2LW8A

Nmr solution structure of eph receptor
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
183
structure length
183
Chain Sequence
GSNEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKAPLTVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of Eph receptor
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Ephrin type-A receptor 4
total genus 14
structure length 183
sequence length 183
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01404 Ephrin_lbd Ephrin receptor ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2lw8A00
3OBAA 2LS6A 1JU3A 2QQMA 4DXTA 3K77A 1ULPA 3ZM8A 1PX3A 1XPWA 3OEAA 2W3JA 2Y6KA 1PMJX 4A42A 1O8PA 2QQIA 2VZOA 1DLCA 3CZJA 2W1UA 3A21A 4M4RA 4CUAA 4QDRA 3LEGA 3C7OA 5IJRA 5B4NA 4BK4A 4E8DA 5C70A 1OF3A 3OGVA 3MO4A 1K12A 3GM8A 4MGQA 5EJ1B 5LCWL 2ZEYA 1UWWA 4P08A 4UI9L 3W5MA 1UY2A 4DUVA 3WNMA 1R64A 1GUIA 1HN1A 2KD7A 2B9VA 3ACFA 1UY4A 2WUHA 5JMOA 1KGYA 2VZ1A 3I3EA 3LQCA 1JYNA 4ZZ8A 3P1IA 3LEKA 5EJZB 3SEPA 4CU8A 3C7FA 1UYXA 1OF4A 4XUNA 3VD3A 2W87A 4OMDA 3DYOA 2BGOA 1JZ8A 2J1SA 3K4ZA 2J1EA 2WABA 5F7UA 2BBAA 3J7HA 5IFPA 3HJRA 5EIYB 4BDVB 1UY3A 2ZXQA 1SHWB 2WBKA 1OT5A 3T09A 3NQHA 5CZKA 1D7PM 4KI5M 3I2FA 2RVAA 3NJXA 1CIYA 3BN6A 3FHQA 5G04L 4A4AA 2V5DA 4DEVA 2WO2A 4QX3A 2EICA 1CZVA 2W1SA 2E32A 3IB3A 2Y6HA 1US2A 2VZTA 4MOAA 5JR2A 3I2HA 3K46A 2VCAA 2JDAA 3WNPA 2W1WA 2VQTA 2VC9A 2J1VA 4W50A 4W4ZA 5JXHA 3WF4A 2VOTA 5DN2A 3T2PA 3SKVA 4QX1A 4DUWA 4JKKA 3IDAA 1T2XA 2CDOA 2J1TA 4XUOA 1L7QA 1W9SA 2C4XA 3T2OA 4QX0A 1L7RA 2QQJA 3SEEA 1XNTA 2Y64A 2YFZA 4IUGA 4QPWA 4OYUA 3WNKA 4L0PA 3UESA 1I5PA 1NAEA 3CMGA 3NJVA 2R7EB 1W9TA 1XC6A 5LA2A 2XQXA 4JKMA 2WZ8A 2HYXA 3MV11 4QB6A 5HXMA 2EIDA 3WF3A 4DEQA 4A45A 1GOHA 3IAPA 3T0DA 3AC0A 1OH4A 4ZXEA 3MUZ1 2EIBA 3WF2A 4BXSV 4QDQA 1JU4A 3C7GA 2VMFA 2VM9A 4E8CA 3WQBA 5I0DA 4QB1A 4TTGA 3HNMA 1TG7A 3ACIA 1OD3A 2W92A 2XHNA 2W95A 2VTFA 2W94A 4CUCA 1WCQA 1CX1A 3CIHA 2VJXA 1UMIA 3FN9A 1K42A 5DPNA 3K4AA 2RJ2A 2L9LA 1EUUA 4GWIA 5C7GA 4LKSA 3HOBA 3DYPA 1J84A 1UYZA 2Y6LA 4OZOA 2WQ8A 3T2QA 4BK5A 4Z2AA 4P02B 1O59A 4XURA 5LA1A 1JYVA 3THDA 3NRUA 3VD4A 3OG2A 2VZQA 3A22A 2X10A 3E1F1 1DP0A 5JXJA 1JZ4A 5C71A 2ID4A 2PQSA 4QB2A 5G05L 3WSOA 2JE8A 1GOGA 2W47A 1UXXX 3MBWA 1JZ2A 2W9XA 4CVUA 4RYDA 3ETPA 2J1RA 5DQ0A 1CZSA 2DDUA 4MO3M 3CKHA 1UZ0A 4RN5A 5B4XA 4LQRA 2WN3A 1SDDB 3FHAA 2VZVA 4JKLA 3VDAA 1JYWA 1NKGA 4YPJA 3GGLA 3HPNA 3GDBA 3OEBA 1GU3A 2RV9A 2E33A 2VCCA 5JXGA 3I2JA 2WN2A 5IYYA 2DCJA 1JZ6A 2J7MA 1IQDC 1F4HA 2B4KA 3ACHA 2V4VA 2WAAA 4MGSA 3HNYM 1P8JA 1UMHA 3ACGA 2DCKA 2ORZA 3I2IA 2ZEWA 5LA0A 3T0AA 3WF1A 2XONA 5JXIA 3PUIA 2Y8KA 3IAQA 1W8NA 4JX0A 2C26A 2BGPA 5IHRA 3THCA 1K45A 4GWJA 1UY1A 3A23A 2BERA 3UNPA 3NNGA 3OGSA 1RYYA 4TXWA 4UOJA 1MPXA 1H6XA 1GQPA 3F2ZA 3LE0A 2Z4FA 3HN3A 4OMCA 3I3BA 2YC4A 3K4DA 1UX7A 2J1AA 2WO3A 2QQNA 3DYMA 4GZ9A 2EIEA 4QX2A 4A6OA 3DECA 2VMDA 4DXSA 4ARXA 3BGAA 2ZEZA 1GOFA 4AG4A 2VL4A 2W5FA 3SKJE 3VD7A 3OGRA 4M4PA 2VO5A 3D3AA 5HPOA 5FUIA 2VMCA 2YFUA 2ZEXA 3I2KA 3EB7A 2E26A 3VDBA 1JZ3A 1UY0A 1US3A 2VZUA 5JUVA 2CDPA 4JHZA 4A3ZA 1K3IA 2VCBA 2VMEA 2C9KA 4KMQA 3ABZA 1CZTA 2YB7A 3PUHA 3LPFA 4FI9A 1W99A 3C8XA 1SG3A 4BJ0A 2W91A 4LHSA 2XOMA 3IIIA 1WKYA 3VDCA 4D8MA 1JYXA 2W1QA 3P6BA 4P5YA 1KEXA 2QBXA 2E31A 2VZRA 2QQKA 4DXRA 4XZUG 3UETA 2HLEA 4UAPA 2WO1A 1JZ5A 2V72A 1H6YA 1GNYA 1JZ7A 4ZZ5A 1JHJA 4ET7A 5DMYA 3WEZA 1NUKA 2YG0A 1JI6A 4CU7A 2QQLA 3I3DA 4ARYA 1ULOA 3U37A 2JKXA 3MUY1 4XUQA 3CZUA 4PQQA 2WAOA 4CUBA 5A1AA 4PF1A 3C7EA 3JXSA 2VZ3A 3OB8A 3LPGA 2VQUA 3CQOA 3ECQA 4QAWA 4KWUA 4HG6B 3WNNA 1TVGA 1PX4A 4P00B 1W9WA 1F4AA 2WYSA 4XUTA 1J83A 2W46A 1NX9A 2VR4A 1DYOA 3K75B 1UXZA 2ORXA 2Y6JA 3W5NA 3I97A 4DUXA 1XNAA 2J1UA 1GMMA 3A7QA 1W8OA 3EYPA 1PMHX 4XUPA 4MADA 5CYYA 3T0BA 1LNSA 4A44A 2X09A 2YC2A 4QDSA 3T08A 5IFTA 5J1XA 1EUTA 2VZSA 1YQ2A 3WF0A 3VD9A 3VD5A 2QQOA 3CDZB 4LPLA 3WNLA 4CU9A 4CU6A 2BZDA 2Y6GA 1BHGA 1O8SA 2VZPA 1W0NA 3GXUA 4AAXA 4W8JA 4XVHA 4ZY9A 2WDBA 3WNOA 2X05A 3I2GA 3HNBM 4OUEA 4D0QA 4PT6A 2J22A 3FL7A 2LW8A 4A41A 2WZEA 2JD9A 1UYYA 3HEIA 3MV01 3LEIA 2OKXA 3C7HA
chains in the Genus database with same CATH superfamily
4YGBA 1JU3A 5DDJ1 5IK8A 2WNVB 3AZVA 4UW4A 1VRH1 3OJBA 2GH8A 1ULPA 3JCIA 5FZOB 3AP6A 1Q3EA 1PX3A 2ERFA 3KD4A 1BXHA 2BNNA 3MF9A 4JV4A 1V6OA 2BVVA 2WT2A 3OEAA 5DUWA 2WT1A 2Y6KA 1QJU3 3ZMOA 1KS4A 3VBFA 3E5XA 2F4LA 2GNBA 2QQIA 3I59B 4YVSB 5A7NA 2XVGA 1AR82 4A3XA 4YYOA 5FZOA 1DLCA 3AJYA 3CZJA 4IERA 3H42B 4N7IA 3EHKA 3A21A 3PMEA 1W2UA 3LEGA 4CEWC 3H50A 1ZX5A 4W65A 4BK4A 1V0AA 2PTMA 1CQ9A 1BZWA 4P14A 3VDDA 5KHGA 3EBRA 3OOXA 4JGYC 4CDQB 3RSJA 5FZ4A 2A3XA 3USSA 2ET7A 2IFWA 2ZZJA 5L73A 4NVPA 3GZTB 3ZN5A 2Z69A 1X9PA 3GCXA 3H3LA 1RIRA 4PLNA 1FMD3 3HT2A 2R072 3HAGA 1OLQA 1UY2A 3POYA 1GANA 4XAEA 4E4ZA 3PLQA 3WNMA 3MIGA 4LKEA 5CG8A 2KD7A 4ORFA 3V0BA 2ZACA 2WUHA 1RUG2 4WM8A 2ZZQA 3BU7A 4JGZA 5FPUA 3VZJA 5JMOA 1KGYA 5C33A 3KM5A 3POWA 5TSWA 3ZKYA 5A3MA 3ZYPA 1O3QA 1UOGA 3LEKA 3MLJA 5EV7A 5EJZB 5FZ3A 2XPJA 4B8EA 1UYXA 4XUNA 4AI2A 1DU3D 5JVVA 1C8M2 1UOFA 3DYOA 1VRH3 5CAZA 1HDKA 1Q8PA 1LOFC 3UGHA 1J1LA 2BU9A 2SLIA 5FYBA 1QJY3 3KV9A 1SPPA 5LATA 2D6LX 3IT8A 1OH3A 4LBQA 2HWC3 2YBPA 2J1SA 3M70A 2J1EA 4PDWB 1ASJ2 1QY4A 1OKOA 1AYN3 3SMHA 2ZXQA 3NJZA 2EALA 4SBVA 4NO4A 5KXBA 3N7MA 1OT5A 3L2YA 2A73B 3ATGA 3NNMA 3OYWB 4KBZA 3T09A 3NQHA 2WINB 4UFLA 3ENRA 3KQRA 3U78A 4N9IA 5JR7B 2JJ6A 4Q29A 2EXJA 1VBA3 3NL1A 2V5DA 2ZKLA 4BMEA 4DEVA 2DV9A 1WD4A 4XF1A 4RHV3 2VQAA 3SLIA 2Y34A 3ZXAC 2BTVC 2Q8OA 3AP9A 3GBFA 5C8CB 2XBO1 4JHTA 4HN1A 3VBRB 2R043 2ZBJA 2JG8A 3KWVA 2V5YA 2WFPA 1SLAA 4IEUA 2VC9A 2R32A 4BM8A 1I1EA 1LCLA 4H7LA 3G6JB 2BEOA 5E88A 2BPA2 5KHHA 2E53A 2XKPA 2VOTA 3B94A 2BRTA 4OQ9A 4AVCA 1GBGA 4GJYA 3N4MA 4RGAA 1YJKA 4DUWA 4JKKA 3IDAA 2BJSA 3IDEA 1G9BA 2CGPA 4XTMA 4XUOA 1AR72 1L7QA 1W9SA 4M0HA 4U36A 2BW8A 4KH9A 3ORJA 3USUB 1LAJA 1FOD3 3LFMA 1A78A 1RUJ1 2QQJA 2R041 1XNTA 2Y64A 4AXOA 3TN92 4URAA 3MIHA 4NHYA 1CAXB 2B9UA 2GZWA 1RC6A 4IGOA 1ND3C 4WM7C 3EJKA 1ZRCA 1H0BA 2HWE1 3JBG3 4LKDA 2GC0A 2D6MA 4OZXA 1HRI3 1U5XA 1WCDJ 3DN7A 4MV2A 3OBTA 2MEV1 3MFCA 3UESA 1H9PA 1UU5A 3H3UA 5A7PA 5BV6A 3ZSKA 1XC6A 1NYWA 2Q0AA 3RZHA 1QF3A 1O3TA 5FK8A 2WZ8A 4KL1A 4OCTA 5ABJC 4D7TA 1F5FA 3WW2A 4PI0A 3BTZA 1YIFA 2IXKA 2FBEA 2EIDA 1UX6A 4A45A 2HWE3 3JBG1 4HSJA 4X8PA 1XE7A 4XMIA 2RS32 2EIBA 3MUZ1 5J96B 4BXSV 5KHIA 3LOBA 1YWKA 2VOKA 1LESA 1W3XA 3B01A 3M3CA 4INDA 4ASKA 4E8CA 4CEWB 5I0DA 3I7DA 1C5IA 1NLSA 3UL2A 1ULCA 4OI2A 1Y9QA 2G9GA 1TG7A 4JDNA 2QTWB 5A1FA 2ZHKA 1XE0A 4FT8A 5FPBA 4CCMA 1DQ4A 2Z5WA 2DUPA 3PU3A 1OA3A 2RDRA 1NQJA 4LNVA 4IV1A 2HBUA 3LEMA 4OHYA 5SV5A 1Y3TA 4JRAA 1FOD1 3T30A 1HRV2 4HONA 5A32B 5CFDA 3TOJA 3KHCA 3K48A 1UMIA 3Q8EA 2OT7A 2IWGB 3LWCA 4K1YA 1K42A 5KXCA 4HANA 4RQPA 4CXWA 1B09A 2JENA 1GWLA 4XFIA 3RPQA 2Y6FA 5C7GA 3HOBA 1J84A 3VBUB 4OZOA 2RHPA 2WQ8A 4BK5A 4BQWA 3LF7A 5AC91 1QJZA 3ACLA 4AI3A 3N35A 5LA1A 3RYKA 1COV2 4YW6A 5A7QA 2K2SA 2VZQA 3A22A 1V6NA 5LCWL 5BNNC 4Y22B 4Z1VA 3WDYA 3PMSA 3ZYGA 4CPBD 5JXJA 1JZ4A 1ZRIA 1NQDA 2OVUA 4YRDA 2E63A 4UBHA 1LU1A 2JIGA 1KJLA 3OBZA 3WSOA 1ACCA 4CXXA 1ZM1A 1LJ7A 5IVYA 1GOGA 2W47A 3MBWA 3ZN6B 1JZ2A 3VBHB 1W39A 1R1A1 3ETPA 2VW1A 3DPRC 3SXWA 5ABJB 1EYBA 4NIIA 4BYYA 2RS52 5DQ0A 2I2SA 4NN0A 2VNVA 1CZSA 1UQXA 2ILMA 4LMFA 1UIJA 5FYMA 5GALA 4MO3M 2TEPA 5KWRA 3KV6A 1GR3A 1J59A 2H0VA 2WWUA 3DF0A 3JQWA 1JYWA 1NKGA 4W6XA 4FPKA 3LFIA 3OEBA 4HVOA 3DXUA 2ARAA 4H3WA 3MIBA 2E33A 4MXWA 4GKYA 2VCMA 2XLAA 2IXHA 5EHDA 1R092 2D98A 5JMCA 1IQDC 1Q56A 3V0AA 3B7MA 3RWKX 2B4KA 2QDNA 3LIGA 1YQCA 3O1VA 2V4VA 1YXWA 2WSUA 5FMOS 4AGGA 1W0OA 4MGSA 3HNYM 2D3SA 4XBQA 1EAH3 4GJZA 2VW0A 3ACGA 1HRI1 3FWEA 2A3YA 3KGLA 5FP7A 4QM8A 3T0AA 1UL9A 1VR3A 4HMZA 3WP3A 4AFBA 4W6WA 3NNFA 5DABA 1RUF1 4LHNA 4KWLA 4C91A 2Y60A 1W8NA 4LTAA 2H6CA 3ZO0B 2C26A 2E7TA 4UBGA 3AB0A 2VECA 1VAMA 5JSOA 5C9AB 5K0UA 5C8CC 1LKNA 3PL0A 4K21A 1XE8A 2R062 1RUI1 4BCUA 5LWBA 5FZIA 1FT9A 3VL9A 1RUD1 5C3RA 4R8HA 3UNPA 2P3YA 3OGSA 1TME1 2GN7A 2XQRA 3KB5A 1N1TA 2XJVA 4KNCA 5BY5A 1OKQA 1Y7BA 3M3IA 1WW4A 2XJQA 3NWKA 1J1TA 1MPXA 1GQPA 2D6OX 3F2ZA 4N43C 4AOCA 3SH3A 2VE1A 2YC4A 2DUQA 4IV3A 3URFA 1OQDA 2D43A 4QQPA 1PHMA 5FYUA 2WO3A 2Q8EA 2ATFA 4IE0A 5FXWA 1MVQA 1VBD2 2A6XA 2YGLA 2WJSA 4CRQA 1W03A 1STMA 2JDUA 3MIEA 4YLZA 1AF9A 4K8FA 4IE7A 4LBQD 3RMXA 1OLMA 2JG9B 1U5YA 1AR83 3PTYA 4AHXA 2Q1ZB 1QJFA 5J48A 4DXSA 4ARXA 1FV2A 1QKQA 3BGAA 3B02A 2GSYA 3POBA 4RD7A 5EFUA 4OI0A 5T54A 3I3QA 2QQUA 2DU0A 4Q2FA 5K4LA 5C3PA 4XFBA 3D3AA 2DVAA 2ZGNA 2VNRA 1HRV1 1NCRC 1W05A 3JZVA 1DZQA 5A3NA 2XL7A 4FP2A 3MDPA 4OULA 4NRMA 2YFUA 4FTEA 3FMGA 2EVXA 2DTYA 2E26A 5D1IA 1YYNA 4FPEA 1TEIA 2XBO2 4FTBA 2B8MA 3U0ZA 2IVIB 1UY0A 4Q4Y2 1QIQA 4CEWA 3R05A 1US3A 1SBFA 2CDPA 4CDQC 4YM1A 3P3PA 3ZYBA 4GH4A 4NIGA 1K3IA 4CA9A 2VMEA 2C9KA 1LGCA 4BOWA 2HWB1 3VZKA 2VBPA 1HQWA 5IK7A 1DQ6A 4P9YA 1HW5A 2XMLA 3LKJA 1AR62 2A6YA 3OY8B 4RGGA 2ZGSA 1CGPA 1FAYA 5F6KA 3TAYA 2F17A 1QJY2 4UT5A 2PAMA 2VAUA 4FPGA 5CG9A 1BBT2 1J3RA 3IIIA 1LR5A 1WKYA 5FYVA 3TEXA 1U12A 1RJ8A 4Q4Y3 4TLGA 2LROA 2UURA 2GP5A 3HR9A 5CKQA 3LSDA 1MZ6A 5J98B 1KEXA 4BH9A 4L8QA 1FPN1 4OFGA 1CAXA 4RS5B 1GLHA 4DXRA 5IT6A 1UAIA 1BCXA 5FP4A 3D6EA 3UETA 3UGFA 1QHDA 4LUMA 5FZBA 5K0UB 5BNNA 4K20A 3OCPA 2XB6C 4UAPA 4NWWA 1SQ4A 4XFCA 4FTSA 2V72A 5A3UA 4Q5OA 1A3KA 4XFAA 5C6CA 1X82A 4ZZ5A 1DGRN 4NIAA 3WEZA 4JCKA 2DVGA 2JDHA 1NUKA 3P3NA 4FOVA 4ZXKA 1Q43A 3LA3A 1PNGA 4AEDA 1GQGA 4MLOA 5KR7A 1IG0A 1QDCA 2JG8B 3BOWA 2D93A 1VJ2A 4UW3A 2QQLA 3DCQA 5J09A 1Q8SA 4D6QA 1ULOA 2GMEA 2HWB2 4J6GA 3U37A 1DLLA 2JKXA 1VP6A 2R16A 5A7SA 5CFCB 5F5CA 3U14A 3CZUA 5A1AA 1E57A 3H8RA 3C7EA 2CWSA 3OB8A 1MS0A 2WZR1 4EN9B 4F83A 2WS93 3CQOA 4PHZA 3ECQA 4FPJA 4Y24A 1C1FA 4M01A 5I8YA 1XU2A 1ZZBA 3WNNA 4QPIA 2QKDA 3PIGA 1H2KA 1PX4A 5JSPA 1ENQA 1XRUA 2ZGRA 2ZGLA 4AW7A 3H1YA 3AYCA 5SV8A 3VBHA 5L9RA 1VBD3 2OPKA 2W46A 5GM0A 3G7DA 4QMAA 5LY2A 5FOJB 1RUC3 1ULFA 4K40A 4XJAA 1RINA 5EPAA 1EV13 3I97A 5JIAA 5CB7A 2PHRA 3M3OA 5EXOA 1W8OA 1VBE1 3IPVB 5GJ6A 1PMHX 2ZPXA 1DGLA 1GZCA 5HXVA 2IVJA 1CJDA 4NHMA 3AMPA 1GSLA 2E9QA 1CPNA 3RGBA 2E51A 2UU8A 2JKBA 4DY3A 1MVEA 3DEMA 4I02A 4LHLA 4Q26A 3WQ1A 3HBKA 3IPVA 4J1XA 4E4SA 4OLLA 1TMF3 3T08A 2FCUA 4IL7A 1W8UA 2JE9A 4AWDA 4LIVA 2VZSA 5JZGC 1BBT3 2HWC1 2ARCA 5IWFA 4YFZA 2WZR3 4FCAA 2B5HA 1YEWA 4JRLA 4AEJA 2D5FA 1OI6A 1RUH1 5CFCC 3FZ3A 2A71A 2ZGOA 1O8SA 2FDJA 4YVWA 4YZ3A 3Q8CA 1W0NA 3F95A 4W8JA 4ZY9A 4WVMB 1SBEA 2AUYA 2WDBA 1JUIA 2CY6A 3Q9OA 2A70A 4XQDA 4EWAA 1LEMA 2C0ZA 4QXBA 2RM22 4Y26A 