2LWDA

Solution structure of second card of human rig-i
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
KKIEKLEEYRLLLKRLQPEFKTRIIPTDIISDLSECLINQECEEILQICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERNKFSELWIVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Dynamics of the Second CARD of Human RIG-I Provide Mechanistic Insights into Regulation of RIG-I Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Probable ATP-dependent RNA helicase DDX58
total genus 35
structure length 96
sequence length 96
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2012-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16739 CARD_2 Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2lwdA00
1Z6TA 4UZ0A 2L6AA 2MPCA 3CRDA 1CY5A 1C15A 4ZBWA 4A2QA 2DBGA 4EWIA 1WH4A 1DDFA 3MOPA 1D2ZB 1FADA 2KN6A 4M9ZA 3J6JA 1A1WA 1E41A 2N83A 2MS7A 1NGRA 4JQWA 4A2WA 4F42A 2G7RA 4P4HA 2NZ7A 4IZ5E 2N97A 3CL3A 3KATA 2N7ZA 2YQFA 2MS8A 2YU0A 1N3KA 2LS7A 2BBRA 2A9IA 2BBZA 2DO9A 3YGSP 2P1HA 4N1JA 2VGQA 2D96A 4NQKA 1WXPA 3LQRA 2KM6A 4IZ7B 1E3YA 2NAQA 1YGOA 2B1WA 4FH0A 4M9SA 2HM2Q 2A5YB 2M5VA 1DGNA 1D2ZA 4LWDA 4JUPA 2MB9A 4O7QA 2DBFA 4QOBA 4O9FA 1UCPA 2NSNA 2L9MA 3EZQA 3QF2A 4I16A 4IZAB 3T6PA 4D8OA 1WMGA 2YVIA 2DBDA 2LWDA 2DBHA 3LQQA 1ICHA 4RHWA 2N80A 1A1ZA 2LWEA 4M9XA 2IB1A 1PN5A 3YGSC 4DWNA 4P4HI 4N1LA 2F1SA 3EZQB 2YGSA 2MN4A 2OF5A 3MOPK 4O9LA 2N1FA 2N00A 3J63A 2GF5A 3MOPG 4O6XA 2OF5H 4N1KA 4RHWE 4F44A 4E9MA 2O71A 1CWWA
chains in the Genus database with same CATH superfamily
1Z6TA 4UZ0A 2L6AA 2MJMA 2MPCA 3CRDA 1CY5A 1C15A 4ZBWA 4A2QA 2DBGA 4EWIA 1WH4A 1DDFA 3MOPA 1D2ZB 1FADA 2KN6A 2XV9A 4M9ZA 3J6JA 1A1WA 1E41A 2N83A 2MS7A 1NGRA 4JQWA 4A2WA 4F42A 2G7RA 4P4HA 2NZ7A 4IZ5E 2N97A 3CL3A 3KATA 2N7ZA 2YQFA 2MS8A 2YU0A 1N3KA 2LS7A 2BBRA 2A9IA 2BBZA 2DO9A 3YGSP 2P1HA 4N1JA 2VGQA 2D96A 4NQKA 1WXPA 3LQRA 2KM6A 4IZ7B 1E3YA 2NAQA 1YGOA 2B1WA 4FH0A 4M9SA 2HM2Q 2A5YB 2M5VA 1DGNA 1D2ZA 4LWDA 4JUPA 2MB9A 4O7QA 2DBFA 4QOBA 4O9FA 1UCPA 2NSNA 2L9MA 3EZQA 3QF2A 4I16A 4IZAB 3T6PA 4D8OA 1WMGA 2YVIA 2DBDA 2LWDA 2DBHA 3LQQA 1ICHA 4RHWA 2N80A 1A1ZA 2LWEA 4M9XA 2IB1A 1PN5A 3YGSC 4DWNA 4P4HI 4N1LA 2F1SA 3EZQB 2YGSA 2MN4A 2OF5A 3MOPK 4O9LA 2N1FA 2N00A 3J63A 2GF5A 3MOPG 4O6XA 2OF5H 4N1KA 4RHWE 4F44A 4E9MA 2O71A 1CWWA
