB A;  3JUU A;  2WIN B;  3K75 B;  1SLC A;  1NY7 2;  1AR7 2;  1WUV A;  5FLJ A;  1AR9 3;  2XBO 3;  4TTG A;  5DAQ A;  4PDW A;  1NQJ A;  2C9A A;  4RYD A;  4I3P A;  3VHR A;  2GC3 A;  2E51 A;  3HWJ A;  5FIX A;  4JTO A;  1POV 1;  2VL4 A;  4V2V A;  4XF4 A;  5EJZ B;  4YW3 A;  1W04 A;  3MIG A;  4PBP A;  4LBQ A;  5BNO B;  1QJU 1;  2VMC A;  3NJX A;  5FP4 A;  1DQ6 A;  4KI5 M;  5DQ0 A;  3VL9 A;  3RDI A;  2YRO A;  3M3I A;  1NKG A;  2JJ6 A;  5LBC A;  1Y3T A;  1U0A A;  1J3R A;  4FOW A;  1GR3 A;  1SEF A;  3N9P A;  4Q1R A;  4QDQ A;  3IWZ A;  2PHT A;  2ARC A;  1F4H A;  4GJZ A;  3IAP A;  1Y9G A;  2OII A;  1CES A;  5E1R A;  5FLI A;  1FAY A;  3USU B;  1DGR A;  2JG9 C;  3KT1 A;  3MIE A;  4MGY E;  5FYH A;  4NRQ A;  4D6Q A;  4DXZ A;  4YZ2 A;  2D3S A;  5CFC B;  1F2N A;  4RQP B;  2D44 A;  4XAA A;  3ZN5 A;  5I91 A;  1ENS A;  5KC5 A;  4NIG A;  4LLF A;  1OD5 A;  1SCS A;  2C0Z A;  5D8A B;  3WNP A;  2DV9 A;  4N43 C;  3T3Y A;  3ZR6 A;  3NAP A;  4XIK A;  4D7S A;  1GU3 A;  4XE9 A;  5DAV A;  4CP0 A;  2J42 A;  1RUH 3;  2ZX4 A;  2WNE A;  1FT9 A;  1VP6 A;  1H4H A;  2YC0 A;  3J9S A;  3NW4 A;  4YZ4 A;  4IEQ A;  5FJH A;  3FFZ A;  2W1Q A;  4XUR A;  4QQL A;  5LA2 A;  4A6S A;  4KWJ A;  5HV0 A;  4L8Q A;  1BEV 1;  2EXH A;  4UFK A;  2CNA A;  3ALQ A;  4AQ2 A;  4QWN A;  3WUD A;  2PMW B;  4LUL A;  1GLH A;  2W0X A;  3KV6 A;  4CEW C;  5LWB A;  1J3P A;  3MPP G;  3URF A;  4EN8 B;  1V00 A;  2HBU A;  1SAC A;  5FOB B;  5G05 L;  5A7Q A;  5J09 A;  1C57 A;  2HWF 2;  3IMN A;  4DXS A;  4FO9 A;  3WP3 A;  3N35 A;  3OUJ A;  2QDR A;  4CCO A;  1YFX A;  3KGZ A;  4ZS2 A;  4NN0 A;  4FP3 A;  2QQK A;  1UOJ A;  1RUE 3;  3NJV A;  2NN8 A;  4LHN A;  1X82 A;  1ULP A;  1W8N A;  4OZO A;  1N1S A;  4Z82 A;  1QMJ A;  3WDU A;  5FZO B;  3WW2 A;  4QHB A;  4XJU A;  1W90 A;  3GAL A;  2ADE A;  4LQR A;  1QGL A;  5HCA A;  3OF1 A;  5GLV A;  3WNX A;  4BQY A;  5FY9 A;  2RR1 2;  2ERF A;  4RS5 A;  5HI0 A;  5EYY A;  2BPA 2;  1JS9 A;  4GAZ A;  5LA0 A;  1MS1 A;  3DYP A;  3ROU A;  2QQM A;  2P34 A;  5IHR A;  