3GNEA 4UFJA 1DGRA 2XBO3 5FZDA 3OBRA 2Q5TA 4FPCA 4AEMA 4OUEA 3ZX7A 1COV3 1DIWA 4A41A 2WZEA 3NMBA 1UYYA 1AZDA 3MV01 5T50A 4BQ3A 4RS5A 1PO11 1AL22 4KQ7A 3SCHA 4XOGA 4DXTA 1VBC3 2DCYA 1SLBA 1V6MA 4Q0QA 1ZREA 2FMDA 1PMJX 2VPVA 1UKRA 3WD5A 1V00A 1DQ1A 1O8PA 3VZLA 3RDIA 3ZFGB 1EPZA 1UW8A 2GP3A 4AI0A 2VZOA 5H9QA 1AX0A 4QGMA 4AFCA 3DV8A 3POEA 5FMDA 5IAXA 4CUAA 4XDPA 5I8SA 5FAXA 3C7OA 4OHZA 5F3CA 3GHNA 2QCSB 1OLME 1SLCA 4I30A 2IXIA 2X5IC 3OGVA 1WBLA 1RMU1 3MO4A 1K12A 1G9FA 1OUXA 3I4IA 4G3YC 5F8PA 3WP6A 2Q1MA 4P08A 1GZWA 4EZHA 1YLLA 3O1SA 1YFXA 3WP4A 2VUDA 1HB4A 5DAQA 2VD7A 1SLTA 3NV3A 2Q8CA 3U11A 1VBE2 3R4DB 1KDKA 4AR2A 3MI8A 3ZIWA 2FZ2A 4P5HA 3ZPOA 1W6QB 2YMZA 4E4DX 3O0VA 2QVSB 1NA1B 2TUNA 4B7KA 3DPRA 3U75A 3I2OA 2WNUB 1KD7A 4W6YA 1GFF2 3SEPA 4M0NA 4CU8A 1XNDA 2DCZA 4AEKA 3VD3A 4OMDA 2FDKA 4DOUA 1QJEA 3TEZA 3ZPYA 3J8F3 2JIJA 1LB2A 2BGOA 4CP0A 3IM0A 2W68A 3CBNA 4MSVA 4YZ4A 4B1MA 4FQ4A 1S0FA 4Y1XA 3SHRA 1MS9A 3VBSB 5F7UA 3SNMA 4PIZA 1LU2A 1WWYA 5T5LA 1WLWA 2JDYA 1Y43B 1F9KA 4XAAA 1QOSA 3KVBA 4ATEA 3KSCA 3E5QA 4NR1A 4KI5M 1U0AA 2RVAA 3I2FA 4PBOA 3J8F1 3NJXA 5KHKA 3BN6A 3MPPG 2VULA 1CIWA 1OXCA 3ITQA 1CPMA 1O4YA 3ZYHA 1TMF1 3NNJA 3K51A 4PIXA 4YM0A 1OFNA 2WO2A 1DHKB 5A3TA 2QZ2A 3IB3A 2AZ5A 2HWF2 4Q4X2 1MS5A 4XFHA 1BJQA 1M4WA 4Q4V3 3SITA 2HEYF 4HLTA 1ZRRA 1US2A 2YZ4A 3TEWA 3I2HA 5FBJA 5LBBA 1SZBA 1S2BA 2W1WA 4Q8LA 4DRRA 2VBDA 1TE1B 5A6ZA 4XE9A 3TN93 2D97A 5C5UA 4Q4Y1 5A7OA 5FPLA 3WG3A 5HCHA 3MW4A 1XNBA 3GCWA 4C8DA 5APAA 3SKVA 1YIPA 2V09A 2OUJA 1QJU1 2VW2A 1H4HA 4TLFA 2CDOA 4QGNA 2J1TA 4IEYA 3V0AB 2C4XA 1HQLA 4RA0A 3S57A 2YBSA 1PIV1 2DVFA 1L7RA 1KJRA 4QX0A 4MXWB 5FY5A 2A6WA 4LO7A 4LITA 1RUOA 1LOCA 2SBAA 3O7OA 2Q4SA 3ZR5A 2GC2A 1LEDA 1HXS1 3ILFA 5FMCA 1MZ5A 1URXA 2D3RA 3WNKA 1AXZA 3N9NA 4YG0A 4XF9A 4RGKA 3QCWA 4V2VA 1DDLA 5FZ6A 1IGOA 2YXSA 2FDIA 1I5PA 4AEDB 1G9DA 2R7EB 3AFGA 4YW4A 4COVA 1VBC1 4AFAA 1VBD1 4FOQA 2D40A 1AJKA 5CADA 3EQEA 1UD1A 1QOOA 3H7JA 5FXZA 5LEJA 5LA2A 4Q4W1 2XQXA 4AVSA 1TMF2 2HYXA 3MV11 3BTXA 2WNVA 1OUSA 3AM2A 1NCRA 1W90A 3WF3A 1V6KA 2JECA 2XLFA 1GOHA 5JIUA 3AC0A 1UZZA 1OH4A 3WF2A 4EWDA 4QDQA 1JU4A 2BFUS 3C7GA 1MZFA 2GAUA 5HCFA 5KC5A 5DAPA 5IAVA 1ZBE1 3MF6A 2P5BA 3GZUC 4XBNA 2R6QA 4TTGA 3ACIA 3ETQA 4QHBA 3ZMNA 2H0BA 1WLDA 2ZX4A 2WLQA 2BDRA 4SLIA 2W94A 4IEPA 4BA6A 5DZEA 1WCQA 1J3PA 1JUHA 3AXDA 5T5JA 3Q8AA 1ENXA 3VBUA 1OOPA 2RM23 2WRAA 3FN9A 4JZRA 1M06G 1QH6A 2RJKA 3MPBA 3PDQA 2DBIA 5CNAA 3FFQA 1Q8QA 2RJ2A 2GC3A 3H9AA 1H1IA 4GA9A 3W58A 3VLBB 4GWIA 1EUUA 2GNMA 4LKSA 3ZXDA 4NE9A 2BP6A 3DYPA 2Y6LA 3ZOIA 3T2QA 3BIEA 1NXMA 2HWD1 4QU1A 5FO9B 2WFF1 1YNAA 1BK1A 4BXFA 2P4EA 2XDVA 5FYHA 3WHTA 1JMUB 3GALA 3R4SA 4GWNA 3VD4A 3OG2A 4EN7B 1MS4A 1JS9A 2CGOA 4Y3OA 5JDBA 4D3WA 4ZKTB 1PVC1 3S5QA 3E1F1 4HXCA 2XWJB 4Y33A 3C3VA 1RUI2 4XEZA 4UFIA 4S2FA 5C71A 1E5RA 2WKKA 3AZXA 3OUHA 4CSWA 5LZ6A 1D4VB 1TME2 2PQSA 2YHJA 3LDRA 5G05L 2JE8A 3ZXJA 5IUQA 4AQSA 1PO23 3U07A 2W9XA 4HFSA 1AR81 4Y22A 4CVUA 3FLTA 4FBFA 4CDWB 1W8FA 2ES3A 4G9SB 1OQEA 2VTXJ 3BKZA 1PK6A 3WV6A 5EQUA 4MGYE 3OPTA 4FOWA 2IXLA 2DDUA 3QH6A 4L11A 2QQPA 3OF1A 3MHZA 4XDOA 2WO7A 5FY9A 4Y4RA 5B4XA 2NZ9A 4LQRA 1W9YA 2GNDA 2VZVA 4L9BA 1O3RA 1XNCA 3GGLA 4HKOA 1PK6C 1QOTA 2VXRA 3GDBA 4DS0A 3O1MA 3AKSA 4LXLA 2VCCA 4I2OA 3DXTA 2CYFA 4BISA 4NHLA 4GWMA 5T52A 4B4PA 4YZ1A 2NP0A 1AYN2 2VOVA 2W2IA 1S2KA 5C9AA 2WFF3 1AYM1 1F4HA 1LOAA 1VBB3 5T5OA 2R073 4XDQA 5M0TA 2ARXA 2JG8C 2PHLA 3KQ4B 1WMDA 4QD2A 1UMHA 4GQ7A 4K8RB 4KG8A 4N43A 1PGW1 1PZ7A 2ORZA 1Q8OA 2ZEWA 4ZONA 3VB9A 3KZ4C 4IV1C 2OS2A 2X8KA 2AH2A 3VZMA 3ZYFA 5FZMA 1LODA 2NN8A 3IAQA 1JYTA 3P5BA 2BGPA 3QOPA 3BOPA 2ZOEB 3ME2A 1LENA 4IEVA 3THCA 1XYNA 4XILA 5D8AB 4E9KA 5C8CA 1AYM3 2O0OA 3FUOA 5A33A 2YU1A 5F1RA 5K0UC 2A5ZA 4D7YA 4QPYA 5I0SA 2YROA 4AVBA 3IBMA 3O1OA 1W2OA 1CAUB 2RDQA 4HVRA 4XETA 3CLPA 2W39A 1Z7S1 3VHPA 2PHXA 1NA1C 4BQ1A 1XB9A 3VHRA 3LE0A 3IZOA 2WFF2 4DXZA 4KGQA 5DXDA 1YUDA 2R063 4S2DA 4DIQA 1DYPA 4ZS2A 2QQNA 1KITA 3WQ0A 1HXS2 1PGL2 1S1AA 3DYMA 4UXAA 4F7ZA 5L19A 1GP4A 3I49A 4HSLA 4A6OA 3DECA 4EN0A 2C1FA 2VMDA 5BYNA 2PMWB 4DFSA 2ZEZA 4AG4A 4CPBA 1QJU2 3U4SA 2VL4A 1L7LA 1CAVB 3NVCA 5BNPA 3IMNA 3VD7A 5DAWA 4CDXA 3FX3A 3WDXA 4M4PA 4AFMA 2VO5A 3TWIA 3DKWA 2RR11 5HPOA 1W2AX 3N7KA 3AZYA 3KGZA 3TYJA 4FSJA 1XYOA 5FUIA 3B3QE 1O4ZA 4QPIC 3I2KA 2ZEXA 2WZR2 1IOAA 4Y5SA 2JDNA 1ZVFA 5EP9A 2R49A 5FY8A 3H8OA 2ZGPA 1JZ3A 2IZWA 3M1HA 1WMXA 3CO2A 1CAVA 4AHYA 1AXYA 5FJKA 1U5IA 2VZUA 5F39A 5JUVA 2JDKA 4JHZA 4A3ZA 3FFZA 2AEYA 4R9AA 4UW5A 4KMQA 4Q1RA 3ABZA 1CZTA 2QZ3A 2YB7A 2YC0A 5FY4A 3VBRC 4PBPA 4XZPA 2NMOA 3PUHA 3KS7A 2YDEA 1W99A 1O5LA 1X8MA 3LPFA 3M4FA 4XF3A 4Q4W3 2R061 3RJ2X 3VN4A 3WHUA 1WCUA 2ZABA 5GLVA 3W21A 1SLIA 2DURA 1LOBA 4YM2A 5FYZA 1BKZA 3ES1A 1N1VA 1ULGA 2DVBA 3WUDA 4PDWA 3ZFEC 2F4PA 2I45A 4D8MA 1HJGA 3KF5A 4KWJA 3QBQA 4MZUA 1GV9A 4CDUA 4B29A 1HXS3 3POFA 4NROA 4B4QA 3APBA 5GZFA 1LHUA 5F3GA 4K9SA 4YW2A 1GYKA 2RS53 1XSQA 2CSGA 1YO8A 1BVP1 3LGRA 4XZUG 2WL1A 3JUUA 2DFBA 1YFUA 5IVBA 2YUEA 4PDWC 3UGGA 1V6JA 4C0BA 1RVF1 4DQAA 3AKPA 1AL21 1AR92 1PO12 1RITA 3BPSA 5J37A 5FREA 2I74A 1V6IA 3AMMA 4N7UA 4YVSA 1ZZ7A 2VMHA 4AI8A 4D6RA 3ZFGA 3VBFB 2R071 2ZMKA 5F5AA 4DB5A 4ET7A 5DMYA 1JBCA 1QWRA 1F2NA 5FLJA 2DU1A 4QU2A 2Z79A 5FPXA 3PUSA 4KU7A 3B9IA 4CU7A 4OI1A 3I3DA 5HV4A 1AUYA 1Y9MA 1VLNA 4ARYA 4CEYA 5F5QA 4LO4B 1KRIA 1H8TA 1QDOA 1YQ5A 1AL0G 4GD4A 1W28A 1LOGA 1DCSA 2XUEA 2LM3A 4FPHA 1GP6A 5LB6A 3USUA 2F6BA 4PF1A 3JXSA 5DUVA 5L36A 1RUJ3 1WZXA 1W2TA 4MXVA 3UJOA 2V4AA 1QGLA 5FXVA 2D44A 2W08A 3VUOA 1ZA4A 1VBB2 4GAZA 1HB1A 1ONAA 3KF3A 4KWUA 5DZFA 3AP7A 5JAXA 2WIIB 4HG6B 4O61A 5J3UA 1R091 3L2HA 4TN7A 4CP9A 2D6KA 4JTOA 1J83A 4LO8A 3RI8A 3PVEA 4I01A 5A3OA 4NRPA 2B7YA 1AR71 5FYSA 5I0UA 3VBHC 4CCJA 3ZFEB 1NX9A 5ANQA 2VR4A 5A80A 4NAOA 3RZJA 1UXZA 2Z2SB 2ORXA 2Y6JA 4Y1ZA 1BEV2 3WDVA 2RDNA 5FPAA 5GZDA 1T6GC 1XNAA 4DUXA 1DZTA 2YU2A 4N90A 1W8HA 4AZZA 3A7QA 5T3NA 3UKNA 2RMU3 3EYPA 4Y20B 3TRSB 5CFDC 2FQPA 4NPRA 3SH5A 3WVJA 3OYWA 5GZEA 1PM4A 5I93A 3K2OA 5FZFA 2BYVE 4QXCA 1LNSA 3T0BA 5C3SA 1MQTB 1MEC2 4A44A 2XG3A 4FPOB 2LUWA 4OHVA 4NIHA 4LBMA 3ZYIB 5E8AA 5DAVA 4WVWA 4XMAA 5J1XA 2PHFA 5FBZA 3PU8A 1YJLA 1Z7S2 4XJ8A 1KQRA 1YQ2A 3J7MA 3VD9A 3RI9A 1S55A 1IPJA 3MICA 1IKPA 2QQOA 4LPLA 3WNLA 3D8CA 3WOGA 3VV1A 1HRI2 4RS5C 4AI1A 3VL8A 1S0GA 1OOPB 5JI7A 3KCYA 4HBNA 2Y6GA 3SH4A 3VGIA 3VKFC 4KG0A 5H9SA 2A7AA 5ACA1 5DUXA 2WZPP 1I6XA 2Y38A 3GXUA 2AEZA 4LLOA 1W04A 4JGZB 1NT0A 1R1A3 1QQP2 2TBVA 3NSTA 3VDDC 4LOSA 2VOWA 4YFWA 4CCOA 1V9U1 1AR73 1R1ZA 4AF9A 5BNQA 3RZGA 3BB6A 3I2GA 2VTXA 2UYBA 1T6BX 4CDXB 3KHBA 3J9SA 5KXDA 1CAWB 1CAUA 3A0NA 2LW8A 2X5IB 3QACA 1ZZ8A 1NY72 2PLV2 3X29B 3PJYA 3FBYA 3HEIA 2JDMA 3LD8A 2GDFA 1RUG1 1AR93 4AE2A 3CU7A 3OBAA 1ENSA 4BE3A 2ZHNA 3AP4A 2UWAA 4RR3A 3K77A 3ZM8A 4QKBA 4YW7A 2WLPA 4J25A 1XPWA 1G86A 3V65A 1VAVA 1O5UA 2HWF3 2W3JA 4Q4X3 3D0SA 4A42A 4XQ4A 2OXBA 1DFQA 1A8DA 5FFOC 4JTNA 1BYHA 2WR9A 4QM9A 1MS8A 5FO8B 3AMNA 1FMD1 3M3QA 1CONA 3N3HA 4GKXA 4MVTA 4Z07A 5EJ3A 2W1UA 1GWKA 1BK0A 4M4RA 5K9YA 4GIQA 4WV8A 1QXRA 2XVKA 2CHHA 2OA2A 5FIXA 5B4NA 1RJ7A 5DDJ3 4E8DA 1OF3A 1VBE3 3OUJA 1LOFA 3ASIA 1AR63 4MGQA 1ASJ3 4LKFA 3QH7A 1J3QA 2JG9C 3U10A 3CHXA 3UJQA 1PGW2 2YY1A 3CJIC 3ZN4A 4PLOA 2D7FA 3RS6A 1RUC1 3ELNA 3W5MA 3FLRA 1EV11 1UPIA 3AKTA 3MGUA 4DUVA 4UWDA 4F3JA 2GU9A 1GUIA 1HN1A 2XJSA 2B9VA 2WWSA 2HWE2 2A3WA 4L99A 3E6BA 1PK6B 2AENA 5LASA 1O91A 2R30A 3M8LA 2VZ1A 2WNUC 4CDWA 5C4WB 1UZVA 3RWNA 3P1IA 3PHMA 3C7FA 5C8WA 4XACA 1PIV2 1RUH3 2W87A 4Y5Z0 2N7GA 4JAAA 3H7YA 4XCBA 5DG2A 4LA3A 5DZGA 1JZ8A 4Y5TA 1Z0HA 2XHKA 3MLLA 4H7MA 1GQHA 4O65A 5FZ9A 1BBT1 1W6OB 5A7WA 2X29A 1OPOA 2PYTA 4GMP1 1H2MA 1VB4A 2R042 3N9PA 3S0MA 3I54A 2XGXA 3HJRA 3NKTA 1OVSA 4MHRA 5A6XA 1UY3A 5EIYB 2D3PA 4LUKA 3R4UA 1SHWB 2JB8A 2EA7A 1IS6A 2WBKA 2CV6A 5CZKA 3O0WA 4QPGA 3ZDVA 5FZGA 3INAA 1CIYA 2LTNA 3FHQA 4XCAA 1GNZA 5HI0A 1OA4A 2ZTNA 1TNRA 4EJRA 4LT5A 4D69A 4QX3A 4XJ9A 1V70A 1CZVA 1KS5A 2W1SA 3CNAA 1MEC1 1XU1A 1C8NA 3ZYRA 2Y6HA 5IVFA 1WCKA 3BIWE 3JB8A 4IQPA 4META 2NYYA 2VZTA 4M3CA 2P3IA 2O1QA 1OSGA 3K46A 1WMFA 2VCAA 4O9GA 1S4CA 2YYOA 2JDAA 4Q0VA 5FZ1A 5FZKA 1OHFA 2VQTA 3WNPA 5IATA 4P9IA 3SC7X 2J1VA 1CVNA 2FDFA 4W50A 4W4ZA 5FYIA 2DCTA 1JOBA 3WF4A 4DZGA 2R0FA 1BMV2 3V56A 1BEV1 1DQ2A 3T2PA 4QX1A 4FXGB 5L7OA 4RHV1 1UO9A 1QMJA 1QNWA 3N9QA 2HKXA 1ND2A 2DUOA 3BALA 1OC1A 2PELA 3OGJA 1NXD1 4NRQA 5JZGA 1X50A 2YFZA 2GMMA 2NMNA 2RR12 2BOIA 1FPN3 2G9FA 4QPWA 2Z42A 1ZBA2 4OYUA 1AYN1 3RNSA 2B39A 3JD72 1E5SA 1WLCA 3S30A 5CIRA 3O1RA 2Y0IA 3CMGA 3B9CA 2LRPA 3KCXA 4CE8A 4QXKA 1RHI3 1XXNA 3D82A 1RUC2 2XH6A 3KV4A 3PURA 5AC93 5FZ0A 3AL6A 5FLHA 1RUNA 4NIDA 3OUIA 4QB6A 3Q8BA 3IAPA 4N8MA 3T0DA 2VUCA 4S2GA 3T1LA 4EWEA 4HPKB 4N9HA 4XXAA 2VMFA 4OUMA 3PTRB 3NW4A 4D7SA 2KXLA 2WS92 3WQBA 3O1TA 1FMD2 3KMHA 3HD8B 4G4FA 3HNMA 5LW9A 4Q4V1 2P2KA 1OD3A 3WUCA 2W92A 3FHIB 2XHNA 3AZZA 3CEWA 1BLZA 1MQTA 2W95A 2P1BA 2C5DA 3E6DA 4XF4A 5AFBA 3BTAA 4CUCA 4OQ8A 5FYTA 1X33A 1CX1A 4PJYA 3TN91 4KU8A 1IS5A 4BQ5A 4DMIA 1PZ9A 4QX5A 2BNMA 1HLCA 4R4ZA 5FZHA 2JEMA 4BPZA 2IFRA 2VJXA 4HT1T 1AX2A 2OIIA 2AC1A 5FWEA 5A3LA 5BUVA 1XYPA 1YRZA 2EXHA 4CUGA 1OURA 5FMOL 4AGRA 3RVHA 2VMGA 5A70A 2WNUA 1DF0A 2ZJCA 4CDWC 1F8VA 5F6LB 1TZOA 1UN1A 1UYZA 3T2TA 3POGA 1ZBA3 2ZGMA 4Z2AA 3WX5A 1WCSA 1VE0A 4P02B 4MGKE 5LBEA 2VMIA 2XKOA 3IKWA 2E7AA 2JX9A 4ES9A 2XUMA 1QNYA 1UU6A 3NRUA 1D4M1 3W59A 4R9CA 2TNFA 3AYEA 2ZX1A 1DQ5A 2ZS6B 4KGGA 4P9XA 2D6PA 2X10A 3SCFA 1GZWB 3LZZA 1DP0A 4NPLA 2ID4A 1GP5A 1W8TA 1UMZA 2QQVA 3CL1A 4CCLA 5K8SA 4D6SA 4JVAA 1RXGA 1LOEA 2IXJA 4IDZA 4PCRA 1SLLA 1EP0A 1O7FA 1TQ5A 3PJQA 4AQ6A 1G8WA 4ISRA 3AYAA 1ST8A 4X8NA 4EQVA 4P9GA 4RYDA 4BLJA 1NLQA 4CP2A 3BYWA 1FI2A 2WA4A 1W6QA 2OZ6A 1YHFA 3AKRA 3NAPB 3ZFFB 4LBKA 1EY2A 4YW3A 1MS1A 4YZ5A 1K5MA 1NZIA 3AJZA 1HV1A 5D21A 1YFYA 2G9ZA 1CJPA 1UCXA 4Y20A 1C28A 1UZ0A 4GULA 4CCKA 5C3QA 4E4HA 5JOXA 3J4UH 4FPLA 4C1XA 2D6NA 3VHNA 3AZWA 1GU3A 3I2JA 4UF0A 3NV2A 5FOBB 2WN2A 4NWVA 4AVVA 1FX5A 4L92A 5IYYA 3ZSLA 4IESA 5HBAA 2DCJA 4KWKA 5J36A 2J7MA 2WQ4A 4A6SA 3ACHA 2GN3A 3ILNA 4S2HA 2VY0A 5BXXA 5IK5A 4MG2A 1P8JA 3T4VA 1TME3 5A3WA 1IHMA 2DCKA 3I2IA 4HL0A 5IVCA 4Y1UA 1WUVA 2O8QA 3ON7A 2MEV3 3NAPC 3ZFFC 4QGLA 5LA0A 2BNOA 2XONA 4QWNA 3EMRA 2Y8KA 4JX0A 4ZU7A 3CJIB 2FD8A 5L9VA 2VVEA 1QJY1 3KCCA 1JOJA 4RSUA 1R1A2 1DZRA 4H14A 2Q8DA 3ZSJA 2WNOA 4GWJA 4XFGA 5FPZA 1W8ZA 3E6CC 5AVAA 3ZFGC 3A23A 1SFYA 5FUNA 5IVEA 2BERA 4Z2WA 4IE6A 3OD4A 5EYYA 3BODA 5JSRA 3NNGA 5BNOB 5JPMB 4R9BA 3CJIA 5IVJA 3S5AA 1COV1 