chains in the Genus database with same CATH topology
1Z6TA 4UZ0A 2L6AA 2MJMA 2MPCA 3CRDA 1CY5A 1C15A 4ZBWA 4A2QA 2DBGA 4EWIA 1WH4A 1DDFA 3MOPA 1D2ZB 1FADA 2KN6A 2XV9A 4M9ZA 3J6JA 1A1WA 1E41A 2N83A 2MS7A 1NGRA 4JQWA 4A2WA 4F42A 2G7RA 4P4HA 2NZ7A 4IZ5E 2N97A 3CL3A 3KATA 2N7ZA 2YQFA 2MS8A 2YU0A 1N3KA 2LS7A 2BBRA 2A9IA 2BBZA 2DO9A 3YGSP 2P1HA 4N1JA 2VGQA 2D96A 4NQKA 1WXPA 3LQRA 2KM6A 4IZ7B 1E3YA 2NAQA 1YGOA 2B1WA 4FH0A 4M9SA 2HM2Q 2A5YB 2M5VA 1DGNA 1D2ZA 4LWDA 4JUPA 2MB9A 4O7QA 2DBFA 4QOBA 4O9FA 1UCPA 2NSNA 2L9MA 3EZQA 3QF2A 4I16A 4IZAB 3T6PA 4D8OA 1WMGA 2YVIA 2DBDA 2LWDA 2DBHA 3LQQA 1ICHA 4RHWA 2N80A 1A1ZA 2LWEA 4M9XA 2IB1A 1PN5A 3YGSC 4DWNA 4P4HI 4N1LA 2F1SA 3EZQB 2YGSA 2MN4A 2OF5A 3MOPK 4O9LA 2N1FA 2N00A 3J63A 2GF5A 3MOPG 4O6XA 2OF5H 4N1KA 4RHWE 4F44A 4E9MA 2O71A 1CWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z6T A;  4UZ0 A;  2L6A A;  2MPC A;  3CRD A;  1CY5 A;  1C15 A;  4ZBW A;  4A2Q A;  2DBG A;  4EWI A;  1WH4 A;  1DDF A;  3MOP A;  1D2Z B;  1FAD A;  2KN6 A;  4M9Z A;  3J6J A;  1A1W A;  1E41 A;  2N83 A;  2MS7 A;  1NGR A;  4JQW A;  4A2W A;  4F42 A;  2G7R A;  4P4H A;  2NZ7 A;  4IZ5 E;  2N97 A;  3CL3 A;  3KAT A;  2N7Z A;  2YQF A;  2MS8 A;  2YU0 A;  1N3K A;  2LS7 A;  2BBR A;  2A9I A;  2BBZ A;  2DO9 A;  3YGS P;  2P1H A;  4N1J A;  2VGQ A;  2D96 A;  4NQK A;  1WXP A;  3LQR A;  2KM6 A;  4IZ7 B;  1E3Y A;  2NAQ A;  1YGO A;  2B1W A;  4FH0 A;  4M9S A;  2HM2 Q;  2A5Y B;  2M5V A;  1DGN A;  1D2Z A;  4LWD A;  4JUP A;  2MB9 A;  4O7Q A;  2DBF A;  4QOB A;  4O9F A;  1UCP A;  2NSN A;  2L9M A;  3EZQ A;  3QF2 A;  4I16 A;  4IZA B;  3T6P A;  4D8O A;  1WMG A;  2YVI A;  2DBD A;  2LWD A;  2DBH A;  3LQQ A;  1ICH A;  4RHW A;  2N80 A;  1A1Z A;  2LWE A;  4M9X A;  2IB1 A;  1PN5 A;  3YGS C;  4DWN A;  4P4H I;  4N1L A;  2F1S A;  3EZQ B;  2YGS A;  2MN4 A;  2OF5 A;  3MOP K;  4O9L A;  2N1F A;  2N00 A;  3J63 A;  2GF5 A;  3MOP G;  4O6X A;  2OF5 H;  4N1K A;  4RHW E;  4F44 A;  4E9M A;  2O71 A;  1CWW A; 
#chains in the Genus database with same CATH topology