3BTY A;  5CKQ A;  1BQP A;  4H14 A;  4AG4 A;  3ACF A;  2PLV 3;  3WDW A;  4LBN A;  4RA0 A;  1R09 1;  3WF1 A;  2A6V A;  2BWC A;  5C9A B;  2A75 A;  3EJK A;  1FYU A;  2XWB B;  3NKT A;  3GHM A;  4P9W A;  3U14 A;  4YM3 A;  1NX9 A;  2GND A;  2MPF A;  3ZFE C;  1AJK A;  4FTE A;  4GMP 1;  4D6S A;  1QF3 A;  3T0A A;  1NCQ C;  2D3P A;  2WAA A;  2CL2 A;  4UXA A;  2AEZ A;  4XTM A;  4GB3 2;  1RUC 1;  1APN A;  1DHK B;  2OZ6 A;  3TB0 A;  1AXK A;  4IGQ A;  2W3J A;  2CV6 A;  3THD A;  2WNU C;  1XBF A;  2IXC A;  2XL9 A;  4KWU A;  4D69 A;  3T2Q A;  1UX7 A;  4DQA A;  1VRB A;  2W1U A;  4JAA A;  1K5M B;  3KM5 A;  2FCT A;  5J7M A;  3MFC A;  4XF1 A;  5CAD A;  1DFQ A;  3A4U A;  4K20 A;  5CAZ A;  3RZG A;  2Y0O A;  1IS3 A;  2VMH A;  2RM2 1;  1CQ9 A;  2W9X A;  4XQ4 A;  1C4R A;  1M4W A;  4IW3 A;  4YAR A;  3I3Q A;  2LRO A;  2JEN A;  5JAX A;  1W6M B;  4AE2 A;  3AZZ A;  4Q4W 1;  1NLR A;  3AKQ A;  2JDK A;  3W21 A;  5FTT C;  3IDC B;  2I2S A;  2D6P A;  4OYU A;  1OSG A;  2JG8 A;  2R16 A;  3C2U A;  3WHU A;  5A80 A;  2JDM A;  3PIG A;  1OC1 A;  3HNY M;  2OX0 A;  1NE6 A;  3IDB B;  4E4Z A;  4CDU C;  4XDO A;  4NE9 A;  4GKX A;  4HVO A;  1CJD A;  1HRI 3;  2YBP A;  1PGL 2;  2WNV B;  3QCW A;  1FX5 A;  1ULF A;  2ZA9 A;  2WFF 2;  3ILF A;  4MO3 M;  3WD5 A;  1U5X A;  2ZJC A;  4LIT A;  3WNN A;  1ZX5 A;  2VZQ A;  4PIX A;  1RMU 2;  3NO8 A;  4A41 A;  5CU1 A;  4E4D X;  4EN6 B;  4C1W A;  3KV5 A;  3ZM8 A;  2ZHN A;  4LHK A;  1CIY A;  1LOD A;  2CHH A;  3ZKY A;  4XHX A;  3VD4 A;  1HDK A;  1L7Q A;  1UY3 A;  4HPK A;  3CU7 A;  4CUA A;  5IK5 A;  2H0B A;  4XBQ A;  1SDD B;  1I3H A;  2Z69 A;  4AI8 A;  4TLF A;  2DFC A;  1US3 A;  4V2W A;  1JUI A;  1EAH 3;  1SHW B;  1TE1 B;  2EIC A;  3NL1 A;  3VBU C;  1AXZ A;  1FMD 3;  5L7O C;  4CDQ C;  2AR6 A;  2O8O A;  3KT7 A;  3A22 A;  5HPO A;  1YYN A;  4IQP A;  3OUH A;  1UYY A;  1XOY A;  2QBX A;  2J1U A;  2JD9 A;  2WYF A;  3SH3 A;  1VPH A;  1BKZ A;  2R06 2;  1O91 A;  1Q8Q A;  1QU0 A;  5KHG A;  3EYP A;  1O59 A;  4LTA A;  5FK8 A;  5ACA 2;  1URX A;  