1SCRA 1GKBA 2DF7A 2FMYA 4IEOA 5JCTA 1H2NA 5JOZA 3O14A 3HN3A 4OMCA 3I3BA 5D2AA 4BB3A 3K4DA 1HV0A 1UX7A 2CAUA 1UU4A 3HQUA 1VMJA 2J1AA 1D4M2 1K5JA 1N3QA 3WG2A 4IEWA 4PIYA 3DL3A 1HRV3 4FP3A 4QKFA 1LTEA 3B93A 4L97A 1MEC3 2GC1A 2XJRA 4BHPA 3RZZA 4QX2A 1JN2P 4KBBA 3JD71 1VB2A 4XFFA 1KFXL 3WINE 2O14A 5IW0A 5E1RA 4ITCA 3SKJE 2DWRA 1LHVA 4GXLA 3MFAA 4XHBA 1BEV3 1R093 1I3HA 4YVSC 2WWJA 1VMHA 5B2GB 3ZSMA 4EZ4A 3ZXLA 1FPN2 4WVZA 3WXPA 5A6QA 4EV0A 4LO6B 3NAPA 3ZFFA 4JGYA 5FLIA 3TBDA 3EB7A 1RUE1 4DY5A 2CL2A 2C6SA 5C9AC 3PUQA 3VDBA 4LOTA 1OOPC 5FYCA 4ZU5A 1F35A 2E7QA 4ES8A 2VVDA 2VUAA 2QUOA 3BU0A 1OMIA 3N36A 2VCBA 1NCQC 4EN6B 1YI9A 3B00A 4AGVA 1VBC2 2Y0OA 4QT6A 3KT4A 1S2EA 4LEJA 5F3EA 2ZHLA 5K7PA 3NNLA 1OLRA 3RG0A 3T4HB 3U4XA 2ET1A 1FATA 4YARA 1IS3A 3C8XA 1SG3A 2K0GA 4QQ2A 4LHSA 4QPIB 2OX0A 1R081 2XOMA 3MLKA 3HT1A 1W6PA 2WYFA 1UZYA 3P6BA 4A7ZA 5CA6A 4P5YA 1SMVA 1ULEA 1W06A 1S0CA 3HBZA 3VBOC 2QBXA 2E31A 1QQP3 3J26N 2QQKA 2GNTA 3C2UA 3PNAA 3IIAA 5FP3A 3LSEA 4MGIE 5FRAA 2RMU1 1YFWA 4LE3A 4QKNA 2HLEA 1W6NA 2ZX2A 3LA2A 1D0GA 3ES4A 1YCIA 3FC0A 2WO1A 1JZ5A 5GZGA 1BMV1 1SDWA 1GZ9A 2ZGTA 4JC1A 1UZWA 4NMIA 4UYBA 3WG1A 1H6YA 3WNXA 1LULA 2BVBA 4RHV2 4XYXA 5F2WA 1CESA 1GNYA 2RDSA 5LK5A 4H55A 3I59A 1JHJA 2EF6A 1A34A 1ZRFA 2CAVA 4BWOA 1OFSA 4JGZC 3LA7A 1D2SA 2IUWA 4Q0UA 3VKMA 1B35B 1POV3 5E16A 1S0IA 1NE4A 2B42B 1WD3A 3O5SA 4WZFA 4E2SA 5BNNB 2IXCA 3KT7A 3IDCB 5FZ7A 2R1DA 4HPKA 3SQOA 3RZLA 2FDGA 2VVFA 2NM1A 3RJRA 2BBVA 5FPVA 2PHUA 2HWF1 4Q4X1 1PZ8A 1PNFA 1KFUL 4XUQA 4FOYA 4PQQA 2WAOA 4CUBA 3RZMA 1BQPA 5EWSA 2VZ3A 4XXPA 4B1LA 1N1YA 4MX3A 1H1MA 2WA3A 2VQUA 4CEYC 2ZMLA 1MQTC 4DPNA 2MNGA 3EXUA 3VBFC 2XR4A 1TVGA 4P00B 1NLRA 1W9WA 2P37A 4OHWA 4XJUA 1C1LA 3WQ7A 1AVBA 1C8M1 1F4AA 2A6VA 2WYSA 3HVDA 3MIFA 4XUTA 3VHOA 3VZOA 2PA7A 1RB8G 2RJLA 2G1MA 1MACA 1N47A 1RUG3 1APNA 3TNPB 2ZKNA 2JD4A 2XJPA 3OTFA 4AVTA 3FE5A 3ZIXA 5F32A 3W5NA 1PGL1 1W0PA 4TSVA 1Q8VA 1DG6A 1SCSA 2JG9A 1C57A 3Q8FA 5C4WC 1ZZ9A 5CKNA 2ADDA 3BTYA 1UKGA 3GJBA 3R0RA 2MPFA 2PFWA 4HN0A 4HZFA 2XXZA 5JI9A 4LBJA 5GLZA 1C8M3 2VU9A 2RS33 4CCDA 3ZXEA 4MADA 1ZRDA 3CF6E 4Q0SA 2ZAHA 2YC2A 4QDSA 4RFRB 4M3CB 2JB4A 5IFTA 2FDHA 3IWZA 3ZVXA 4LHKA 4A7KA 1UOBA 1S0BA 2V73A 3MEPA 3O12A 3WF0A 3A4UA 4LBLA 5FZLA 4BU2A 5I91A 5LK7B 4CU9A 3AVRA 4JQTA 1HB2A 1ZBE2 1NCRB 2BZDA 5FV3A 4CU6A 1Y4WA 3S7IA 4D94A 1BHGA 4COUA 2AACA 4MUVA 2VOXA 4AQ2A 4WM7B 1C3HA 4GB31 3RYRA 3ZLIA 3PIJA 3GYDA 4DRVA 1WBFA 3GBWA 1VRH2 2P34A 1JOPA 2HH9A 1CWPA 1WGPA 5AC92 1G9CA 1O4TA 2R1BA 2JWPA 4RR3B 4XF0A 1GWMA 1JYIA 3IDBB 1ALYA 3JU9A 4PT6A 2J22A 4D0QA 3FL7A 1UNBA 2DFCA 3LEIA 3C7HA 4ZPIA 1UPSA 3U1XA 1QQP1 2LS6A 2QQMA 1WLTA 5LBCA 4CDXC 1OD5A 2XL9A 2ZX0A 3POSA 5E6HA 4COYA 3WY6A 2O8OA 4BQ2A 3M3EA 1SACA 4PF5A 4YSFA 2AR6A 3MZHA 1RUF3 2DTWA 4UW6A 2VG9A 3MIDA 1GICA 3N9OA 1H8VA 1ZNPA 5ABJA 1L3JA 1W6NB 4QDRA 5IJRA 1RUD3 2ZHMA 3WR0A 2GALA 5C70A 4GALA 4R4XA 4YNIA 3L9JT 2C24A 1H8TC 3POJA 4Q8KA 1MZEA 5GLTA 3GM8A 5EJ1B 1PO22 4DO0A 1AXKA 5KC6A 2ZEYA 2P3JA 4I0WB 1FNZA 1X8EA 1UYPA 4NAMA 1UWWA 2XJTA 4FFHA 4FQZA 4YW5A 1W6PB 1I5ZA 4UI9L 5FXXA 4OVEA 4F8AA 5L9BA 3NV4A 4NJ4A 3GBGA 3E5UA 3ZXGA 5F9TA 3S6PA 1HQNA 4WVMA 1WA4A 1R64A 3LIHA 5JWPA 2JE7A 3H8XA 1QH7A 2BQPA 3ACFA 1UY4A 4WM8C 3RYPA 4AEDC 2ZX3A 1RVF2 3NV1A 3VBRA 3B5LB 2PQQA 3I3EA 3VBSA 1B35C 4AYUA 3LQCA 2JDZA 3UKTA 1JYNA 4ZZ8A 2IC1A 3ZN6A 1FYUA 1SBDA 2BUKA 1OF4A 1POV0 2A6ZA 5JPNB 4Z82A 1DGWX 2MEV2 2FCVA 4RQPB 1HIXA 3GHMA 1LHOA 3B69A 4ISQA 4LIUA 3O1UA 2HWD3 3NO8A 3ZYJB 4Y4YA 3DPRB 1QJX2 3K4ZA 3TEYA 1NA1A 1WW7A 2R0HA 2PHTA 2WABA 4QPGB 2BBAA 1N3PA 3J7HA 5IFPA 1VMFA 4BDVB 4IE4A 3WCRA 1NOVA 1HKDA 5F2SA 2RR13 3LOIA 4E2GA 3UYJA 1DQ0A 1G7YA 2XVLA 1C5HA 4HKLA 5ACA3 2CU5A 2A75A 2RS31 1D7PM 2WQZC 4LBQB 4YGEA 2XWBB 4QPGC 5FWJA 4YGDA 1LECA 1W6OA 3D5OA 5G04L 5A7WB 3S7EA 4A4AA 5I0RA 4EROA 4E2QA 2BFUL 5F5IA 2ENRA 3NJYA 1RHI2 2EICA 2AREA 3PVOA 1TNFA 2E32A 3T1MA 4RQPC 1RGSA 1V6LA 1S0EA 5D8AC 5FUPA 1CX4A 1N3OA 2GMPA 4AK3A 4ASLA 1PM7A 4MOAA 2VNGA 4Q4W2 5FZEA 3A0KA 3VKNA 4EE2A 2P17A 3N9MA 3RRDA 5JR2A 4FVVA 4A2UA 2VUJA 4MHUA 3MYXA 2NLRA 2YPDA 1ZBE3 4V2WA 3V0BB 4IV1B 4V1PA 3T3YA 3QLQA 5JXHA 2OPWA 5BPXA 3I2DA 3LDKA 4XJWA 4HKWA 5DN2A 1ULDA 4YG6A 3JB4C 3VBSC 1IS4A 4QX7A 1T2XA 5CFCA 3T2OA 2UYAA 4K3UA 5FZCA 3LB9A 1JTZX 5EZWA 4XTPA 1HB3A 3E97A 3SEEA 2CGNA 3OD0A 2H6BA 4LK7A 4FAHA 1FNYA 1U5ZA 4R52A 3BUCA 5AFEA 4IUGA 4WVVA 5FY7A 1XOYA 3K3OA 1HX6A 5FK7A 4YZ2A 1SFNA 3LAGA 1REDA 3LCPA 2OZJA 1S0DA 4L0PA 4NOTA 4CP9B 2EXKA 1POQA 4Q4V2 4XHXA 5FCCA 1AR61 4IGPA 4RFT0 1NAEA 1DBNA 2ZCWA 3NJVA 4IV3C 4GMP0 4O7XA 1F5JA 4I0BA 4ASMB 1W9TA 4P9LA 4BQ4A 1XSRA 1G6NA 1PIV3 2W0XA 3HN1A 4QQLA 4CCEA 3DGTA 4LJHA 4JKMA 2J42A 4O9EA 4YVWB 2Y26A 4PQ9A 4MYEA 1RUD2 5HXMA 3TB0A 4BQYA 1QXPA 5FY1A 2D5HA 4DEQA 1JODA 1IKQA 1JW6A 4UF0B 4E27A 1GNHA 4ZXEA 2RS12 4CEYB 3HWJA 4HK9A 5I8TA 2QDRA 2HJIA 3BI3A 3FJSA 5BNPC 5LY1A 2VM9A 3OGGA 1NE6A 1CD3G 5A3PA 4FFIA 5CISA 4QB1A 4RR3C 4IEZA 5FQ0B 1K5MB 3J8F2 3M7AA 4FO9A 5C3OA 2W52A 2VTFA 4X6QB 3WT3A 1W9FA 1QJX1 2ZGKA 1AYM2 4YGCA 3CIHA 5J7MA 3AX4A 4YWAA 5GLWA 2AGSA 5GKAC 4B7EA 4BIOA 5LRRA 1IG3A 4C90A 5CKMA 5BNPB 5DPNA 2BGCA 1A8MA 4XBLA 3K4AA 4ONUA 2K46A 5FKBA 1PVC3 2HEWF 4CDUB 3D0JA 1DYKA 1VBA1 3OSDA 2L9LA 1EAH1 1W3VA 5FKCA 1V9U2 5FR3A 4XJZA 5ISLA 4MGTA 3ST7A 4CP1A 2A1XA 2UWBA 4Q27A 5T55A 1AX1A 4LBOA 4P9JA 1O59A 1OVPA 2B45X 4JGYB 4XURA 4JDOA 3ZKUA 1JYVA 2RM21 3THDA 2PLV3 2QFEA 4LULA 1D2QA 5L7OC 1VRBA 4NUBA 3VKLA 4DNYA 4I0AA 1RUI3 1W8WA 3N7JA 3V64A 3VZNA 4URTA 2ZA9A 1PVXA 4XABA 1JH5A 3GZEA 2ZMNA 4QB2A 4IXLA 5JOYA 2BWCA 4C0HA 3ZFEA 1UXXX 2RE9A 3O0XA 4GB33 4L2NA 4AI9A 1RUE3 2OW4A 1QJX3 4B3NA 1H9WA 2J1RA 3UV9A 1LGBA 2PAKA 2UY9A 5DDJ2 3MW3A 3AK0A 3KT1A 2ZGQA 5KBFA 2XLGA 1CR7A 2WC2A 1XNKA 3CKHA 4HK8A 2HYKA 1VAKA 4IEXA 4RN5A 4CCCA 2WN3A 1SPPB 4OHXA 1SDDB 3FHAA 1RXFA 4AAPA 4JKLA 3VDAA 4YPJA 3N9LA 2B46X 2FZ1A 3HPNA 2KR2A 4X6RB 4RL7A 4CDQA 2RV9A 1RVF3 5JXGA 2VQ0A 3AKQA 3AVSA 2G4IA 2DBNA 2UY8A 3H3ZA 4LR4A 1ENRA 4U2AA 3WZ1A 1ND2B 1Q5OA 3D4KA 1JZ6A 2OQ6A 1F31A 2YPJA 3NKGA 5FYYA 5KHJA 3CJXA 3J7LA 2AYHA 2WAAA 4ZS3A 5DAXA 1JHNA 1JXNA 2WNEA 1FOD2 4I09A 1ZZ6A 3OPZA 2ADEA 4BZ4A 1QU0A 4PI2A 1Z7S3 1AJOA 3ALQA 1MS3A 4UFHA 3TNQA 1PGSA 1RUH2 2UWCA 3OPWA 3WF1A 1HJFA 2HBTA 5CEHA 5JXIA 3PUIA 4I3GA 4QX8A 2EXIA 2LALA 1C4RA 4AVAA 1H2LA 1R082 3RQ0A 4K1ZA 1R083 1REFA 2VH9A 5IHRA 1K45A 4EN8B 1QXJA 5F37A 3VDDB 2HEVF 1UY1A 1RL3A 1E5HA 3LDBA 3JQXA 2P6HA 4GH4B 4LA2A 3RFRA 3THPA 1O6UA 4YM3A 1CN1A 4LK6A 5HCAA 4EYUA 2CNAA 2HWC2 1RYYA 4TXWA 4UOJA 1WW5A 1WW6A 4IGQA 1ND3B 2QNKA 1MR5A 2WNVC 4FPFA 4LORA 1H6XA 1PVC2 4HOOA 4YG3A 2Z4FA 2BOJA 2XJUA 3H8UA 1VBA2 3IMMA 1UF2C 4NHKA 4XC9A 4J1WA 4OUSA 4P9WA 1A6CA 1Z78A 1ZBA1 5DUUA 4H2AA 1N1SA 1ZA7A 4LO5B 4GZ9A 5FZ8A 2EIEA 3N7LA 2YV8A 1D4M3 5FY0A 4QKDA 3KVAA 1E5IA 1WMEA 2Y33A 3J7NA 1NCQB 1POV1 2PXJA 2OQ7A 3WCSA 3W20A 1KDMA 2RMU2 1GOFA 1JYCA 3IN9A 4A7YA 3AXEA 2VNOA 3O1PA 2W5FA 1RTVA 2RS51 1RUJ2 3OGRA 2K9ZA 5L7OB 1XBFA 3AP5A 2BWAA 2P6CA 1OPMA 3AL5A 5FMBA 4PLMA 1W6MA 1AL23 4QHZA 3WDWA 3PVNA 5HCBA 4BLIA 4GH4C 2VMCA 2DYCA 5FP9A 2KM2A 4QXHA 3POIA 3OY8A 2RS11 2WS91 4IEQA 4BIFA 4AQTA 5LA9A 5CVRA 3KV5A 4M3CE 4AHZA 4CZSA 2WT0A 3WW1A 4HVQA 3PUAA 1S0JA 4CCNA 4M3CF 3AFKA 1F15A 1ZYBA 3DUIA 3VBOA 4CDUC 1SEFA 2VGDA 4XPVA 3I3MA 5H9RA 5EYXA 5GLUA 4Y1YA 4CTEA 1XJAA 1WA6X 2FHRA 3JBG2 1RUE2 4CXYA 4UFKA 5LRSA 4FI9A 2RS13 4IETA 4ATFA 4IE5A 4COZA 1OA2A 1ND2C 1V9U3 1O3SA 5JLVA 4BJ0A 2W91A 1ZZCA 1K5MC 1X7NA 4GMP3 1ODMA 4XQWA 3WG4A 3VDCA 3PVBB 3K3NA 2QJVA 1JYXA 2W1QA 1DGWA 4JQRA 4MH0E 4WZCA 4Z92B 1QEXA 1XQNA 1AR91 2VZRA 5I0TA 3AYDA 2P3KA 5CFDB 1IPKA 3R6SA 2YGMA 5A33B 3JD73 2JXAA 2CTVA 5D8AA 4TZDA 3H0OA 2E6VA 4LBNA 5C4WA 1B35A 5FJHA 5CU1A 2ETEA 3FLPA 4N53A 5BNOA 5IK4A 2VBBA 4OI4A 1X9TA 2DVDA 4TWTA 5C5TA 4ZHNA 5IVVA 4NPMA 4IV3B 2FCTA 1IZ3A 1EV12 2RG4A 4DINB 1JZ7A 3I8TA 3AMHA 2MHFA 2YG0A 4N43B 3KLSA 5KXEA 1RHI1 5LBFA 3VKOA 1GZTA 1X36A 4LLFA 4R9DA 4N53B 1H4GA 1ODNA 4NHXA 4N53C 5FO7B 1JI6A 3ROUA 4K6BA 3SCGA 3ZDSA 3W9AA 2NQYA 5BNOC 1G9AA 1LHWA 2Q1FA 4Q0PA 3RZKA 3ZR6A 1BVVA 4QQHA 4C1WA 4FFGA 2X5IA 4B4RA 4LE4A 5FP8A 3THTA 1I9RA 1H30A 5JZGB 1OBNA 4FXKB 3MUY1 4M00A 4ZU4A 4IW3A 2I07B 3DKQA 3HQXA 3LPGA 2NPIA 5GZCA 3WW3A 1OQ1A 2OUHA 2YBKA 5DG1A 1PO13 3MW2A 4QAWA 4Q1PA 1YQ8A 3BCWA 1AHSA 3HIFA 3QD6A 5AVPA 3WDTA 4BQXA 3GF6A 2BV4A 2JDPA 4K7JA 2OYZA 3ILRA 5A1LA 4MGZE 1W6MB 1NG0A 4WM7A 5E89A 1VALA 1Y9GA 1RMU3 4FPYA 2C9AA 3H1MA 3UKVA 3UT0A 5F3IA 3WW4A 1LGNA 2EIGA 5LEKA 1FV3A 2ZAAA 1DYOA 1HN0A 3K75B 1IQAA 4XIKA 1VIWB 2ZGUA 1NCQA 4FFFA 1W2NA 4YW1A 3SISA 1CAWA 2J1UA 1GMMA 1YC61 3GZAA 4UFMA 3HQRA 1EPWA 2EAAA 5A6YA 3FUQA 3UK9A 3GJAA 5CBLA 1NY71 2PLV1 2EAKA 2GH2A 2G19A 4GB32 2HWB3 4XUPA 3ZSEA 4AL9A 5CYYA 1FXZA 2QQWA 3WP5A 1RMU2 2X09A 3WDUA 1REEA 1ND3A 1H1AA 1J58A 2X53S 3AMQA 3RMYA 5HV0A 4JDMA 2VXJA 4BMBA 3BPZA 1EUTA 2ARBA 2PN5A 4XW3A 4YVWC 5FZAA 5JOWA 1D0HA 4WBBA 1RUF2 1SFPA 3ZXKA 1VBB1 1PO21 4XIOA 3VD5A 1LHNA 2CWMA 3EO6A 2JICA 5ERLA 5ACA2 5FDBA 3CDZB 3VBOB 1NZCA 2PAEA 5FTTC 3BVCA 1IPSA 2WSVA 4QQOA 1LRHA 4HETA 1KXGA 1ASJ1 4QHOA 2VZPA 2QE3A 4WM8B 2PHWA 4AAXA 2HWD2 3HMYA 4XVHA 3WLUA 1UOJA 5H9PA 5FQ0A 1VPHA 5ANNA 4Y1VA 3WNOA 4COWA 3H1WA 5T5PA 2X05A 4I3PA 1YQ6A 3M2MA 3VBUC 2Q30A 4TYSA 3HNBM 1UIKA 3FBMA 4AFDA 2PHDA 2KA3A 1EAH2 1H8TB 4CYDA 4Z8BA 2JD9A 2OKXA 4AHWA 4FAGA 1PMIA 1YI7A 5A32A 3ZXFA
chains in the Genus database with same CATH topology