 1Z6T A;  4UZ0 A;  2L6A A;  2MJM A;  2MPC A;  3CRD A;  1CY5 A;  1C15 A;  4ZBW A;  4A2Q A;  2DBG A;  4EWI A;  1WH4 A;  1DDF A;  3MOP A;  1D2Z B;  1FAD A;  2KN6 A;  2XV9 A;  4M9Z A;  3J6J A;  1A1W A;  1E41 A;  2N83 A;  2MS7 A;  1NGR A;  4JQW A;  4A2W A;  4F42 A;  2G7R A;  4P4H A;  2NZ7 A;  4IZ5 E;  2N97 A;  3CL3 A;  3KAT A;  2N7Z A;  2YQF A;  2MS8 A;  2YU0 A;  1N3K A;  2LS7 A;  2BBR A;  2A9I A;  2BBZ A;  2DO9 A;  3YGS P;  2P1H A;  4N1J A;  2VGQ A;  2D96 A;  4NQK A;  1WXP A;  3LQR A;  2KM6 A;  4IZ7 B;  1E3Y A;  2NAQ A;  1YGO A;  2B1W A;  4FH0 A;  4M9S A;  2HM2 Q;  2A5Y B;  2M5V A;  1DGN A;  1D2Z A;  4LWD A;  4JUP A;  2MB9 A;  4O7Q A;  2DBF A;  4QOB A;  4O9F A;  1UCP A;  2NSN A;  2L9M A;  3EZQ A;  3QF2 A;  4I16 A;  4IZA B;  3T6P A;  4D8O A;  1WMG A;  2YVI A;  2DBD A;  2LWD A;  2DBH A;  3LQQ A;  1ICH A;  4RHW A;  2N80 A;  1A1Z A;  2LWE A;  4M9X A;  2IB1 A;  1PN5 A;  3YGS C;  4DWN A;  4P4H I;  4N1L A;  2F1S A;  3EZQ B;  2YGS A;  2MN4 A;  2OF5 A;  3MOP K;  4O9L A;  2N1F A;  2N00 A;  3J63 A;  2GF5 A;  3MOP G;  4O6X A;  2OF5 H;  4N1K A;  4RHW E;  4F44 A;  4E9M A;  2O71 A;  1CWW A; 
#chains in the Genus database with same CATH homology
 1Z6T A;  4UZ0 A;  2L6A A;  2MJM A;  2MPC A;  3CRD A;  1CY5 A;  1C15 A;  4ZBW A;  4A2Q A;  2DBG A;  4EWI A;  1WH4 A;  1DDF A;  3MOP A;  1D2Z B;  1FAD A;  2KN6 A;  2XV9 A;  4M9Z A;  3J6J A;  1A1W A;  1E41 A;  2N83 A;  2MS7 A;  1NGR A;  4JQW A;  4A2W A;  4F42 A;  2G7R A;  4P4H A;  2NZ7 A;  4IZ5 E;  2N97 A;  3CL3 A;  3KAT A;  2N7Z A;  2YQF A;  2MS8 A;  2YU0 A;  1N3K A;  2LS7 A;  2BBR A;  2A9I A;  2BBZ A;  2DO9 A;  3YGS P;  2P1H A;  4N1J A;  2VGQ A;  2D96 A;  4NQK A;  1WXP A;  3LQR A;  2KM6 A;  4IZ7 B;  1E3Y A;  2NAQ A;  1YGO A;  2B1W A;  4FH0 A;  4M9S A;  2HM2 Q;  2A5Y B;  2M5V A;  1DGN A;  1D2Z A;  4LWD A;  4JUP A;  2MB9 A;  4O7Q A;  2DBF A;  4QOB A;  4O9F A;  1UCP A;  2NSN A;  2L9M A;  3EZQ A;  3QF2 A;  4I16 A;  4IZA B;  3T6P A;  4D8O A;  1WMG A;  2YVI A;  2DBD A;  2LWD A;  2DBH A;  3LQQ A;  1ICH A;  4RHW A;  2N80 A;  1A1Z A;  2LWE A;  4M9X A;  2IB1 A;  1PN5 A;  3YGS C;  4DWN A;  4P4H I;  4N1L A;  2F1S A;  3EZQ B;  2YGS A;  2MN4 A;  2OF5 A;  3MOP K;  4O9L A;  2N1F A;  2N00 A;  3J63 A;  2GF5 A;  3MOP G;  4O6X A;  2OF5 H;  4N1K A;  4RHW E;  4F44 A;  4E9M A;  2O71 A;  1CWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...