2D43 A;  2JEC A;  2MEV 2;  4ZZ5 A;  1D4M 3;  4CUB A;  1GQH A;  3VHN A;  1UY4 A;  5AC9 2;  4LKE A;  5IAT A;  3ZXD A;  2HWD 2;  3EHK A;  1S1A A;  5LB6 A;  3I3E A;  2RMU 1;  1RUN A;  4HLT A;  2ARX A;  2WT2 A;  3ZYB A;  1H1A A;  1GP6 A;  2W47 A;  4RR3 A;  2BDR A;  3RJR A;  4MXW A;  3FZ3 A;  3VD9 A;  3I59 A;  5FZD A;  2WT0 A;  1I9R A;  4AAP A;  2JKX A;  1KS5 A;  4FOQ A;  3ZKU A;  2VZR A;  5DDJ 2;  2B4K A;  1ZBE 2;  4GA9 A;  4EN9 B;  1FOD 2;  3ZFG A;  4KNC A;  2J1S A;  2VGD A;  4CCJ A;  5JLV A;  3VZL A;  5BV6 A;  1AR8 2;  2HWB 3;  2WFF 3;  1W0N A;  4Q4Y 3;  1RUO A;  3DXU A;  2JE9 A;  5EFU A;  3MIF A;  1DDL A;  1UAI A;  4K21 A;  3RS6 A;  4IEV A;  4DUW A;  4CDW B;  2E9Q A;  2NMO A;  3C7H A;  4DZG A;  4MV2 A;  4UFH A;  5CZK A;  1Y4W A; 
#chains in the Genus database with same CATH homology
 2WQ8 A;  3OB8 A;  3WF4 A;  3BN6 A;  3FL7 A;  3A21 A;  4JKM A;  3W5N A;  2J1E A;  1CZS A;  2W94 A;  1ULO A;  1KGY A;  1IQD C;  5IFT A;  4XUN A;  2E26 A;  3IDA A;  3LEG A;  3I3B A;  2WZ8 A;  3J7H A;  2WO2 A;  2B9V A;  2CDP A;  5FUI A;  3VD3 A;  4A6O A;  5EJ1 B;  4BXS V;  4LPL A;  5JXG A;  2QQI A;  3P6B A;  4QX3 A;  2V5D A;  3C7E A;  2YG0 A;  2VZP A;  2WYS A;  3WF0 A;  4CVU A;  3VDC A;  2W92 A;  2Y8K A;  4GWI A;  2VMF A;  3T0B A;  1JYW A;  1PMH X;  4OMD A;  4E8C A;  2BBA A;  2R7E B;  2WAO A;  2RV9 A;  3IAQ A;  2QQJ A;  3OEA A;  2Y6G A;  4W8J A;  4RN5 A;  5CZK A;  1JU4 A;  3NQH A;  4FI9 A;  3HEI A;  3D3A A;  4DUX A;  4M4R A;  3U37 A;  3VD7 A;  4A45 A;  4W4Z A;  5J1X A;  3OG2 A;  4BJ0 A;  1GUI A;  2PQS A;  4A42 A;  4XUT A;  2Y64 A;  3ABZ A;  1OH4 A;  3ETP A;  2E32 A;  5A1A A;  1BHG A;  2VCA A;  2W91 A;  3VDB A;  2YFZ A;  4PQQ A;  2QQN A;  1NAE A;  2LS6 A;  1P8J A;  4JKL A;  2W5F A;  1DP0 A;  3ACH A;  3WNO A;  4P5Y A;  1GQP A;  1O8P A;  3III A;  5DMY A;  1UXX X;  1CZV A;  1JZ3 A;  5JMO A;  1NUK A;  2YFU A;  3LPF A;  3DYM A;  2ID4 A;  2KD7 A;  2JE8 A;  3I3D A;  1TG7 A;  1JYV A;  4P08 A;  3SEP A;  1UWW A;  2QQO A;  3MO4 A;  3I97 A;  1XC6 A;  