3OBAA 2LS6A 1JU3A 2QQMA 4DXTA 3K77A 1ULPA 3ZM8A 1PX3A 1XPWA 3OEAA 2W3JA 2Y6KA 1PMJX 4A42A 1O8PA 2QQIA 2VZOA 1DLCA 3CZJA 2W1UA 3A21A 4M4RA 4CUAA 4QDRA 3LEGA 3C7OA 5IJRA 5B4NA 4BK4A 4E8DA 5C70A 1OF3A 3OGVA 3MO4A 1K12A 3GM8A 4MGQA 5EJ1B 5LCWL 2ZEYA 1UWWA 4P08A 4UI9L 3W5MA 1UY2A 4DUVA 3WNMA 1R64A 1GUIA 1HN1A 2KD7A 2B9VA 3ACFA 1UY4A 2WUHA 5JMOA 1KGYA 2VZ1A 3I3EA 3LQCA 1JYNA 4ZZ8A 3P1IA 3LEKA 5EJZB 3SEPA 4CU8A 3C7FA 1UYXA 1OF4A 4XUNA 3VD3A 2W87A 4OMDA 3DYOA 2BGOA 1JZ8A 2J1SA 3K4ZA 2J1EA 2WABA 5F7UA 2BBAA 3J7HA 5IFPA 3HJRA 5EIYB 4BDVB 1UY3A 2ZXQA 1SHWB 2WBKA 1OT5A 3T09A 3NQHA 5CZKA 1D7PM 4KI5M 3I2FA 2RVAA 3NJXA 1CIYA 3BN6A 3FHQA 5G04L 4A4AA 2V5DA 4DEVA 2WO2A 4QX3A 2EICA 1CZVA 2W1SA 2E32A 3IB3A 2Y6HA 1US2A 2VZTA 4MOAA 5JR2A 3I2HA 3K46A 2VCAA 2JDAA 3WNPA 2W1WA 2VQTA 2VC9A 2J1VA 4W50A 4W4ZA 5JXHA 3WF4A 2VOTA 5DN2A 3T2PA 3SKVA 4QX1A 4DUWA 4JKKA 3IDAA 1T2XA 2CDOA 2J1TA 4XUOA 1L7QA 1W9SA 2C4XA 3T2OA 4QX0A 1L7RA 2QQJA 3SEEA 1XNTA 2Y64A 2YFZA 4IUGA 4QPWA 4OYUA 3WNKA 4L0PA 3UESA 1I5PA 1NAEA 3CMGA 3NJVA 2R7EB 1W9TA 1XC6A 5LA2A 2XQXA 4JKMA 2WZ8A 2HYXA 3MV11 4QB6A 5HXMA 2EIDA 3WF3A 4DEQA 4A45A 1GOHA 3IAPA 3T0DA 3AC0A 1OH4A 4ZXEA 3MUZ1 2EIBA 3WF2A 4BXSV 4QDQA 1JU4A 3C7GA 2VMFA 2VM9A 4E8CA 3WQBA 5I0DA 4QB1A 4TTGA 3HNMA 1TG7A 3ACIA 1OD3A 2W92A 2XHNA 2W95A 2VTFA 2W94A 4CUCA 1WCQA 1CX1A 3CIHA 2VJXA 1UMIA 3FN9A 1K42A 5DPNA 3K4AA 2RJ2A 2L9LA 1EUUA 4GWIA 5C7GA 4LKSA 3HOBA 3DYPA 1J84A 1UYZA 2Y6LA 4OZOA 2WQ8A 3T2QA 4BK5A 4Z2AA 4P02B 1O59A 4XURA 5LA1A 1JYVA 3THDA 3NRUA 3VD4A 3OG2A 2VZQA 3A22A 2X10A 3E1F1 1DP0A 5JXJA 1JZ4A 5C71A 2ID4A 2PQSA 4QB2A 5G05L 3WSOA 2JE8A 1GOGA 2W47A 1UXXX 3MBWA 1JZ2A 2W9XA 4CVUA 4RYDA 3ETPA 2J1RA 5DQ0A 1CZSA 2DDUA 4MO3M 3CKHA 1UZ0A 4RN5A 5B4XA 4LQRA 2WN3A 1SDDB 3FHAA 2VZVA 4JKLA 3VDAA 1JYWA 1NKGA 4YPJA 3GGLA 3HPNA 3GDBA 3OEBA 1GU3A 2RV9A 2E33A 2VCCA 5JXGA 3I2JA 2WN2A 5IYYA 2DCJA 1JZ6A 2J7MA 1IQDC 1F4HA 2B4KA 3ACHA 2V4VA 2WAAA 4MGSA 3HNYM 1P8JA 1UMHA 3ACGA 2DCKA 2ORZA 3I2IA 2ZEWA 5LA0A 3T0AA 3WF1A 2XONA 5JXIA 3PUIA 2Y8KA 3IAQA 1W8NA 4JX0A 2C26A 2BGPA 5IHRA 3THCA 1K45A 4GWJA 1UY1A 3A23A 2BERA 3UNPA 3NNGA 3OGSA 1RYYA 4TXWA 4UOJA 1MPXA 1H6XA 1GQPA 3F2ZA 3LE0A 2Z4FA 3HN3A 4OMCA 3I3BA 2YC4A 3K4DA 1UX7A 2J1AA 2WO3A 2QQNA 3DYMA 4GZ9A 2EIEA 4QX2A 4A6OA 3DECA 2VMDA 4DXSA 4ARXA 3BGAA 2ZEZA 1GOFA 4AG4A 2VL4A 2W5FA 3SKJE 3VD7A 3OGRA 4M4PA 2VO5A 3D3AA 5HPOA 5FUIA 2VMCA 2YFUA 2ZEXA 3I2KA 3EB7A 2E26A 3VDBA 1JZ3A 1UY0A 1US3A 2VZUA 5JUVA 2CDPA 4JHZA 4A3ZA 1K3IA 2VCBA 2VMEA 2C9KA 4KMQA 3ABZA 1CZTA 2YB7A 3PUHA 3LPFA 4FI9A 1W99A 3C8XA 1SG3A 4BJ0A 2W91A 4LHSA 2XOMA 3IIIA 1WKYA 3VDCA 4D8MA 1JYXA 2W1QA 3P6BA 4P5YA 1KEXA 2QBXA 2E31A 2VZRA 2QQKA 4DXRA 4XZUG 3UETA 2HLEA 4UAPA 2WO1A 1JZ5A 2V72A 1H6YA 1GNYA 1JZ7A 4ZZ5A 1JHJA 4ET7A 5DMYA 3WEZA 1NUKA 2YG0A 1JI6A 4CU7A 2QQLA 3I3DA 4ARYA 1ULOA 3U37A 2JKXA 3MUY1 4XUQA 3CZUA 4PQQA 2WAOA 4CUBA 5A1AA 4PF1A 3C7EA 3JXSA 2VZ3A 3OB8A 3LPGA 2VQUA 3CQOA 3ECQA 4QAWA 4KWUA 4HG6B 3WNNA 1TVGA 1PX4A 4P00B 1W9WA 1F4AA 2WYSA 4XUTA 1J83A 2W46A 1NX9A 2VR4A 1DYOA 3K75B 1UXZA 2ORXA 2Y6JA 3W5NA 3I97A 4DUXA 1XNAA 2J1UA 1GMMA 3A7QA 1W8OA 3EYPA 1PMHX 4XUPA 4MADA 5CYYA 3T0BA 1LNSA 4A44A 2X09A 2YC2A 4QDSA 3T08A 5IFTA 5J1XA 1EUTA 2VZSA 1YQ2A 3WF0A 3VD9A 3VD5A 2QQOA 3CDZB 4LPLA 3WNLA 4CU9A 4CU6A 2BZDA 2Y6GA 1BHGA 1O8SA 2VZPA 1W0NA 3GXUA 4AAXA 4W8JA 4XVHA 4ZY9A 2WDBA 3WNOA 2X05A 3I2GA 3HNBM 4OUEA 4D0QA 4PT6A 2J22A 3FL7A 2LW8A 4A41A 2WZEA 2JD9A 1UYYA 3HEIA 3MV01 3LEIA 2OKXA 3C7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OBA A;  2LS6 A;  1JU3 A;  2QQM A;  4DXT A;  3K77 A;  1ULP A;  3ZM8 A;  1PX3 A;  1XPW A;  3OEA A;  2W3J A;  2Y6K A;  1PMJ X;  4A42 A;  1O8P A;  2QQI A;  2VZO A;  1DLC A;  3CZJ A;  2W1U A;  3A21 A;  4M4R A;  4CUA A;  4QDR A;  3LEG A;  3C7O A;  5IJR A;  5B4N A;  4BK4 A;  4E8D A;  5C70 A;  1OF3 A;  3OGV A;  3MO4 A;  1K12 A;  3GM8 A;  4MGQ A;  5EJ1 B;  5LCW L;  2ZEY A;  1UWW A;  4P08 A;  4UI9 L;  3W5M A;  1UY2 A;  4DUV A;  3WNM A;  1R64 A;  1GUI A;  1HN1 A;  2KD7 A;  2B9V A;  3ACF A;  1UY4 A;  2WUH A;  5JMO A;  1KGY A;  2VZ1 A;  3I3E A;  3LQC A;  1JYN A;  4ZZ8 A;  3P1I A;  3LEK A;  5EJZ B;  3SEP A;  4CU8 A;  3C7F A;  1UYX A;  1OF4 A;  4XUN A;  3VD3 A;  2W87 A;  4OMD A;  3DYO A;  2BGO A;  1JZ8 A;  2J1S A;  3K4Z A;  2J1E A;  2WAB A;  5F7U A;  2BBA A;  3J7H A;  5IFP A;  3HJR A;  5EIY B;  4BDV B;  1UY3 A;  2ZXQ A;  1SHW B;  2WBK A;  1OT5 A;  3T09 A;  3NQH A;  5CZK A;  1D7P M;  4KI5 M;  3I2F A;  2RVA A;  3NJX A;  1CIY A;  3BN6 A;  3FHQ A;  5G04 L;  4A4A A;  2V5D A;  4DEV A;  2WO2 A;  4QX3 A;  2EIC A;  1CZV A;  2W1S A;  2E32 A;  3IB3 A;  2Y6H A;  1US2 A;  2VZT A;  4MOA A;  5JR2 A;  3I2H A;  3K46 A;  2VCA A;  2JDA A;  3WNP A;  2W1W A;  2VQT A;  2VC9 A;  2J1V A;  4W50 A;  4W4Z A;  5JXH A;  3WF4 A;  2VOT A;  5DN2 A;  3T2P A;  3SKV A;  4QX1 A;  4DUW A;  4JKK A;  3IDA A;  1T2X A;  2CDO A;  2J1T A;  4XUO A;  1L7Q A;  1W9S A;  2C4X A;  3T2O A;  4QX0 A;  1L7R A;  2QQJ A;  3SEE A;  1XNT A;  2Y64 A;  2YFZ A;  4IUG A;  4QPW A;  4OYU A;  3WNK A;  4L0P A;  3UES A;  1I5P A;  1NAE A;  3CMG A;  3NJV A;  2R7E B;  1W9T A;  1XC6 A;  5LA2 A;  2XQX A;  4JKM A;  2WZ8 A;  2HYX A;  3MV1 1;  4QB6 A;  5HXM A;  2EID A;  3WF3 A;  4DEQ A;  4A45 A;  1GOH A;  3IAP A;  3T0D A;  3AC0 A;  1OH4 A;  4ZXE A;  3MUZ 1;  2EIB A;  3WF2 A;  4BXS V;  4QDQ A;  1JU4 A;  3C7G A;  2VMF A;  2VM9 A;  4E8C A;  3WQB A;  5I0D A;  4QB1 A;  4TTG A;  3HNM A;  1TG7 A;  3ACI A;  1OD3 A;  2W92 A;  2XHN A;  2W95 A;  2VTF A;  2W94 A;  4CUC A;  1WCQ A;  1CX1 A;  3CIH A;  2VJX A;  1UMI A;  3FN9 A;  1K42 A;  5DPN A;  3K4A A;  2RJ2 A;  2L9L A;  1EUU A;  4GWI A;  5C7G A;  4LKS A;  3HOB A;  3DYP A;  1J84 A;  1UYZ A;  2Y6L A;  4OZO A;  2WQ8 A;  3T2Q A;  4BK5 A;  4Z2A A;  4P02 B;  1O59 A;  4XUR A;  5LA1 A;  1JYV A;  3THD A;  3NRU A;  3VD4 A;  3OG2 A;  2VZQ A;  3A22 A;  2X10 A;  3E1F 1;  1DP0 A;  5JXJ A;  1JZ4 A;  5C71 A;  2ID4 A;  2PQS A;  4QB2 A;  5G05 L;  3WSO A;  2JE8 A;  1GOG A;  2W47 A;  1UXX X;  3MBW A;  1JZ2 A;  2W9X A;  4CVU A;  4RYD A;  3ETP A;  2J1R A;  5DQ0 A;  1CZS A;  2DDU A;  4MO3 M;  3CKH A;  1UZ0 A;  4RN5 A;  5B4X A;  4LQR A;  2WN3 A;  1SDD B;  3FHA A;  2VZV A;  4JKL A;  3VDA A;  1JYW A;  1NKG A;  4YPJ A;  3GGL A;  3HPN A;  3GDB A;  3OEB A;  1GU3 A;  2RV9 A;  2E33 A;  2VCC A;  5JXG A;  3I2J A;  2WN2 A;  5IYY A;  2DCJ A;  1JZ6 A;  2J7M A;  1IQD C;  1F4H A;  2B4K A;  3ACH A;  2V4V A;  2WAA A;  4MGS A;  3HNY M;  1P8J A;  1UMH A;  3ACG A;  2DCK A;  2ORZ A;  3I2I A;  2ZEW A;  5LA0 A;  3T0A A;  3WF1 A;  2XON A;  5JXI A;  3PUI A;  2Y8K A;  3IAQ A;  1W8N A;  4JX0 A;  2C26 A;  2BGP A;  5IHR A;  3THC A;  1K45 A;  4GWJ A;  1UY1 A;  3A23 A;  2BER A;  3UNP A;  3NNG A;  3OGS A;  1RYY A;  4TXW A;  4UOJ A;  1MPX A;  1H6X A;  1GQP A;  3F2Z A;  3LE0 A;  2Z4F A;  3HN3 A;  4OMC A;  3I3B A;  2YC4 A;  3K4D A;  1UX7 A;  2J1A A;  2WO3 A;  2QQN A;  3DYM A;  4GZ9 A;  2EIE A;  4QX2 A;  4A6O A;  3DEC A;  2VMD A;  4DXS A;  4ARX A;  3BGA A;  2ZEZ A;  1GOF A;  4AG4 A;  2VL4 A;  2W5F A;  3SKJ E;  3VD7 A;  3OGR A;  4M4P A;  2VO5 A;  3D3A A;  5HPO A;  5FUI A;  2VMC A;  2YFU A;  2ZEX A;  3I2K A;  3EB7 A;  2E26 A;  3VDB A;  1JZ3 A;  1UY0 A;  1US3 A;  2VZU A;  5JUV A;  2CDP A;  4JHZ A;  4A3Z A;  1K3I A;  2VCB A;  2VME A;  2C9K A;  4KMQ A;  3ABZ A;  1CZT A;  2YB7 A;  3PUH A;  3LPF A;  4FI9 A;  1W99 A;  3C8X A;  1SG3 A;  4BJ0 A;  2W91 A;  4LHS A;  2XOM A;  3III A;  1WKY A;  3VDC A;  4D8M A;  1JYX A;  2W1Q A;  3P6B A;  4P5Y A;  1KEX A;  2QBX A;  2E31 A;  2VZR A;  2QQK A;  4DXR A;  4XZU G;  3UET A;  2HLE A;  4UAP A;  2WO1 A;  1JZ5 A;  2V72 A;  1H6Y A;  1GNY A;  1JZ7 A;  4ZZ5 A;  1JHJ A;  4ET7 A;  5DMY A;  3WEZ A;  1NUK A;  2YG0 A;  1JI6 A;  4CU7 A;  2QQL A;  3I3D A;  4ARY A;  1ULO A;  3U37 A;  2JKX A;  3MUY 1;  4XUQ A;  3CZU A;  4PQQ A;  2WAO A;  4CUB A;  5A1A A;  4PF1 A;  3C7E A;  3JXS A;  2VZ3 A;  3OB8 A;  3LPG A;  2VQU A;  3CQO A;  3ECQ A;  4QAW A;  4KWU A;  4HG6 B;  3WNN A;  1TVG A;  1PX4 A;  4P00 B;  1W9W A;  1F4A A;  2WYS A;  4XUT A;  1J83 A;  2W46 A;  1NX9 A;  2VR4 A;  1DYO A;  3K75 B;  1UXZ A;  2ORX A;  2Y6J A;  3W5N A;  3I97 A;  4DUX A;  1XNA A;  2J1U A;  1GMM A;  3A7Q A;  1W8O A;  3EYP A;  1PMH X;  4XUP A;  4MAD A;  5CYY A;  3T0B A;  1LNS A;  4A44 A;  2X09 A;  2YC2 A;  4QDS A;  3T08 A;  5IFT A;  5J1X A;  1EUT A;  2VZS A;  1YQ2 A;  3WF0 A;  3VD9 A;  3VD5 A;  2QQO A;  3CDZ B;  4LPL A;  3WNL A;  4CU9 A;  4CU6 A;  2BZD A;  2Y6G A;  1BHG A;  1O8S A;  2VZP A;  1W0N A;  3GXU A;  4AAX A;  4W8J A;  4XVH A;  4ZY9 A;  2WDB A;  3WNO A;  2X05 A;  3I2G A;  3HNB M;  4OUE A;  4D0Q A;  4PT6 A;  2J22 A;  3FL7 A;  2LW8 A;  4A41 A;  2WZE A;  2JD9 A;  1UYY A;  3HEI A;  3MV0 1;  3LEI A;  2OKX A;  3C7H A; 
#chains in the Genus database with same CATH topology
 4YGB A;  1JU3 A;  5DDJ 1;  5IK8 A;  2WNV B;  3AZV A;  4UW4 A;  1VRH 1;  3OJB A;  2GH8 A;  1ULP A;  3JCI A;  5FZO B;  3AP6 A;  1Q3E A;  1PX3 A;  2ERF A;  3KD4 A;  1BXH A;  2BNN A;  3MF9 A;  4JV4 A;  1V6O A;  2BVV A;  2WT2 A;  3OEA A;  5DUW A;  2WT1 A;  2Y6K A;  1QJU 3;  3ZMO A;  1KS4 A;  3VBF A;  3E5X A;  2F4L A;  2GNB A;  2QQI A;  3I59 B;  4YVS B;  5A7N A;  2XVG A;  1AR8 2;  4A3X A;  4YYO A;  5FZO A;  1DLC A;  3AJY A;  3CZJ A;  4IER A;  3H42 B;  4N7I A;  3EHK A;  3A21 A;  3PME A;  1W2U A;  3LEG A;  4CEW C;  3H50 A;  1ZX5 A;  4W65 A;  4BK4 A;  1V0A A;  2PTM A;  1CQ9 A;  1BZW A;  4P14 A;  3VDD A;  5KHG A;  3EBR A;  3OOX A;  4JGY C;  4CDQ B;  3RSJ A;  5FZ4 A;  2A3X A;  3USS A;  2ET7 A;  2IFW A;  2ZZJ A;  5L73 A;  4NVP A;  3GZT B;  3ZN5 A;  2Z69 A;  1X9P A;  3GCX A;  3H3L A;  1RIR A;  4PLN A;  1FMD 3;  3HT2 A;  2R07 2;  3HAG A;  1OLQ A;  1UY2 A;  3POY A;  1GAN A;  4XAE A;  4E4Z A;  3PLQ A;  3WNM A;  3MIG A;  4LKE A;  5CG8 A;  2KD7 A;  4ORF A;  3V0B A;  2ZAC A;  2WUH A;  1RUG 2;  4WM8 A;  2ZZQ A;  3BU7 A;  4JGZ A;  5FPU A;  3VZJ A;  5JMO A;  1KGY A;  5C33 A;  3KM5 A;  3POW A;  5TSW A;  3ZKY A;  5A3M A;  3ZYP A;  1O3Q A;  1UOG A;  3LEK A;  3MLJ A;  5EV7 A;  5EJZ B;  5FZ3 A;  2XPJ A;  4B8E A;  1UYX A;  4XUN A;  4AI2 A;  1DU3 D;  5JVV A;  1C8M 2;  1UOF A;  3DYO A;  1VRH 3;  5CAZ A;  1HDK A;  1Q8P A;  1LOF C;  3UGH A;  1J1L A;  2BU9 A;  2SLI A;  5FYB A;  1QJY 3;  3KV9 A;  1SPP A;  5LAT A;  2D6L X;  3IT8 A;  1OH3 A;  4LBQ A;  2HWC 3;  2YBP A;  2J1S A;  3M70 A;  2J1E A;  4PDW B;  1ASJ 2;  1QY4 A;  1OKO A;  1AYN 3;  3SMH A;  2ZXQ A;  3NJZ A;  2EAL A;  4SBV A;  4NO4 A;  5KXB A;  3N7M A;  1OT5 A;  3L2Y A;  2A73 B;  3ATG A;  3NNM A;  3OYW B;  4KBZ A;  3T09 A;  3NQH A;  2WIN B;  4UFL A;  3ENR A;  3KQR A;  3U78 A;  4N9I A;  5JR7 B;  2JJ6 A;  4Q29 A;  2EXJ A;  1VBA 3;  3NL1 A;  2V5D A;  2ZKL A;  4BME A;  4DEV A;  2DV9 A;  1WD4 A;  4XF1 A;  4RHV 3;  2VQA A;  3SLI A;  2Y34 A;  3ZXA C;  2BTV C;  2Q8O A;  3AP9 A;  3GBF A;  5C8C B;  2XBO 1;  4JHT A;  4HN1 A;  3VBR B;  2R04 3;  2ZBJ A;  2JG8 A;  3KWV A;  2V5Y A;  2WFP A;  1SLA A;  4IEU A;  2VC9 A;  2R32 A;  4BM8 A;  1I1E A;  1LCL A;  4H7L A;  3G6J B;  2BEO A;  5E88 A;  2BPA 2;  5KHH A;  2E53 A;  2XKP A;  2VOT A;  3B94 A;  2BRT A;  4OQ9 A;  4AVC A;  1GBG A;  4GJY A;  3N4M A;  4RGA A;  1YJK A;  4DUW A;  4JKK A;  3IDA A;  2BJS A;  3IDE A;  1G9B A;  2CGP A;  4XTM A;  4XUO A;  1AR7 2;  1L7Q A;  1W9S A;  4M0H A;  4U36 A;  2BW8 A;  4KH9 A;  3ORJ A;  3USU B;  1LAJ A;  1FOD 3;  3LFM A;  1A78 A;  1RUJ 1;  2QQJ A;  2R04 1;  1XNT A;  2Y64 A;  4AXO A;  3TN9 2;  4URA A;  3MIH A;  4NHY A;  