4DEQ A;  4MOA A;  3WNK A;  4QX0 A;  3DYO A;  1EUU A;  2J1V A;  1UMH A;  1TVG A;  1K42 A;  3HPN A;  4IUG A;  1KEX A;  3CQO A;  2VCC A;  1UXZ A;  3SEE A;  3I2K A;  4QX1 A;  1JYX A;  3HNM A;  2WDB A;  4ZY9 A;  3AC0 A;  4CU7 A;  2XON A;  1CX1 A;  4BDV B;  2YC2 A;  4XUO A;  1W9S A;  3FN9 A;  2XOM A;  4ZZ8 A;  1UMI A;  5I0D A;  1EUT A;  2DCK A;  2WBK A;  1JYN A;  4ARY A;  2VOT A;  1SG3 A;  4QB1 A;  4ET7 A;  2VZS A;  1OT5 A;  2VCB A;  2WO3 A;  1RYY A;  5JXJ A;  1UY0 A;  3K77 A;  2VJX A;  4QB2 A;  3E1F 1;  1K12 A;  3GDB A;  2VZO A;  2VC9 A;  3ACI A;  3WF2 A;  1L7R A;  2VZT A;  2RJ2 A;  1W9W A;  1K3I A;  2EID A;  3OGV A;  4DXR A;  2VME A;  1YQ2 A;  3MUY 1;  4JHZ A;  2C9K A;  4L0P A;  2DDU A;  4UI9 L;  3K4A A;  5B4N A;  4M4P A;  3PUH A;  3THC A;  4QX2 A;  3A23 A;  4CU8 A;  2VTF A;  1LNS A;  3GGL A;  3CZU A;  4DXT A;  2OKX A;  1XNA A;  1XPW A;  1F4A A;  4CUC A;  2YC4 A;  2ZEX A;  3JXS A;  3MV0 1;  3FHA A;  5CYY A;  4HG6 B;  4LKS A;  5F7U A;  2VQU A;  3I2F A;  4UAP A;  2Z4F A;  2DCJ A;  2WN2 A;  1JZ7 A;  3CDZ B;  4XVH A;  1UY1 A;  3FHQ A;  5JXI A;  3OGR A;  4P02 B;  4A44 A;  1HN1 A;  5LA1 A;  3LE0 A;  1K45 A;  4JX0 A;  5C71 A;  4XUQ A;  1XNT A;  2VM9 A;  3PUI A;  2ZEZ A;  1PX3 A;  1UZ0 A;  1PX4 A;  3VDA A;  2JDA A;  2C26 A;  3CIH A;  1JZ5 A;  2ORX A;  3MBW A;  3K75 B;  4CU6 A;  1JZ2 A;  4TTG A;  3K4D A;  4RYD A;  1T2X A;  3K46 A;  1JZ4 A;  3MUZ 1;  2VL4 A;  2Y6J A;  3CMG A;  3HJR A;  5EJZ B;  2BZD A;  1OF4 A;  1D7P M;  4AAX A;  4W50 A;  2VMC A;  3NJX A;  5DQ0 A;  4KI5 M;  4MGQ A;  4MGS A;  5DPN A;  3I2I A;  1NKG A;  2QQL A;  1GOH A;  2VZ1 A;  4Z2A A;  1JZ6 A;  4QDQ A;  1PMJ X;  2X09 A;  1F4H A;  1US2 A;  3IAP A;  4QAW A;  2Y6H A;  2YB7 A;  2CDO A;  2W1W A;  4CUB A;  3WNP A;  1O8S A;  3CZJ A;  1GU3 A;  2VZV A;  3T0D A;  2VZU A;  3NRU A;  3WSO A;  1JU3 A;  1W9T A;  5LA2 A;  2W1Q A;  1R64 A;  4XUR A;  5JR2 A;  2V72 A;  4GWJ A;  3F2Z A;  2VO5 A;  4OMC A;  5C70 A;  3ACG A;  2E33 A;  3W5M A;  3LEK A;  5LCW L;  2HLE A;  1UYX