1CAX B;  2B9U A;  2GZW A;  1RC6 A;  4IGO A;  1ND3 C;  4WM7 C;  3EJK A;  1ZRC A;  1H0B A;  2HWE 1;  3JBG 3;  4LKD A;  2GC0 A;  2D6M A;  4OZX A;  1HRI 3;  1U5X A;  1WCD J;  3DN7 A;  4MV2 A;  3OBT A;  2MEV 1;  3MFC A;  3UES A;  1H9P A;  1UU5 A;  3H3U A;  5A7P A;  5BV6 A;  3ZSK A;  1XC6 A;  1NYW A;  2Q0A A;  3RZH A;  1QF3 A;  1O3T A;  5FK8 A;  2WZ8 A;  4KL1 A;  4OCT A;  5ABJ C;  4D7T A;  1F5F A;  3WW2 A;  4PI0 A;  3BTZ A;  1YIF A;  2IXK A;  2FBE A;  2EID A;  1UX6 A;  4A45 A;  2HWE 3;  3JBG 1;  4HSJ A;  4X8P A;  1XE7 A;  4XMI A;  2RS3 2;  2EIB A;  3MUZ 1;  5J96 B;  4BXS V;  5KHI A;  3LOB A;  1YWK A;  2VOK A;  1LES A;  1W3X A;  3B01 A;  3M3C A;  4IND A;  4ASK A;  4E8C A;  4CEW B;  5I0D A;  3I7D A;  1C5I A;  1NLS A;  3UL2 A;  1ULC A;  4OI2 A;  1Y9Q A;  2G9G A;  1TG7 A;  4JDN A;  2QTW B;  5A1F A;  2ZHK A;  1XE0 A;  4FT8 A;  5FPB A;  4CCM A;  1DQ4 A;  2Z5W A;  2DUP A;  3PU3 A;  1OA3 A;  2RDR A;  1NQJ A;  4LNV A;  4IV1 A;  2HBU A;  3LEM A;  4OHY A;  5SV5 A;  1Y3T A;  4JRA A;  1FOD 1;  3T30 A;  1HRV 2;  4HON A;  5A32 B;  5CFD A;  3TOJ A;  3KHC A;  3K48 A;  1UMI A;  3Q8E A;  2OT7 A;  2IWG B;  3LWC A;  4K1Y A;  1K42 A;  5KXC A;  4HAN A;  4RQP A;  4CXW A;  1B09 A;  2JEN A;  1GWL A;  4XFI A;  3RPQ A;  2Y6F A;  5C7G A;  3HOB A;  1J84 A;  3VBU B;  4OZO A;  2RHP A;  2WQ8 A;  4BK5 A;  4BQW A;  3LF7 A;  5AC9 1;  1QJZ A;  3ACL A;  4AI3 A;  3N35 A;  5LA1 A;  3RYK A;  1COV 2;  4YW6 A;  5A7Q A;  2K2S A;  2VZQ A;  3A22 A;  1V6N A;  5LCW L;  5BNN C;  4Y22 B;  4Z1V A;  3WDY A;  3PMS A;  3ZYG A;  4CPB D;  5JXJ A;  1JZ4 A;  1ZRI A;  1NQD A;  2OVU A;  4YRD A;  2E63 A;  4UBH A;  1LU1 A;  2JIG A;  1KJL A;  3OBZ A;  3WSO A;  1ACC A;  4CXX A;  1ZM1 A;  1LJ7 A;  5IVY A;  1GOG A;  2W47 A;  3MBW A;  3ZN6 B;  1JZ2 A;  3VBH B;  1W39 A;  1R1A 1;  3ETP A;  2VW1 A;  3DPR C;  3SXW A;  5ABJ B;  1EYB A;  4NII A;  4BYY A;  2RS5 2;  5DQ0 A;  2I2S A;  4NN0 A;  2VNV A;  1CZS A;  1UQX A;  2ILM A;  4LMF A;  1UIJ A;  5FYM A;  5GAL A;  4MO3 M;  2TEP A;  5KWR A;  3KV6 A;  1GR3 A;  1J59 A;  2H0V A;  2WWU A;  3DF0 A;  3JQW A;  1JYW A;  1NKG A;  4W6X A;  4FPK A;  3LFI A;  3OEB A;  4HVO A;  3DXU A;  2ARA A;  4H3W A;  3MIB A;  2E33 A;  4MXW A;  4GKY A;  2VCM A;  2XLA A;  2IXH A;  5EHD A;  1R09 2;  2D98 A;  5JMC A;  1IQD C;  1Q56 A;  3V0A A;  3B7M A;  3RWK X;  2B4K A;  2QDN A;  3LIG A;  1YQC A;  3O1V A;  2V4V A;  1YXW A;  2WSU A;  5FMO S;  4AGG A;  1W0O A;  4MGS A;  3HNY M;  2D3S A;  4XBQ A;  1EAH 3;  4GJZ A;  2VW0 A;  3ACG A;  1HRI 1;  3FWE A;  2A3Y A;  3KGL A;  5FP7 A;  4QM8 A;  3T0A A;  1UL9 A;  1VR3 A;  4HMZ A;  3WP3 A;  4AFB A;  4W6W A;  3NNF A;  5DAB A;  1RUF 1;  4LHN A;  4KWL A;  4C91 A;  2Y60 A;  1W8N A;  4LTA A;  2H6C A;  3ZO0 B;  2C26 A;  2E7T A;  4UBG A;  3AB0 A;  2VEC A;  1VAM A;  5JSO A;  5C9A B;  5K0U A;  5C8C C;  1LKN A;  3PL0 A;  4K21 A;  1XE8 A;  2R06 2;  1RUI 1;  4BCU A;  5LWB A;  5FZI A;  1FT9 A;  3VL9 A;  1RUD 1;  5C3R A;  4R8H A;  3UNP A;  2P3Y A;  3OGS A;  1TME 1;  2GN7 A;  2XQR A;  3KB5 A;  1N1T A;  2XJV A;  4KNC A;  5BY5 A;  1OKQ A;  1Y7B A;  3M3I A;  1WW4 A;  2XJQ A;  3NWK A;  1J1T A;  1MPX A;  1GQP A;  2D6O X;  3F2Z A;  4N43 C;  4AOC A;  3SH3 A;  2VE1 A;  2YC4 A;  2DUQ A;  4IV3 A;  3URF A;  1OQD A;  2D43 A;  4QQP A;  1PHM A;  5FYU A;  2WO3 A;  2Q8E A;  2ATF A;  4IE0 A;  5FXW A;  1MVQ A;  1VBD 2;  2A6X A;  2YGL A;  2WJS A;  4CRQ A;  1W03 A;  1STM A;  2JDU A;  3MIE A;  4YLZ A;  1AF9 A;  4K8F A;  4IE7 A;  4LBQ D;  3RMX A;  1OLM A;  2JG9 B;  1U5Y A;  1AR8 3;  3PTY A;  4AHX A;  2Q1Z B;  1QJF A;  5J48 A;  4DXS A;  4ARX A;  1FV2 A;  1QKQ A;  3BGA A;  3B02 A;  2GSY A;  3POB A;  4RD7 A;  5EFU A;  4OI0 A;  5T54 A;  3I3Q A;  2QQU A;  2DU0 A;  4Q2F A;  5K4L A;  5C3P A;  4XFB A;  3D3A A;  2DVA A;  2ZGN A;  2VNR A;  1HRV 1;  1NCR C;  1W05 A;  3JZV A;  1DZQ A;  5A3N A;  2XL7 A;  4FP2 A;  3MDP A;  4OUL A;  4NRM A;  2YFU A;  4FTE A;  3FMG A;  2EVX A;  2DTY A;  2E26 A;  5D1I A;  1YYN A;  4FPE A;  1TEI A;  2XBO 2;  4FTB A;  2B8M A;  3U0Z A;  2IVI B;  1UY0 A;  4Q4Y 2;  1QIQ A;  4CEW A;  3R05 A;  1US3 A;  1SBF A;  2CDP A;  4CDQ C;  4YM1 A;  3P3P A;  3ZYB A;  4GH4 A;  4NIG A;  1K3I A;  4CA9 A;  2VME A;  2C9K A;  1LGC A;  4BOW A;  2HWB 1;  3VZK A;  2VBP A;  1HQW A;  5IK7 A;  1DQ6 A;  4P9Y A;  1HW5 A;  2XML A;  3LKJ A;  1AR6 2;  2A6Y A;  3OY8 B;  4RGG A;  2ZGS A;  1CGP A;  1FAY A;  5F6K A;  3TAY A;  2F17 A;  1QJY 2;  4UT5 A;  2PAM A;  2VAU A;  4FPG A;  5CG9 A;  1BBT 2;  1J3R A;  3III A;  1LR5 A;  1WKY A;  5FYV A;  3TEX A;  1U12 A;  1RJ8 A;  4Q4Y 3;  4TLG A;  2LRO A;  2UUR A;  2GP5 A;  3HR9 A;  5CKQ A;  3LSD A;  1MZ6 A;  5J98 B;  1KEX A;  4BH9 A;  4L8Q A;  1FPN 1;  4OFG A;  1CAX A;  4RS5 B;  1GLH A;  4DXR A;  5IT6 A;  1UAI A;  1BCX A;  5FP4 A;  3D6E A;  3UET A;  3UGF A;  1QHD A;  4LUM A;  5FZB A;  5K0U B;  5BNN A;  4K20 A;  3OCP A;  2XB6 C;  4UAP A;  4NWW A;  1SQ4 A;  4XFC A;  4FTS A;  2V72 A;  5A3U A;  4Q5O A;  1A3K A;  4XFA A;  5C6C A;  1X82 A;  4ZZ5 A;  1DGR N;  4NIA A;  3WEZ A;  4JCK A;  2DVG A;  2JDH A;  1NUK A;  3P3N A;  4FOV A;  4ZXK A;  1Q43 A;  3LA3 A;  1PNG A;  4AED A;  1GQG A;  4MLO A;  5KR7 A;  1IG0 A;  1QDC A;  2JG8 B;  3BOW A;  2D93 A;  1VJ2 A;  4UW3 A;  2QQL A;  3DCQ A;  5J09 A;  1Q8S A;  4D6Q A;  1ULO A;  2GME A;  2HWB 2;  4J6G A;  3U37 A;  1DLL A;  2JKX A;  1VP6 A;  2R16 A;  5A7S A;  5CFC B;  5F5C A;  3U14 A;  3CZU A;  5A1A A;  1E57 A;  3H8R A;  3C7E A;  2CWS A;  3OB8 A;  1MS0 A;  2WZR 1;  4EN9 B;  4F83 A;  2WS9 3;  3CQO A;  4PHZ A;  3ECQ A;  4FPJ A;  4Y24 A;  1C1F A;  4M01 A;  5I8Y A;  1XU2 A;  1ZZB A;  3WNN A;  4QPI A;  2QKD A;  3PIG A;  1H2K A;  1PX4 A;  5JSP A;  1ENQ A;  1XRU A;  2ZGR A;  2ZGL A;  4AW7 A;  3H1Y A;  3AYC A;  5SV8 A;  3VBH A;  5L9R A;  1VBD 3;  2OPK A;  2W46 A;  5GM0 A;  3G7D A;  4QMA A;  5LY2 A;  5FOJ B;  1RUC 3;  1ULF A;  4K40 A;  4XJA A;  1RIN A;  5EPA A;  1EV1 3;  3I97 A;  5JIA A;  5CB7 A;  2PHR A;  3M3O A;  5EXO A;  1W8O A;  1VBE 1;  3IPV B;  5GJ6 A;  1PMH X;  2ZPX A;  1DGL A;  1GZC A;  5HXV A;  2IVJ A;  1CJD A;  4NHM A;  3AMP A;  1GSL A;  2E9Q A;  1CPN A;  3RGB A;  2E51 A;  2UU8 A;  2JKB A;  4DY3 A;  1MVE A;  3DEM A;  4I02 A;  4LHL A;  4Q26 A;  3WQ1 A;  3HBK A;  3IPV A;  4J1X A;  4E4S A;  4OLL A;  1TMF 3;  3T08 A;  2FCU A;  4IL7 A;  1W8U A;  2JE9 A;  4AWD A;  4LIV A;  2VZS A;  5JZG C;  1BBT 3;  2HWC 1;  2ARC A;  5IWF A;  4YFZ A;  2WZR 3;  4FCA A;  2B5H A;  1YEW A;  4JRL A;  4AEJ A;  2D5F A;  1OI6 A;  1RUH 1;  5CFC C;  3FZ3 A;  2A71 A;  2ZGO A;  1O8S A;  2FDJ A;  4YVW A;  4YZ3 A;  3Q8C A;  1W0N A;  3F95 A;  4W8J A;  4ZY9 A;  4WVM B;  1SBE A;  2AUY A;  2WDB A;  1JUI A;  2CY6 A;  3Q9O A;  2A70 A;  4XQD A;  4EWA A;  1LEM A;  2C0Z A;  4QXB A;  2RM2 2;  4Y26 A;  3GNE A;  4UFJ A;  1DGR A;  2XBO 3;  5FZD A;  3OBR A;  2Q5T A;  4FPC A;  4AEM A;  4OUE A;  3ZX7 A;  1COV 3;  1DIW A;  4A41 A;  2WZE A;  3NMB A;  1UYY A;  1AZD A;  3MV0 1;  5T50 A;  4BQ3 A;  4RS5 A;  1PO1 1;  1AL2 2;  4KQ7 A;  3SCH A;  4XOG A;  4DXT A;  1VBC 3;  2DCY A;  1SLB A;  1V6M A;  4Q0Q A;  1ZRE A;  2FMD A;  1PMJ X;  2VPV A;  1UKR A;  3WD5 A;  1V00 A;  1DQ1 A;  1O8P A;  3VZL A;  3RDI A;  3ZFG B;  1EPZ A;  1UW8 A;  2GP3 A;  4AI0 A;  2VZO A;  5H9Q A;  1AX0 A;  4QGM A;  4AFC A;  3DV8 A;  3POE A;  5FMD A;  5IAX A;  4CUA A;  4XDP A;  5I8S A;  5FAX A;  3C7O A;  4OHZ A;  5F3C A;  3GHN A;  2QCS B;  1OLM E;  1SLC A;  4I30 A;  2IXI A;  2X5I C;  3OGV A;  1WBL A;  1RMU 1;  3MO4 A;  1K12 A;  1G9F A;  1OUX A;  3I4I A;  4G3Y C;  5F8P A;  3WP6 A;  2Q1M A;  4P08 A;  1GZW A;  4EZH A;  1YLL A;  3O1S A;  1YFX A;  3WP4 A;  2VUD A;  1HB4 A;  5DAQ A;  2VD7 A;  1SLT A;  3NV3 A;  2Q8C A;  3U11 A;  1VBE 2;  3R4D B;  1KDK A;  4AR2 A;  3MI8 A;  3ZIW A;  2FZ2 A;  4P5H A;  3ZPO A;  1W6Q B;  2YMZ A;  4E4D X;  3O0V A;  2QVS B;  1NA1 B;  2TUN A;  4B7K A;  3DPR A;  3U75 A;  3I2O A;  2WNU B;  1KD7 A;  4W6Y A;  1GFF 2;  3SEP A;  4M0N A;  4CU8 A;  1XND A;  2DCZ A;  4AEK A;  3VD3 A;  4OMD A;  2FDK A;  4DOU A;  1QJE A;  3TEZ A;  3ZPY A;  3J8F 3;  2JIJ A;  1LB2 A;  2BGO A;  4CP0 A;  3IM0 A;  2W68 A;  3CBN A;  4MSV A;  4YZ4 A;  4B1M A;  4FQ4 A;  1S0F A;  4Y1X A;  3SHR A;  1MS9 A;  3VBS B;  5F7U A;  3SNM A;  4PIZ A;  1LU2 A;  1WWY A;  5T5L A;  1WLW A;  2JDY A;  1Y43 B;  1F9K A;  4XAA A;  1QOS A;  3KVB A;  4ATE A;  3KSC A;  3E5Q A;  4NR1 A;  4KI5 M;  1U0A A;  2RVA A;  3I2F A;  4PBO A;  3J8F 1;  3NJX A;  5KHK A;  3BN6 A;  3MPP G;  2VUL A;  1CIW A;  1OXC A;  3ITQ A;  1CPM A;  1O4Y A;  3ZYH A;  1TMF 1;  3NNJ A;  3K51 A;  4PIX A;  4YM0 A;  1OFN A;  2WO2 A;  1DHK B;  5A3T A;  2QZ2 A;  3IB3 A;  2AZ5 A;  2HWF 2;  4Q4X 2;  1MS5 A;  4XFH A;  1BJQ A;  1M4W A;  4Q4V 3;  3SIT A;  2HEY F;  4HLT A;  1ZRR A;  1US2 A;  2YZ4 A;  3TEW A;  3I2H A;  5FBJ A;  5LBB A;  1SZB A;  1S2B A;  2W1W A;  4Q8L A;  4DRR A;  2VBD A;  1TE1 B;  5A6Z A;  4XE9 A;  3TN9 3;  2D97 A;  5C5U A;  4Q4Y 1;  5A7O A;  5FPL A;  3WG3 A;  5HCH A;  3MW4 A;  1XNB A;  3GCW A;  4C8D A;  5APA A;  3SKV A;  1YIP A;  2V09 A;  2OUJ A;  1QJU 1;  2VW2 A;  1H4H A;  4TLF A;  2CDO A;  4QGN A;  2J1T A;  4IEY A;  3V0A B;  2C4X A;  1HQL A;  4RA0 A;  3S57 A;  2YBS A;  1PIV 1;  2DVF A;  1L7R A;  1KJR A;  4QX0 A;  4MXW B;  5FY5 A;  2A6W A;  4LO7 A;  4LIT A;  1RUO A;  1LOC A;  2SBA A;  3O7O A;  2Q4S A;  3ZR5 A;  2GC2 A;  1LED A;  1HXS 1;  3ILF A;  5FMC A;  1MZ5 A;  1URX A;  2D3R A;  3WNK A;  1AXZ A;  3N9N A;  4YG0 A;  4XF9 A;  4RGK A;  3QCW A;  4V2V A;  1DDL A;  5FZ6 A;  1IGO A;  2YXS A;  2FDI A;  1I5P A;  4AED B;  1G9D A;  2R7E B;  3AFG A;  4YW4 A;  4COV A;  1VBC 1;  4AFA A;  1VBD 1;  4FOQ A;  2D40 A;  1AJK A;  5CAD A;  3EQE A;  1UD1 A;  1QOO A;  3H7J A;  5FXZ A;  5LEJ A;  5LA2 A;  4Q4W 1;  2XQX A;  4AVS A;  1TMF 2;  2HYX A;  3MV1 1;  3BTX A;  2WNV A;  1OUS A;  3AM2 A;  1NCR A;  1W90 A;  3WF3 A;  1V6K A;  2JEC A;  2XLF A;  1GOH A;  5JIU A;  3AC0 A;  1UZZ A;  1OH4 A;  3WF2 A;  4EWD A;  4QDQ A;  1JU4 A;  2BFU S;  3C7G A;  1MZF A;  2GAU A;  5HCF A;  5KC5 A;  5DAP A;  5IAV A;  1ZBE 1;  3MF6 A;  2P5B A;  3GZU C;  4XBN A;  2R6Q A;  4TTG A;  3ACI A;  3ETQ A;  4QHB A;  3ZMN A;  2H0B A;  1WLD A;  2ZX4 A;  2WLQ A;  2BDR A;  4SLI A;  2W94 A;  4IEP A;  4BA6 A;  5DZE A;  1WCQ A;  1J3P A;  1JUH A;  3AXD A;  5T5J A;  3Q8A A;  1ENX A;  3VBU A;  1OOP A;  2RM2 3;  2WRA A;  3FN9 A;  4JZR A;  1M06 G;  1QH6 A;  2RJK A;  3MPB A;  3PDQ A;  2DBI A;  5CNA A;  3FFQ A;  1Q8Q A;  2RJ2 A;  2GC3 A;  3H9A A;  1H1I A;  4GA9 A;  3W58 A;  3VLB B;  4GWI A;  1EUU A;  2GNM A;  4LKS A;  3ZXD A;  4NE9 A;  2BP6 A;  3DYP A;  2Y6L A;  3ZOI A;  3T2Q A;  3BIE A;  1NXM A;  2HWD 1;  4QU1 A;  5FO9 B;  2WFF 1;  1YNA A;  1BK1 A;  4BXF A;  2P4E A;  2XDV A;  5FYH A;  3WHT A;  1JMU B;  3GAL A;  3R4S A;  4GWN A;  3VD4 A;  3OG2 A;  4EN7 B;  1MS4 A;  1JS9 A;  2CGO A;  4Y3O A;  5JDB A;  4D3W A;  4ZKT B;  1PVC 1;  3S5Q A;  3E1F 1;  4HXC A;  2XWJ B;  4Y33 A;  3C3V A;  1RUI 2;  4XEZ A;  4UFI A;  4S2F A;  5C71 A;  1E5R A;  2WKK A;  3AZX A;  3OUH A;  4CSW A;  5LZ6 A;  1D4V B;  1TME 2;  2PQS A;  2YHJ A;  3LDR A;  5G05 L;  2JE8 A;  3ZXJ A;  5IUQ A;  4AQS A;  1PO2 3;  3U07 A;  2W9X A;  4HFS A;  1AR8 1;  4Y22 A;  4CVU A;  3FLT A;  4FBF A;  4CDW B;  1W8F A;  2ES3 A;  4G9S B;  1OQE A;  2VTX J;  3BKZ A;  1PK6 A;  3WV6 A;  5EQU A;  4MGY E;  3OPT A;  4FOW A;  2IXL A;  2DDU A;  3QH6 A;  4L11 A;  2QQP A;  3OF1 A;  3MHZ A;  4XDO A;  2WO7 A;  5FY9 A;  4Y4R A;  5B4X A;  2NZ9 A;  4LQR A;  1W9Y A;  2GND A;  2VZV A;  4L9B A;  1O3R A;  1XNC A;  3GGL A;  4HKO A;  1PK6 C;  1QOT A;  2VXR A;  3GDB A;  4DS0 A;  3O1M A;  3AKS A;  4LXL A;  2VCC A;  4I2O A;  3DXT A;  2CYF A;  4BIS A;  4NHL A;  4GWM A;  5T52 A;  4B4P A;  4YZ1 A;  2NP0 A;  1AYN 2;  2VOV A;  2W2I A;  1S2K A;  5C9A A;  2WFF 3;  1AYM 1;  1F4H A;  1LOA A;  1VBB 3;  5T5O A;  2R07 3;  4XDQ A;  5M0T A;  2ARX A;  2JG8 C;  2PHL A;  3KQ4 B;  1WMD A;  4QD2 A;  1UMH A;  4GQ7 A;  4K8R B;  4KG8 A;  4N43 A;  1PGW 1;  1PZ7 A;  2ORZ A;  1Q8O A;  2ZEW A;  4ZON A;  3VB9 A;  3KZ4 C;  4IV1 C;  2OS2 A;  2X8K A;  2AH2 A;  3VZM A;  3ZYF A;  5FZM A;  1LOD A;  2NN8 A;  3IAQ A;  1JYT A;  3P5B A;  2BGP A;  3QOP A;  3BOP A;  2ZOE B;  3ME2 A;  1LEN A;  4IEV A;  3THC A;  1XYN A;  4XIL A;  5D8A B;  4E9K A;  5C8C A;  1AYM 3;  2O0O A;  3FUO A;  5A33 A;  2YU1 A;  5F1R A;  5K0U C;  2A5Z A;  4D7Y A;  4QPY A;  5I0S A;  2YRO A;  4AVB A;  3IBM A;  3O1O A;  1W2O A;  1CAU B;  2RDQ A;  4HVR A;  4XET A;  3CLP A;  2W39 A;  1Z7S 1;  3VHP A;  2PHX A;  1NA1 C;  4BQ1 A;  1XB9 A;  3VHR A;  3LE0 A;  3IZO A;  2WFF 2;  4DXZ A;  4KGQ A;  5DXD A;  1YUD A;  2R06 3;  4S2D A;  4DIQ A;  1DYP A;  4ZS2 A;  2QQN A;  1KIT A;  3WQ0 A;  1HXS 2;  1PGL 2;  1S1A A;  3DYM A;  4UXA A;  4F7Z A;  5L19 A;  1GP4 A;  3I49 A;  4HSL A;  4A6O A;  3DEC A;  4EN0 A;  2C1F A;  2VMD A;  5BYN A;  2PMW B;  4DFS A;  2ZEZ A;  4AG4 A;  4CPB A;  1QJU 2;  3U4S A;  2VL4 A;  1L7L A;  1CAV B;  3NVC A;  5BNP A;  3IMN A;  3VD7 A;  5DAW A;  4CDX A;  3FX3 A;  3WDX A;  4M4P A;  4AFM A;  2VO5 A;  3TWI A;  3DKW A;  2RR1 1;  5HPO A;  1W2A X;  3N7K A;  3AZY A;  3KGZ A;  3TYJ A;  4FSJ A;  1XYO A;  5FUI A;  3B3Q E;  1O4Z A;  4QPI C;  3I2K A;  2ZEX A;  2WZR 2;  1IOA A;  4Y5S A;  2JDN A;  1ZVF A;  5EP9 A;  2R49 A;  5FY8 A;  3H8O A;  2ZGP A;  1JZ3 A;  2IZW A;  3M1H A;  1WMX A;  3CO2 A;  1CAV A;  4AHY A;  1AXY A;  5FJK A;  1U5I A;  2VZU A;  5F39 A;  5JUV A;  2JDK A;  4JHZ A;  4A3Z A;  3FFZ A;  2AEY A;  4R9A A;  4UW5 A;  4KMQ A;  4Q1R A;  3ABZ A;  1CZT A;  2QZ3 A;  2YB7 A;  2YC0 A;  5FY4 A;  3VBR C;  4PBP A;  4XZP A;  2NMO A;  3PUH A;  3KS7 A;  2YDE A;  1W99 A;  1O5L A;  1X8M A;  3LPF A;  3M4F A;  4XF3 A;  4Q4W 3;  2R06 1;  3RJ2 X;  3VN4 A;  3WHU A;  1WCU A;  2ZAB A;  5GLV A;  3W21 A;  1SLI A;  2DUR A;  1LOB A;  4YM2 A;  5FYZ A;  1BKZ A;  3ES1 A;  1N1V A;  1ULG A;  2DVB A;  3WUD A;  4PDW A;  3ZFE C;  2F4P A;  2I45 A;  4D8M A;  1HJG A;  3KF5 A;  4KWJ A;  3QBQ A;  4MZU A;  1GV9 A;  4CDU A;  4B29 A;  1HXS 3;  3POF A;  4NRO A;  4B4Q A;  3APB A;  5GZF A;  1LHU A;  5F3G A;  4K9S A;  4YW2 A;  1GYK A;  2RS5 3;  1XSQ A;  2CSG A;  1YO8 A;  1BVP 1;  3LGR A;  4XZU G;  2WL1 A;  3JUU A;  2DFB A;  1YFU A;  5IVB A;  2YUE A;  4PDW C;  3UGG A;  1V6J A;  4C0B A;  1RVF 1;  4DQA A;  3AKP A;  1AL2 1;  1AR9 2;  1PO1 2;  1RIT A;  3BPS A;  5J37 A;  5FRE A;  2I74 A;  1V6I A;  3AMM A;  4N7U A;  4YVS A;  1ZZ7 A;  2VMH A;  4AI8 A;  4D6R A;  3ZFG A;  3VBF B;  2R07 1;  2ZMK A;  5F5A A;  4DB5 A;  4ET7 A;  5DMY A;  1JBC A;  1QWR A;  1F2N A;  5FLJ A;  2DU1 A;  4QU2 A;  2Z79 A;  5FPX A;  3PUS A;  4KU7 A;  3B9I A;  4CU7 A;  4OI1 A;  3I3D A;  5HV4 A;  1AUY A;  1Y9M A;  1VLN A;  4ARY A;  4CEY A;  5F5Q A;  4LO4 B;  1KRI A;  1H8T A;  1QDO A;  1YQ5 A;  1AL0 G;  4GD4 A;  1W28 A;  1LOG A;  1DCS A;  2XUE A;  2LM3 A;  4FPH A;  1GP6 A;  5LB6 A;  3USU A;  2F6B A;  4PF1 A;  3JXS A;  5DUV A;  5L36 A;  1RUJ 3;  1WZX A;  1W2T A;  4MXV A;  3UJO A;  2V4A A;  1QGL A;  5FXV A;  2D44 A;  2W08 A;  3VUO A;  1ZA4 A;  1VBB 2;  4GAZ A;  1HB1 A;  1ONA A;  3KF3 A;  4KWU A;  5DZF A;  3AP7 A;  5JAX A;  2WII B;  4HG6 B;  4O61 A;  5J3U A;  1R09 1;  3L2H A;  4TN7 A;  4CP9 A;  2D6K A;  4JTO A;  1J83 A;  4LO8 A;  3RI8 A;  3PVE A;  4I01 A;  5A3O A;  4NRP A;  2B7Y A;  1AR7 1;  5FYS A;  5I0U A;  3VBH C;  4CCJ A;  3ZFE B;  1NX9 A;  5ANQ A;  2VR4 A;  5A80 A;  4NAO A;  3RZJ A;  1UXZ A;  2Z2S B;  2ORX A;  2Y6J A;  4Y1Z A;  1BEV 2;  3WDV A;  2RDN A;  5FPA A;  5GZD A;  1T6G C;  1XNA A;  4DUX A;  1DZT A;  2YU2 A;  4N90 A;  1W8H A;  4AZZ A;  3A7Q A;  5T3N A;  3UKN A;  2RMU 3;  3EYP A;  4Y20 B;  3TRS B;  5CFD C;  2FQP A;  4NPR A;  3SH5 A;  3WVJ A;  3OYW A;  5GZE A;  1PM4 A;  5I93 A;  3K2O A;  5FZF A;  2BYV E;  4QXC A;  1LNS A;  3T0B A;  5C3S A;  1MQT B;  1MEC 2;  4A44 A;  2XG3 A;  4FPO B;  2LUW A;  4OHV A;  4NIH A;  4LBM A;  3ZYI B;  5E8A A;  5DAV A;  4WVW A;  4XMA A;  5J1X A;  2PHF A;  5FBZ A;  3PU8 A;  1YJL A;  1Z7S 2;  4XJ8 A;  1KQR A;  1YQ2 A;  3J7M A;  3VD9 A;  3RI9 A;  1S55 A;  1IPJ A;  3MIC A;  1IKP A;  2QQO A;  4LPL A;  3WNL A;  3D8C A;  3WOG A;  3VV1 A;  1HRI 2;  4RS5 C;  4AI1 A;  3VL8 A;  1S0G A;  1OOP B;  5JI7 A;  3KCY A;  4HBN A;  2Y6G A;  3SH4 A;  3VGI A;  3VKF C;  4KG0 A;  5H9S A;  2A7A A;  5ACA 1;  5DUX A;  2WZP P;  1I6X A;  2Y38 A;  3GXU A;  2AEZ A;  4LLO A;  1W04 A;  4JGZ B;  1NT0 A;  1R1A 3;  1QQP 2;  2TBV A;  3NST A;  3VDD C;  4LOS A;  2VOW A;  4YFW A;  4CCO A;  1V9U 1;  1AR7 3;  1R1Z A;  4AF9 A;  5BNQ A;  3RZG A;  3BB6 A;  3I2G A;  2VTX A;  2UYB A;  1T6B X;  4CDX B;  3KHB A;  3J9S A;  5KXD A;  1CAW B;  1CAU A;  3A0N A;  2LW8 A;  2X5I B;  3QAC A;  1ZZ8 A;  1NY7 2;  2PLV 2;  3X29 B;  3PJY A;  3FBY A;  3HEI A;  2JDM A;  3LD8 A;  2GDF A;  1RUG 1;  1AR9 3;  4AE2 A;  3CU7 A;  3OBA A;  1ENS A;  4BE3 A;  2ZHN A;  3AP4 A;  2UWA A;  4RR3 A;  3K77 A;  3ZM8 A;  4QKB A;  4YW7 A;  2WLP A;  4J25 A;  1XPW A;  1G86 A;  3V65 A;  1VAV A;  1O5U A;  2HWF 3;  2W3J A;  4Q4X 3;  3D0S A;  4A42 A;  4XQ4 A;  2OXB A;  1DFQ A;  1A8D A;  5FFO C;  4JTN A;  1BYH A;  2WR9 A;  4QM9 A;  1MS8 A;  5FO8 B;  3AMN A;  1FMD 1;  3M3Q A;  1CON A;  3N3H A;  4GKX A;  4MVT A;  4Z07 A;  5EJ3 A;  2W1U A;  1GWK A;  1BK0 A;  4M4R A;  5K9Y A;  4GIQ A;  4WV8 A;  1QXR A;  2XVK A;  2CHH A;  2OA2 A;  5FIX A;  5B4N A;  1RJ7 A;  5DDJ 3;  4E8D A;  1OF3 A;  1VBE 3;  3OUJ A;  1LOF A;  3ASI A;  1AR6 3;  4MGQ A;  1ASJ 3;  4LKF A;  3QH7 A;  1J3Q A;  2JG9 C;  3U10 A;  3CHX A;  3UJQ A;  1PGW 2;  2YY1 A;  3CJI C;  3ZN4 A;  4PLO A;  2D7F A;  3RS6 A;  1RUC 1;  3ELN A;  3W5M A;  3FLR A;  1EV1 1;  1UPI A;  3AKT A;  3MGU A;  4DUV A;  4UWD A;  4F3J A;  2GU9 A;  1GUI A;  1HN1 A;  2XJS A;  2B9V A;  2WWS A;  2HWE 2;  2A3W A;  4L99 A;  3E6B A;  1PK6 B;  2AEN A;  5LAS A;  1O91 A;  2R30 A;  3M8L A;  2VZ1 A;  2WNU C;  4CDW A;  5C4W B;  1UZV A;  3RWN A;  3P1I A;  3PHM A;  3C7F A;  5C8W A;  4XAC A;  1PIV 2;  1RUH 3;  2W87 A;  4Y5Z 0;  2N7G A;  4JAA A;  3H7Y A;  4XCB A;  5DG2 A;  4LA3 A;  5DZG A;  1JZ8 A;  4Y5T A;  1Z0H A;  2XHK A;  3MLL A;  4H7M A;  1GQH A;  4O65 A;  5FZ9 A;  1BBT 1;  1W6O B;  5A7W A;  2X29 A;  1OPO A;  2PYT A;  4GMP 1;  1H2M A;  1VB4 A;  2R04 2;  3N9P A;  3S0M A;  3I54 A;  2XGX A;  3HJR A;  3NKT A;  1OVS A;  4MHR A;  5A6X A;  1UY3 A;  5EIY B;  2D3P A;  4LUK A;  3R4U A;  1SHW B;  2JB8 A;  2EA7 A;  1IS6 A;  2WBK A;  2CV6 A;  5CZK A;  3O0W A;  4QPG A;  3ZDV A;  5FZG A;  3INA A;  1CIY A;  2LTN A;  3FHQ A;  4XCA A;  1GNZ A;  5HI0 A;  1OA4 A;  2ZTN A;  1TNR A;  4EJR A;  4LT5 A;  4D69 A;  4QX3 A;  4XJ9 A;  1V70 A;  1CZV A;  1KS5 A;  2W1S A;  3CNA A;  1MEC 1;  1XU1 A;  1C8N A;  3ZYR A;  2Y6H A;  5IVF A;  1WCK A;  3BIW E;  3JB8 A;  4IQP A;  4MET A;  2NYY A;  2VZT A;  4M3C A;  2P3I A;  2O1Q A;  1OSG A;  3K46 A;  1WMF A;  2VCA A;  4O9G A;  1S4C A;  2YYO A;  2JDA A;  4Q0V A;  5FZ1 A;  5FZK A;  1OHF A;  2VQT A;  3WNP A;  5IAT A;  4P9I A;  3SC7 X;  2J1V A;  1CVN A;  2FDF A;  4W50 A;  4W4Z A;  5FYI A;  2DCT A;  1JOB A;  3WF4 A;  4DZG A;  2R0F A;  1BMV 2;  3V56 A;  1BEV 1;  1DQ2 A;  3T2P A;  4QX1 A;  4FXG B;  5L7O A;  4RHV 1;  1UO9 A;  1QMJ A;  1QNW A;  3N9Q A;  2HKX A;  1ND2 A;  2DUO A;  3BAL A;  1OC1 A;  2PEL A;  3OGJ A;  1NXD 1;  4NRQ A;  5JZG A;  1X50 A;  2YFZ A;  2GMM A;  2NMN A;  2RR1 2;  2BOI A;  1FPN 3;  2G9F A;  4QPW A;  2Z42 A;  1ZBA 2;  4OYU A;  1AYN 1;  3RNS A;  2B39 A;  3JD7 2;  1E5S A;  1WLC A;  3S30 A;  5CIR A;  3O1R A;  2Y0I A;  3CMG A;  3B9C A;  2LRP A;  3KCX A;  4CE8 A;  4QXK A;  1RHI 3;  1XXN A;  3D82 A;  1RUC 2;  2XH6 A;  3KV4 A;  3PUR A;  5AC9 3;  5FZ0 A;  3AL6 A;  5FLH A;  1RUN A;  4NID A;  3OUI A;  4QB6 A;  3Q8B A;  3IAP A;  4N8M A;  3T0D A;  2VUC A;  4S2G A;  3T1L A;  4EWE A;  4HPK B;  4N9H A;  4XXA A;  2VMF A;  4OUM A;  3PTR B;  3NW4 A;  4D7S A;  2KXL A;  2WS9 2;  3WQB A;  3O1T A;  1FMD 2;  3KMH A;  3HD8 B;  4G4F A;  3HNM A;  5LW9 A;  4Q4V 1;  2P2K A;  1OD3 A;  3WUC A;  2W92 A;  3FHI B;  2XHN A;  3AZZ A;  3CEW A;  1BLZ A;  1MQT A;  2W95 A;  2P1B A;  2C5D A;  3E6D A;  4XF4 A;  5AFB A;  3BTA A;  4CUC A;  4OQ8 A;  5FYT A;  1X33 A;  1CX1 A;  4PJY A;  3TN9 1;  4KU8 A;  1IS5 A;  4BQ5 A;  4DMI A;  1PZ9 A;  4QX5 A;  2BNM A;  1HLC A;  4R4Z A;  5FZH A;  2JEM A;  4BPZ A;  2IFR A;  2VJX A;  4HT1 T;  1AX2 A;  2OII A;  2AC1 A;  5FWE A;  5A3L A;  5BUV A;  1XYP A;  1YRZ A;  2EXH A;  4CUG A;  1OUR A;  5FMO L;  4AGR A;  3RVH A;  2VMG A;  5A70 A;  2WNU A;  1DF0 A;  2ZJC A;  4CDW C;  1F8V A;  5F6L B;  1TZO A;  1UN1 A;  1UYZ A;  3T2T A;  3POG A;  1ZBA 3;  2ZGM A;  4Z2A A;  3WX5 A;  1WCS A;  1VE0 A;  4P02 B;  4MGK E;  5LBE A;  2VMI A;  2XKO A;  3IKW A;  2E7A A;  2JX9 A;  4ES9 A;  2XUM A;  1QNY A;  1UU6 A;  3NRU A;  1D4M 1;  3W59 A;  4R9C A;  2TNF A;  3AYE A;  2ZX1 A;  1DQ5 A;  2ZS6 B;  4KGG A;  4P9X A;  2D6P A;  2X10 A;  3SCF A;  