A;  3T2O A;  1W99 A;  5G05 L;  3DEC A;  3OEB A;  5G04 L;  4DXS A;  3OBA A;  4E8D A;  2QQK A;  3MV1 1;  3NJV A;  1ULP A;  1W8N A;  4OZO A;  1JI6 A;  1W8O A;  4UOJ A;  3I2J A;  1CZT A;  2ZEW A;  3WNL A;  2J1A A;  3WF3 A;  4LQR A;  2WUH A;  2X10 A;  3WEZ A;  4OUE A;  4QDR A;  4TXW A;  4A3Z A;  5C7G A;  5IJR A;  5LA0 A;  3DYP A;  4DUV A;  3WNM A;  2QQM A;  4CU9 A;  2WZE A;  5IHR A;  2V4V A;  3C7G A;  4AG4 A;  4D8M A;  3ACF A;  1I5P A;  5IFP A;  3WQB A;  3BGA A;  3WF1 A;  2WN3 A;  3HN3 A;  5JXH A;  1NX9 A;  3CKH A;  4MAD A;  1GNY A;  5EIY B;  2WO1 A;  1GOG A;  3T0A A;  3UNP A;  2WAA A;  2RVA A;  3THD A;  2W3J A;  5IYY A;  4KWU A;  3T2Q A;  1UX7 A;  2W1U A;  3I2H A;  4D0Q A;  2Y6L A;  1GMM A;  4LHS A;  3I2G A;  2C4X A;  1OD3 A;  2W9X A;  3T08 A;  2W95 A;  1DLC A;  4XZU G;  3ECQ A;  3LPG A;  3C8X A;  3A7Q A;  4OYU A;  3UES A;  2J1R A;  2ZXQ A;  3HNY M;  3LEI A;  4PT6 A;  2W46 A;  2J7M A;  1UYZ A;  2HYX A;  2XHN A;  4ZXE A;  3IB3 A;  2VR4 A;  4MO3 M;  2J22 A;  3HNB M;  1H6X A;  3WNN A;  3K4Z A;  2WAB A;  2ORZ A;  2VZQ A;  2Y6K A;  2VMD A;  3C7O A;  4QPW A;  4A41 A;  2LW8 A;  3ZM8 A;  3VD4 A;  2BER A;  1CIY A;  1L7Q A;  1GOF A;  2BGP A;  1UY3 A;  3T09 A;  4CUA A;  2EIE A;  1J83 A;  1SDD B;  1WCQ A;  1DYO A;  4XUP A;  2X05 A;  1US3 A;  1SHW B;  2EIC A;  5JUV A;  1MPX A;  4QDS A;  5HPO A;  4JKK A;  3A22 A;  4KMQ A;  4GZ9 A;  1UYY A;  2QBX A;  2J1U A;  2JD9 A;  3OGS A;  2ZEY A;  4QB6 A;  4P00 B;  3EYP A;  3T2P A;  1O59 A;  2W1S A;  4ZZ5 A;  1UY4 A;  4ARX A;  5DN2 A;  3UET A;  3NNG A;  2EIB A;  3I3E A;  4YPJ A;  4DEV A;  2W47 A;  4PF1 A;  1OF3 A;  2VQT A;  2VZ3 A;  3VD9 A;  3LQC A;  4BK5 A;  5HXM A;  2JKX A;  2VZR A;  3SKV A;  1J84 A;  2B4K A;  2E31 A;  2L9L A;  3C7F A;  3HOB A;  3SKJ E;  2J1T A;  2J1S A;  1JZ8 A;  5B4X A;  3P1I A;  4A4A A;  3EB7 A;  4BK4 A;  1WKY A;  1UY2 A;  3GM8 A;  1W0N A;  3VD5 A;  4DUW A;  3C7H A;  2XQX A;  1H6Y A;  2W87 A;  1JHJ A;  2BGO A;  3GXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...