1GZW B;  3LZZ A;  1DP0 A;  4NPL A;  2ID4 A;  1GP5 A;  1W8T A;  1UMZ A;  2QQV A;  3CL1 A;  4CCL A;  5K8S A;  4D6S A;  4JVA A;  1RXG A;  1LOE A;  2IXJ A;  4IDZ A;  4PCR A;  1SLL A;  1EP0 A;  1O7F A;  1TQ5 A;  3PJQ A;  4AQ6 A;  1G8W A;  4ISR A;  3AYA A;  1ST8 A;  4X8N A;  4EQV A;  4P9G A;  4RYD A;  4BLJ A;  1NLQ A;  4CP2 A;  3BYW A;  1FI2 A;  2WA4 A;  1W6Q A;  2OZ6 A;  1YHF A;  3AKR A;  3NAP B;  3ZFF B;  4LBK A;  1EY2 A;  4YW3 A;  1MS1 A;  4YZ5 A;  1K5M A;  1NZI A;  3AJZ A;  1HV1 A;  5D21 A;  1YFY A;  2G9Z A;  1CJP A;  1UCX A;  4Y20 A;  1C28 A;  1UZ0 A;  4GUL A;  4CCK A;  5C3Q A;  4E4H A;  5JOX A;  3J4U H;  4FPL A;  4C1X A;  2D6N A;  3VHN A;  3AZW A;  1GU3 A;  3I2J A;  4UF0 A;  3NV2 A;  5FOB B;  2WN2 A;  4NWV A;  4AVV A;  1FX5 A;  4L92 A;  5IYY A;  3ZSL A;  4IES A;  5HBA A;  2DCJ A;  4KWK A;  5J36 A;  2J7M A;  2WQ4 A;  4A6S A;  3ACH A;  2GN3 A;  3ILN A;  4S2H A;  2VY0 A;  5BXX A;  5IK5 A;  4MG2 A;  1P8J A;  3T4V A;  1TME 3;  5A3W A;  1IHM A;  2DCK A;  3I2I A;  4HL0 A;  5IVC A;  4Y1U A;  1WUV A;  2O8Q A;  3ON7 A;  2MEV 3;  3NAP C;  3ZFF C;  4QGL A;  5LA0 A;  2BNO A;  2XON A;  4QWN A;  3EMR A;  2Y8K A;  4JX0 A;  4ZU7 A;  3CJI B;  2FD8 A;  5L9V A;  2VVE A;  1QJY 1;  3KCC A;  1JOJ A;  4RSU A;  1R1A 2;  1DZR A;  4H14 A;  2Q8D A;  3ZSJ A;  2WNO A;  4GWJ A;  4XFG A;  5FPZ A;  1W8Z A;  3E6C C;  5AVA A;  3ZFG C;  3A23 A;  1SFY A;  5FUN A;  5IVE A;  2BER A;  4Z2W A;  4IE6 A;  3OD4 A;  5EYY A;  3BOD A;  5JSR A;  3NNG A;  5BNO B;  5JPM B;  4R9B A;  3CJI A;  5IVJ A;  3S5A A;  1COV 1;  1SCR A;  1GKB A;  2DF7 A;  2FMY A;  4IEO A;  5JCT A;  1H2N A;  5JOZ A;  3O14 A;  3HN3 A;  4OMC A;  3I3B A;  5D2A A;  4BB3 A;  3K4D A;  1HV0 A;  1UX7 A;  2CAU A;  1UU4 A;  3HQU A;  1VMJ A;  2J1A A;  1D4M 2;  1K5J A;  1N3Q A;  3WG2 A;  4IEW A;  4PIY A;  3DL3 A;  1HRV 3;  4FP3 A;  4QKF A;  1LTE A;  3B93 A;  4L97 A;  1MEC 3;  2GC1 A;  2XJR A;  4BHP A;  3RZZ A;  4QX2 A;  1JN2 P;  4KBB A;  3JD7 1;  1VB2 A;  4XFF A;  1KFX L;  3WIN E;  2O14 A;  5IW0 A;  5E1R A;  4ITC A;  3SKJ E;  2DWR A;  1LHV A;  4GXL A;  3MFA A;  4XHB A;  1BEV 3;  1R09 3;  1I3H A;  4YVS C;  2WWJ A;  1VMH A;  5B2G B;  3ZSM A;  4EZ4 A;  3ZXL A;  1FPN 2;  4WVZ A;  3WXP A;  5A6Q A;  4EV0 A;  4LO6 B;  3NAP A;  3ZFF A;  4JGY A;  5FLI A;  3TBD A;  3EB7 A;  1RUE 1;  4DY5 A;  2CL2 A;  2C6S A;  5C9A C;  3PUQ A;  3VDB A;  4LOT A;  1OOP C;  5FYC A;  4ZU5 A;  1F35 A;  2E7Q A;  4ES8 A;  2VVD A;  2VUA A;  2QUO A;  3BU0 A;  1OMI A;  3N36 A;  2VCB A;  1NCQ C;  4EN6 B;  1YI9 A;  3B00 A;  4AGV A;  1VBC 2;  2Y0O A;  4QT6 A;  3KT4 A;  1S2E A;  4LEJ A;  5F3E A;  2ZHL A;  5K7P A;  3NNL A;  1OLR A;  3RG0 A;  3T4H B;  3U4X A;  2ET1 A;  1FAT A;  4YAR A;  1IS3 A;  3C8X A;  1SG3 A;  2K0G A;  4QQ2 A;  4LHS A;  4QPI B;  2OX0 A;  1R08 1;  2XOM A;  3MLK A;  3HT1 A;  1W6P A;  2WYF A;  1UZY A;  3P6B A;  4A7Z A;  5CA6 A;  4P5Y A;  1SMV A;  1ULE A;  1W06 A;  1S0C A;  3HBZ A;  3VBO C;  2QBX A;  2E31 A;  1QQP 3;  3J26 N;  2QQK A;  2GNT A;  3C2U A;  3PNA A;  3IIA A;  5FP3 A;  3LSE A;  4MGI E;  5FRA A;  2RMU 1;  1YFW A;  4LE3 A;  4QKN A;  2HLE A;  1W6N A;  2ZX2 A;  3LA2 A;  1D0G A;  3ES4 A;  1YCI A;  3FC0 A;  2WO1 A;  1JZ5 A;  5GZG A;  1BMV 1;  1SDW A;  1GZ9 A;  2ZGT A;  4JC1 A;  1UZW A;  4NMI A;  4UYB A;  3WG1 A;  1H6Y A;  3WNX A;  1LUL A;  2BVB A;  4RHV 2;  4XYX A;  5F2W A;  1CES A;  1GNY A;  2RDS A;  5LK5 A;  4H55 A;  3I59 A;  1JHJ A;  2EF6 A;  1A34 A;  1ZRF A;  2CAV A;  4BWO A;  1OFS A;  4JGZ C;  3LA7 A;  1D2S A;  2IUW A;  4Q0U A;  3VKM A;  1B35 B;  1POV 3;  5E16 A;  1S0I A;  1NE4 A;  2B42 B;  1WD3 A;  3O5S A;  4WZF A;  4E2S A;  5BNN B;  2IXC A;  3KT7 A;  3IDC B;  5FZ7 A;  2R1D A;  4HPK A;  3SQO A;  3RZL A;  2FDG A;  2VVF A;  2NM1 A;  3RJR A;  2BBV A;  5FPV A;  2PHU A;  2HWF 1;  4Q4X 1;  1PZ8 A;  1PNF A;  1KFU L;  4XUQ A;  4FOY A;  4PQQ A;  2WAO A;  4CUB A;  3RZM A;  1BQP A;  5EWS A;  2VZ3 A;  4XXP A;  4B1L A;  1N1Y A;  4MX3 A;  1H1M A;  2WA3 A;  2VQU A;  4CEY C;  2ZML A;  1MQT C;  4DPN A;  2MNG A;  3EXU A;  3VBF C;  2XR4 A;  1TVG A;  4P00 B;  1NLR A;  1W9W A;  2P37 A;  4OHW A;  4XJU A;  1C1L A;  3WQ7 A;  1AVB A;  1C8M 1;  1F4A A;  2A6V A;  2WYS A;  3HVD A;  3MIF A;  4XUT A;  3VHO A;  3VZO A;  2PA7 A;  1RB8 G;  2RJL A;  2G1M A;  1MAC A;  1N47 A;  1RUG 3;  1APN A;  3TNP B;  2ZKN A;  2JD4 A;  2XJP A;  3OTF A;  4AVT A;  3FE5 A;  3ZIX A;  5F32 A;  3W5N A;  1PGL 1;  1W0P A;  4TSV A;  1Q8V A;  1DG6 A;  1SCS A;  2JG9 A;  1C57 A;  3Q8F A;  5C4W C;  1ZZ9 A;  5CKN A;  2ADD A;  3BTY A;  1UKG A;  3GJB A;  3R0R A;  2MPF A;  2PFW A;  4HN0 A;  4HZF A;  2XXZ A;  5JI9 A;  4LBJ A;  5GLZ A;  1C8M 3;  2VU9 A;  2RS3 3;  4CCD A;  3ZXE A;  4MAD A;  1ZRD A;  3CF6 E;  4Q0S A;  2ZAH A;  2YC2 A;  4QDS A;  4RFR B;  4M3C B;  2JB4 A;  5IFT A;  2FDH A;  3IWZ A;  3ZVX A;  4LHK A;  4A7K A;  1UOB A;  1S0B A;  2V73 A;  3MEP A;  3O12 A;  3WF0 A;  3A4U A;  4LBL A;  5FZL A;  4BU2 A;  5I91 A;  5LK7 B;  4CU9 A;  3AVR A;  4JQT A;  1HB2 A;  1ZBE 2;  1NCR B;  2BZD A;  5FV3 A;  4CU6 A;  1Y4W A;  3S7I A;  4D94 A;  1BHG A;  4COU A;  2AAC A;  4MUV A;  2VOX A;  4AQ2 A;  4WM7 B;  1C3H A;  4GB3 1;  3RYR A;  3ZLI A;  3PIJ A;  3GYD A;  4DRV A;  1WBF A;  3GBW A;  1VRH 2;  2P34 A;  1JOP A;  2HH9 A;  1CWP A;  1WGP A;  5AC9 2;  1G9C A;  1O4T A;  2R1B A;  2JWP A;  4RR3 B;  4XF0 A;  1GWM A;  1JYI A;  3IDB B;  1ALY A;  3JU9 A;  4PT6 A;  2J22 A;  4D0Q A;  3FL7 A;  1UNB A;  2DFC A;  3LEI A;  3C7H A;  4ZPI A;  1UPS A;  3U1X A;  1QQP 1;  2LS6 A;  2QQM A;  1WLT A;  5LBC A;  4CDX C;  1OD5 A;  2XL9 A;  2ZX0 A;  3POS A;  5E6H A;  4COY A;  3WY6 A;  2O8O A;  4BQ2 A;  3M3E A;  1SAC A;  4PF5 A;  4YSF A;  2AR6 A;  3MZH A;  1RUF 3;  2DTW A;  4UW6 A;  2VG9 A;  3MID A;  1GIC A;  3N9O A;  1H8V A;  1ZNP A;  5ABJ A;  1L3J A;  1W6N B;  4QDR A;  5IJR A;  1RUD 3;  2ZHM A;  3WR0 A;  2GAL A;  5C70 A;  4GAL A;  4R4X A;  4YNI A;  3L9J T;  2C24 A;  1H8T C;  3POJ A;  4Q8K A;  1MZE A;  5GLT A;  3GM8 A;  5EJ1 B;  1PO2 2;  4DO0 A;  1AXK A;  5KC6 A;  2ZEY A;  2P3J A;  4I0W B;  1FNZ A;  1X8E A;  1UYP A;  4NAM A;  1UWW A;  2XJT A;  4FFH A;  4FQZ A;  4YW5 A;  1W6P B;  1I5Z A;  4UI9 L;  5FXX A;  4OVE A;  4F8A A;  5L9B A;  3NV4 A;  4NJ4 A;  3GBG A;  3E5U A;  3ZXG A;  5F9T A;  3S6P A;  1HQN A;  4WVM A;  1WA4 A;  1R64 A;  3LIH A;  5JWP A;  2JE7 A;  3H8X A;  1QH7 A;  2BQP A;  3ACF A;  1UY4 A;  4WM8 C;  3RYP A;  4AED C;  2ZX3 A;  1RVF 2;  3NV1 A;  3VBR A;  3B5L B;  2PQQ A;  3I3E A;  3VBS A;  1B35 C;  4AYU A;  3LQC A;  2JDZ A;  3UKT A;  1JYN A;  4ZZ8 A;  2IC1 A;  3ZN6 A;  1FYU A;  1SBD A;  2BUK A;  1OF4 A;  1POV 0;  2A6Z A;  5JPN B;  4Z82 A;  1DGW X;  2MEV 2;  2FCV A;  4RQP B;  1HIX A;  3GHM A;  1LHO A;  3B69 A;  4ISQ A;  4LIU A;  3O1U A;  2HWD 3;  3NO8 A;  3ZYJ B;  4Y4Y A;  3DPR B;  1QJX 2;  3K4Z A;  3TEY A;  1NA1 A;  1WW7 A;  2R0H A;  2PHT A;  2WAB A;  4QPG B;  2BBA A;  1N3P A;  3J7H A;  5IFP A;  1VMF A;  4BDV B;  4IE4 A;  3WCR A;  1NOV A;  1HKD A;  5F2S A;  2RR1 3;  3LOI A;  4E2G A;  3UYJ A;  1DQ0 A;  1G7Y A;  2XVL A;  1C5H A;  4HKL A;  5ACA 3;  2CU5 A;  2A75 A;  2RS3 1;  1D7P M;  2WQZ C;  4LBQ B;  4YGE A;  2XWB B;  4QPG C;  5FWJ A;  4YGD A;  1LEC A;  1W6O A;  3D5O A;  5G04 L;  5A7W B;  3S7E A;  4A4A A;  5I0R A;  4ERO A;  4E2Q A;  2BFU L;  5F5I A;  2ENR A;  3NJY A;  1RHI 2;  2EIC A;  2ARE A;  3PVO A;  1TNF A;  2E32 A;  3T1M A;  4RQP C;  1RGS A;  1V6L A;  1S0E A;  5D8A C;  5FUP A;  1CX4 A;  1N3O A;  2GMP A;  4AK3 A;  4ASL A;  1PM7 A;  4MOA A;  2VNG A;  4Q4W 2;  5FZE A;  3A0K A;  3VKN A;  4EE2 A;  2P17 A;  3N9M A;  3RRD A;  5JR2 A;  4FVV A;  4A2U A;  2VUJ A;  4MHU A;  3MYX A;  2NLR A;  2YPD A;  1ZBE 3;  4V2W A;  3V0B B;  4IV1 B;  4V1P A;  3T3Y A;  3QLQ A;  5JXH A;  2OPW A;  5BPX A;  3I2D A;  3LDK A;  4XJW A;  4HKW A;  5DN2 A;  1ULD A;  4YG6 A;  3JB4 C;  3VBS C;  1IS4 A;  4QX7 A;  1T2X A;  5CFC A;  3T2O A;  2UYA A;  4K3U A;  5FZC A;  3LB9 A;  1JTZ X;  5EZW A;  4XTP A;  1HB3 A;  3E97 A;  3SEE A;  2CGN A;  3OD0 A;  2H6B A;  4LK7 A;  4FAH A;  1FNY A;  1U5Z A;  4R52 A;  3BUC A;  5AFE A;  4IUG A;  4WVV A;  5FY7 A;  1XOY A;  3K3O A;  1HX6 A;  5FK7 A;  4YZ2 A;  1SFN A;  3LAG A;  1RED A;  3LCP A;  2OZJ A;  1S0D A;  4L0P A;  4NOT A;  4CP9 B;  2EXK A;  1POQ A;  4Q4V 2;  4XHX A;  5FCC A;  1AR6 1;  4IGP A;  4RFT 0;  1NAE A;  1DBN A;  2ZCW A;  3NJV A;  4IV3 C;  4GMP 0;  4O7X A;  1F5J A;  4I0B A;  4ASM B;  1W9T A;  4P9L A;  4BQ4 A;  1XSR A;  1G6N A;  1PIV 3;  2W0X A;  3HN1 A;  4QQL A;  4CCE A;  3DGT A;  4LJH A;  4JKM A;  2J42 A;  4O9E A;  4YVW B;  2Y26 A;  4PQ9 A;  4MYE A;  1RUD 2;  5HXM A;  3TB0 A;  4BQY A;  1QXP A;  5FY1 A;  2D5H A;  4DEQ A;  1JOD A;  1IKQ A;  1JW6 A;  4UF0 B;  4E27 A;  1GNH A;  4ZXE A;  2RS1 2;  4CEY B;  3HWJ A;  4HK9 A;  5I8T A;  2QDR A;  2HJI A;  3BI3 A;  3FJS A;  5BNP C;  5LY1 A;  2VM9 A;  3OGG A;  1NE6 A;  1CD3 G;  5A3P A;  4FFI A;  5CIS A;  4QB1 A;  4RR3 C;  4IEZ A;  5FQ0 B;  1K5M B;  3J8F 2;  3M7A A;  4FO9 A;  5C3O A;  2W52 A;  2VTF A;  4X6Q B;  3WT3 A;  1W9F A;  1QJX 1;  2ZGK A;  1AYM 2;  4YGC A;  3CIH A;  5J7M A;  3AX4 A;  4YWA A;  5GLW A;  2AGS A;  5GKA C;  4B7E A;  4BIO A;  5LRR A;  1IG3 A;  4C90 A;  5CKM A;  5BNP B;  5DPN A;  2BGC A;  1A8M A;  4XBL A;  3K4A A;  4ONU A;  2K46 A;  5FKB A;  1PVC 3;  2HEW F;  4CDU B;  3D0J A;  1DYK A;  1VBA 1;  3OSD A;  2L9L A;  1EAH 1;  1W3V A;  5FKC A;  1V9U 2;  5FR3 A;  4XJZ A;  5ISL A;  4MGT A;  3ST7 A;  4CP1 A;  2A1X A;  2UWB A;  4Q27 A;  5T55 A;  1AX1 A;  4LBO A;  4P9J A;  1O59 A;  1OVP A;  2B45 X;  4JGY B;  4XUR A;  4JDO A;  3ZKU A;  1JYV A;  2RM2 1;  3THD A;  2PLV 3;  2QFE A;  4LUL A;  1D2Q A;  5L7O C;  1VRB A;  4NUB A;  3VKL A;  4DNY A;  4I0A A;  1RUI 3;  1W8W A;  3N7J A;  3V64 A;  3VZN A;  4URT A;  2ZA9 A;  1PVX A;  4XAB A;  1JH5 A;  3GZE A;  2ZMN A;  4QB2 A;  4IXL A;  5JOY A;  2BWC A;  4C0H A;  3ZFE A;  1UXX X;  2RE9 A;  3O0X A;  4GB3 3;  4L2N A;  4AI9 A;  1RUE 3;  2OW4 A;  1QJX 3;  4B3N A;  1H9W A;  2J1R A;  3UV9 A;  1LGB A;  2PAK A;  2UY9 A;  5DDJ 2;  3MW3 A;  3AK0 A;  3KT1 A;  2ZGQ A;  5KBF A;  2XLG A;  1CR7 A;  2WC2 A;  1XNK A;  3CKH A;  4HK8 A;  2HYK A;  1VAK A;  4IEX A;  4RN5 A;  4CCC A;  2WN3 A;  1SPP B;  4OHX A;  1SDD B;  3FHA A;  1RXF A;  4AAP A;  4JKL A;  3VDA A;  4YPJ A;  3N9L A;  2B46 X;  2FZ1 A;  3HPN A;  2KR2 A;  4X6R B;  4RL7 A;  4CDQ A;  2RV9 A;  1RVF 3;  5JXG A;  2VQ0 A;  3AKQ A;  3AVS A;  2G4I A;  2DBN A;  2UY8 A;  3H3Z A;  4LR4 A;  1ENR A;  4U2A A;  3WZ1 A;  1ND2 B;  1Q5O A;  3D4K A;  1JZ6 A;  2OQ6 A;  1F31 A;  2YPJ A;  3NKG A;  5FYY A;  5KHJ A;  3CJX A;  3J7L A;  2AYH A;  2WAA A;  4ZS3 A;  5DAX A;  1JHN A;  1JXN A;  2WNE A;  1FOD 2;  4I09 A;  1ZZ6 A;  3OPZ A;  2ADE A;  4BZ4 A;  1QU0 A;  4PI2 A;  1Z7S 3;  1AJO A;  3ALQ A;  1MS3 A;  4UFH A;  3TNQ A;  1PGS A;  1RUH 2;  2UWC A;  3OPW A;  3WF1 A;  1HJF A;  2HBT A;  5CEH A;  5JXI A;  3PUI A;  4I3G A;  4QX8 A;  2EXI A;  2LAL A;  1C4R A;  4AVA A;  1H2L A;  1R08 2;  3RQ0 A;  4K1Z A;  1R08 3;  1REF A;  2VH9 A;  5IHR A;  1K45 A;  4EN8 B;  1QXJ A;  5F37 A;  3VDD B;  2HEV F;  1UY1 A;  1RL3 A;  1E5H A;  3LDB A;  3JQX A;  2P6H A;  4GH4 B;  4LA2 A;  3RFR A;  3THP A;  1O6U A;  4YM3 A;  1CN1 A;  4LK6 A;  5HCA A;  4EYU A;  2CNA A;  2HWC 2;  1RYY A;  4TXW A;  4UOJ A;  1WW5 A;  1WW6 A;  4IGQ A;  1ND3 B;  2QNK A;  1MR5 A;  2WNV C;  4FPF A;  4LOR A;  1H6X A;  1PVC 2;  4HOO A;  4YG3 A;  2Z4F A;  2BOJ A;  2XJU A;  3H8U A;  1VBA 2;  3IMM A;  1UF2 C;  4NHK A;  4XC9 A;  4J1W A;  4OUS A;  4P9W A;  1A6C A;  1Z78 A;  1ZBA 1;  5DUU A;  4H2A A;  1N1S A;  1ZA7 A;  4LO5 B;  4GZ9 A;  5FZ8 A;  2EIE A;  3N7L A;  2YV8 A;  1D4M 3;  5FY0 A;  4QKD A;  3KVA A;  1E5I A;  1WME A;  2Y33 A;  3J7N A;  1NCQ B;  1POV 1;  2PXJ A;  2OQ7 A;  3WCS A;  3W20 A;  1KDM A;  2RMU 2;  1GOF A;  1JYC A;  3IN9 A;  4A7Y A;  3AXE A;  2VNO A;  3O1P A;  2W5F A;  1RTV A;  2RS5 1;  1RUJ 2;  3OGR A;  2K9Z A;  5L7O B;  1XBF A;  3AP5 A;  2BWA A;  2P6C A;  1OPM A;  3AL5 A;  5FMB A;  4PLM A;  1W6M A;  1AL2 3;  4QHZ A;  3WDW A;  3PVN A;  5HCB A;  4BLI A;  4GH4 C;  2VMC A;  2DYC A;  5FP9 A;  2KM2 A;  4QXH A;  3POI A;  3OY8 A;  2RS1 1;  2WS9 1;  4IEQ A;  4BIF A;  4AQT A;  5LA9 A;  5CVR A;  3KV5 A;  4M3C E;  4AHZ A;  4CZS A;  2WT0 A;  3WW1 A;  4HVQ A;  3PUA A;  1S0J A;  4CCN A;  4M3C F;  3AFK A;  1F15 A;  1ZYB A;  3DUI A;  3VBO A;  4CDU C;  1SEF A;  2VGD A;  4XPV A;  3I3M A;  5H9R A;  5EYX A;  5GLU A;  4Y1Y A;  4CTE A;  1XJA A;  1WA6 X;  2FHR A;  3JBG 2;  1RUE 2;  4CXY A;  4UFK A;  5LRS A;  4FI9 A;  2RS1 3;  4IET A;  4ATF A;  4IE5 A;  4COZ A;  1OA2 A;  1ND2 C;  1V9U 3;  1O3S A;  5JLV A;  4BJ0 A;  2W91 A;  1ZZC A;  1K5M C;  1X7N A;  4GMP 3;  1ODM A;  4XQW A;  3WG4 A;  3VDC A;  3PVB B;  3K3N A;  2QJV A;  1JYX A;  2W1Q A;  1DGW A;  4JQR A;  4MH0 E;  4WZC A;  4Z92 B;  1QEX A;  1XQN A;  1AR9 1;  2VZR A;  5I0T A;  3AYD A;  2P3K A;  5CFD B;  1IPK A;  3R6S A;  2YGM A;  5A33 B;  3JD7 3;  2JXA A;  2CTV A;  5D8A A;  4TZD A;  3H0O A;  2E6V A;  4LBN A;  5C4W A;  1B35 A;  5FJH A;  5CU1 A;  2ETE A;  3FLP A;  4N53 A;  5BNO A;  5IK4 A;  2VBB A;  4OI4 A;  1X9T A;  2DVD A;  4TWT A;  5C5T A;  4ZHN A;  5IVV A;  4NPM A;  4IV3 B;  2FCT A;  1IZ3 A;  1EV1 2;  2RG4 A;  4DIN B;  1JZ7 A;  3I8T A;  3AMH A;  2MHF A;  2YG0 A;  4N43 B;  3KLS A;  5KXE A;  1RHI 1;  5LBF A;  3VKO A;  1GZT A;  1X36 A;  4LLF A;  4R9D A;  4N53 B;  1H4G A;  1ODN A;  4NHX A;  4N53 C;  5FO7 B;  1JI6 A;  3ROU A;  4K6B A;  3SCG A;  3ZDS A;  3W9A A;  2NQY A;  5BNO C;  1G9A A;  1LHW A;  2Q1F A;  4Q0P A;  3RZK A;  3ZR6 A;  1BVV A;  4QQH A;  4C1W A;  4FFG A;  2X5I A;  4B4R A;  4LE4 A;  5FP8 A;  3THT A;  1I9R A;  1H30 A;  5JZG B;  1OBN A;  4FXK B;  3MUY 1;  4M00 A;  4ZU4 A;  4IW3 A;  2I07 B;  3DKQ A;  3HQX A;  3LPG A;  2NPI A;  5GZC A;  3WW3 A;  1OQ1 A;  2OUH A;  2YBK A;  5DG1 A;  1PO1 3;  3MW2 A;  4QAW A;  4Q1P A;  1YQ8 A;  3BCW A;  1AHS A;  3HIF A;  3QD6 A;  5AVP A;  3WDT A;  4BQX A;  3GF6 A;  2BV4 A;  2JDP A;  4K7J A;  2OYZ A;  3ILR A;  5A1L A;  4MGZ E;  1W6M B;  1NG0 A;  4WM7 A;  5E89 A;  1VAL A;  1Y9G A;  1RMU 3;  4FPY A;  2C9A A;  3H1M A;  3UKV A;  3UT0 A;  5F3I A;  3WW4 A;  1LGN A;  2EIG A;  5LEK A;  1FV3 A;  2ZAA A;  1DYO A;  1HN0 A;  3K75 B;  1IQA A;  4XIK A;  1VIW B;  2ZGU A;  1NCQ A;  4FFF A;  1W2N A;  4YW1 A;  3SIS A;  1CAW A;  2J1U A;  1GMM A;  1YC6 1;  3GZA A;  4UFM A;  3HQR A;  1EPW A;  2EAA A;  5A6Y A;  3FUQ A;  3UK9 A;  3GJA A;  5CBL A;  1NY7 1;  2PLV 1;  2EAK A;  2GH2 A;  2G19 A;  4GB3 2;  2HWB 3;  4XUP A;  3ZSE A;  4AL9 A;  5CYY A;  1FXZ A;  2QQW A;  3WP5 A;  1RMU 2;  2X09 A;  3WDU A;  1REE A;  1ND3 A;  1H1A A;  1J58 A;  2X53 S;  3AMQ A;  3RMY A;  5HV0 A;  4JDM A;  2VXJ A;  4BMB A;  3BPZ A;  1EUT A;  2ARB A;  2PN5 A;  4XW3 A;  4YVW C;  5FZA A;  5JOW A;  1D0H A;  4WBB A;  1RUF 2;  1SFP A;  3ZXK A;  1VBB 1;  1PO2 1;  4XIO A;  3VD5 A;  1LHN A;  2CWM A;  3EO6 A;  2JIC A;  5ERL A;  5ACA 2;  5FDB A;  3CDZ B;  3VBO B;  1NZC A;  2PAE A;  5FTT C;  3BVC A;  1IPS A;  2WSV A;  4QQO A;  1LRH A;  4HET A;  1KXG A;  1ASJ 1;  4QHO A;  2VZP A;  2QE3 A;  4WM8 B;  2PHW A;  4AAX A;  2HWD 2;  3HMY A;  4XVH A;  3WLU A;  1UOJ A;  5H9P A;  5FQ0 A;  1VPH A;  5ANN A;  4Y1V A;  3WNO A;  4COW A;  3H1W A;  5T5P A;  2X05 A;  4I3P A;  1YQ6 A;  3M2M A;  3VBU C;  2Q30 A;  4TYS A;  3HNB M;  1UIK A;  3FBM A;  4AFD A;  2PHD A;  2KA3 A;  1EAH 2;  1H8T B;  4CYD A;  4Z8B A;  2JD9 A;  2OKX A;  4AHW A;  4FAG A;  1PMI A;  1YI7 A;  5A32 A;  3ZXF A; 
#chains in the Genus database with same CATH homology
 3OBA A;  2LS6 A;  1JU3 A;  2QQM A;  4DXT A;  3K77 A;  1ULP A;  3ZM8 A;  1PX3 A;  1XPW A;  3OEA A;  2W3J A;  2Y6K A;  1PMJ X;  4A42 A;  1O8P A;  2QQI A;  2VZO A;  1DLC A;  3CZJ A;  2W1U A;  3A21 A;  4M4R A;  4CUA A;  4QDR A;  3LEG A;  3C7O A;  5IJR A;  5B4N A;  4BK4 A;  4E8D A;  5C70 A;  1OF3 A;  3OGV A;  3MO4 A;  1K12 A;  3GM8 A;  4MGQ A;  5EJ1 B;  5LCW L;  2ZEY A;  1UWW A;  4P08 A;  4UI9 L;  3W5M A;  1UY2 A;  4DUV A;  3WNM A;  1R64 A;  1GUI A;  1HN1 A;  2KD7 A;  2B9V A;  3ACF A;  1UY4 A;  2WUH A;  5JMO A;  1KGY A;  2VZ1 A;  3I3E A;  3LQC A;  1JYN A;  4ZZ8 A;  3P1I A;  3LEK A;  5EJZ B;  3SEP A;  4CU8 A;  3C7F A;  1UYX A;  1OF4 A;  4XUN A;  3VD3 A;  2W87 A;  4OMD A;  3DYO A;  2BGO A;  1JZ8 A;  2J1S A;  3K4Z A;  2J1E A;  2WAB A;  5F7U A;  2BBA A;  3J7H A;  5IFP A;  3HJR A;  5EIY B;  4BDV B;  1UY3 A;  2ZXQ A;  1SHW B;  2WBK A;  1OT5 A;  3T09 A;  3NQH A;  5CZK A;  1D7P M;  4KI5 M;  3I2F A;  2RVA A;  3NJX A;  1CIY A;  3BN6 A;  3FHQ A;  5G04 L;  4A4A A;  2V5D A;  4DEV A;  2WO2 A;  4QX3 A;  2EIC A;  1CZV A;  2W1S A;  2E32 A;  3IB3 A;  2Y6H A;  1US2 A;  2VZT A;  4MOA A;  5JR2 A;  3I2H A;  3K46 A;  2VCA A;  2JDA A;  3WNP A;  2W1W A;  2VQT A;  2VC9 A;  2J1V A;  4W50 A;  4W4Z A;  5JXH A;  3WF4 A;  2VOT A;  5DN2 A;  3T2P A;  3SKV A;  4QX1 A;  4DUW A;  4JKK A;  3IDA A;  1T2X A;  2CDO A;  2J1T A;  4XUO A;  1L7Q A;  1W9S A;  2C4X A;  3T2O A;  4QX0 A;  1L7R A;  2QQJ A;  3SEE A;  1XNT A;  2Y64 A;  2YFZ A;  4IUG A;  4QPW A;  4OYU A;  3WNK A;  4L0P A;  3UES A;  1I5P A;  1NAE A;  3CMG A;  3NJV A;  2R7E B;  1W9T A;  1XC6 A;  5LA2 A;  2XQX A;  4JKM A;  2WZ8 A;  2HYX A;  3MV1 1;  4QB6 A;  5HXM A;  2EID A;  3WF3 A;  4DEQ A;  4A45 A;  1GOH A;  3IAP A;  3T0D A;  3AC0 A;  1OH4 A;  4ZXE A;  3MUZ 1;  2EIB A;  3WF2 A;  4BXS V;  4QDQ A;  1JU4 A;  3C7G A;  2VMF A;  2VM9 A;  4E8C A;  3WQB A;  5I0D A;  4QB1 A;  4TTG A;  3HNM A;  1TG7 A;  3ACI A;  1OD3 A;  2W92 A;  2XHN A;  2W95 A;  2VTF A;  2W94 A;  4CUC A;  1WCQ A;  1CX1 A;  3CIH A;  2VJX A;  1UMI A;  3FN9 A;  1K42 A;  5DPN A;  3K4A A;  2RJ2 A;  2L9L A;  1EUU A;  4GWI A;  5C7G A;  4LKS A;  3HOB A;  3DYP A;  1J84 A;  1UYZ A;  2Y6L A;  4OZO A;  2WQ8 A;  3T2Q A;  4BK5 A;  4Z2A A;  4P02 B;  1O59 A;  4XUR A;  5LA1 A;  1JYV A;  3THD A;  3NRU A;  3VD4 A;  3OG2 A;  2VZQ A;  3A22 A;  2X10 A;  3E1F 1;  1DP0 A;  5JXJ A;  1JZ4 A;  5C71 A;  2ID4 A;  2PQS A;  4QB2 A;  5G05 L;  3WSO A;  2JE8 A;  1GOG A;  2W47 A;  1UXX X;  3MBW A;  1JZ2 A;  2W9X A;  4CVU A;  4RYD A;  3ETP A;  2J1R A;  5DQ0 A;  1CZS A;  2DDU A;  4MO3 M;  3CKH A;  1UZ0 A;  4RN5 A;  5B4X A;  4LQR A;  2WN3 A;  1SDD B;  3FHA A;  2VZV A;  4JKL A;  3VDA A;  1JYW A;  1NKG A;  4YPJ A;  3GGL A;  3HPN A;  3GDB A;  3OEB A;  1GU3 A;  2RV9 A;  2E33 A;  2VCC A;  5JXG A;  3I2J A;  2WN2 A;  5IYY A;  2DCJ A;  1JZ6 A;  2J7M A;  1IQD C;  1F4H A;  2B4K A;  3ACH A;  2V4V A;  2WAA A;  4MGS A;  3HNY M;  1P8J A;  1UMH A;  3ACG A;  2DCK A;  2ORZ A;  3I2I A;  2ZEW A;  5LA0 A;  3T0A A;  3WF1 A;  2XON A;  5JXI A;  3PUI A;  2Y8K A;  3IAQ A;  1W8N A;  4JX0 A;  2C26 A;  2BGP A;  5IHR A;  3THC A;  1K45 A;  4GWJ A;  1UY1 A;  3A23 A;  2BER A;  3UNP A;  3NNG A;  3OGS A;  1RYY A;  4TXW A;  4UOJ A;  1MPX A;  1H6X A;  1GQP A;  3F2Z A;  3LE0 A;  2Z4F A;  3HN3 A;  4OMC A;  3I3B A;  2YC4 A;  3K4D A;  1UX7 A;  2J1A A;  2WO3 A;  2QQN A;  3DYM A;  4GZ9 A;  2EIE A;  4QX2 A;  4A6O A;  3DEC A;  2VMD A;  4DXS A;  4ARX A;  3BGA A;  2ZEZ A;  1GOF A;  4AG4 A;  2VL4 A;  2W5F A;  3SKJ E;  3VD7 A;  3OGR A;  4M4P A;  2VO5 A;  3D3A A;  5HPO A;  5FUI A;  2VMC A;  2YFU A;  2ZEX A;  3I2K A;  3EB7 A;  2E26 A;  3VDB A;  1JZ3 A;  1UY0 A;  1US3 A;  2VZU A;  5JUV A;  2CDP A;  4JHZ A;  4A3Z A;  1K3I A;  2VCB A;  2VME A;  2C9K A;  4KMQ A;  3ABZ A;  1CZT A;  2YB7 A;  3PUH A;  3LPF A;  4FI9 A;  1W99 A;  3C8X A;  1SG3 A;  4BJ0 A;  2W91 A;  4LHS A;  2XOM A;  3III A;  1WKY A;  3VDC A;  4D8M A;  1JYX A;  2W1Q A;  3P6B A;  4P5Y A;  1KEX A;  2QBX A;  2E31 A;  2VZR A;  2QQK A;  4DXR A;  4XZU G;  3UET A;  2HLE A;  4UAP A;  2WO1 A;  1JZ5 A;  2V72 A;  1H6Y A;  1GNY A;  1JZ7 A;  4ZZ5 A;  1JHJ A;  4ET7 A;  5DMY A;  3WEZ A;  1NUK A;  2YG0 A;  1JI6 A;  4CU7 A;  2QQL A;  3I3D A;  4ARY A;  1ULO A;  3U37 A;  2JKX A;  3MUY 1;  4XUQ A;  3CZU A;  4PQQ A;  2WAO A;  4CUB A;  5A1A A;  4PF1 A;  3C7E A;  3JXS A;  2VZ3 A;  3OB8 A;  3LPG A;  2VQU A;  3CQO A;  3ECQ A;  4QAW A;  4KWU A;  4HG6 B;  3WNN A;  1TVG A;  1PX4 A;  4P00 B;  1W9W A;  1F4A A;  2WYS A;  4XUT A;  1J83 A;  2W46 A;  1NX9 A;  2VR4 A;  1DYO A;  3K75 B;  1UXZ A;  2ORX A;  2Y6J A;  3W5N A;  3I97 A;  4DUX A;  1XNA A;  2J1U A;  1GMM A;  3A7Q A;  1W8O A;  3EYP A;  1PMH X;  4XUP A;  4MAD A;  5CYY A;  3T0B A;  1LNS A;  4A44 A;  2X09 A;  2YC2 A;  4QDS A;  3T08 A;  5IFT A;  5J1X A;  1EUT A;  2VZS A;  1YQ2 A;  3WF0 A;  3VD9 A;  3VD5 A;  2QQO A;  3CDZ B;  4LPL A;  3WNL A;  4CU9 A;  4CU6 A;  2BZD A;  2Y6G A;  1BHG A;  1O8S A;  2VZP A;  1W0N A;  3GXU A;  4AAX A;  4W8J A;  4XVH A;  4ZY9 A;  2WDB A;  3WNO A;  2X05 A;  3I2G A;  3HNB M;  4OUE A;  4D0Q A;  4PT6 A;  2J22 A;  3FL7 A;  2LW8 A;  4A41 A;  2WZE A;  2JD9 A;  1UYY A;  3HEI A;  3MV0 1;  3LEI A;  2OKX A;  3C7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...