2LWEA

Solution structure of mutant (t170e) second card of human rig-i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
96
structure length
96
Chain Sequence
KKIEKLEEYRLLLKRLQPEFKTRIIPTDIISDLSECLINQECEEILQICSTKGMMAGAEKLVECLLRSDKENWPKELKLALEKERNKFSELWIVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Dynamics of the Second CARD of Human RIG-I Provide Mechanistic Insights into Regulation of RIG-I Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Probable ATP-dependent RNA helicase DDX58
total genus 37
structure length 96
sequence length 96
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2012-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16739 CARD_2 Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 2lweA00
3MOPA 3KATA 1PN5A 3YGSP 4M9ZA 3J63A 2N97A 2MPCA 1D2ZA 2MS8A 4N1LA 3J6JA 2LWEA 4IZ5E 1DGNA 1DDFA 2DBHA 4F42A 4M9XA 1D2ZB 1NGRA 2P1HA 4NQKA 2MB9A 4JQWA 4P4HA 2N7ZA 2VGQA 4A2WA 4N1JA 2LWDA 2DO9A 1CWWA 1CY5A 2N83A 4EWIA 2YGSA 2DBGA 1C15A 3MOPK 2B1WA 4IZAB 1N3KA 2N80A 2BBZA 2KM6A 2D96A 3EZQA 4O6XA 4I16A 1UCPA 4RHWE 2L6AA 4UZ0A 3T6PA 2DBDA 1Z6TA 3CL3A 2F1SA 4A2QA 4DWNA 1ICHA 2HM2Q 1FADA 1A1WA 2O71A 4JUPA 3YGSC 2DBFA 2A5YB 3MOPG 2G7RA 1YGOA 4LWDA 1E41A 1WXPA 2YQFA 2GF5A 3LQRA 2YVIA 2NAQA 4QOBA 2MS7A 2MN4A 2OF5A 3CRDA 4O7QA 1WMGA 2N1FA 2L9MA 4O9FA 2OF5H 4P4HI 4O9LA 1WH4A 2IB1A 1A1ZA 2M5VA 4E9MA 4M9SA 2NZ7A 3QF2A 3EZQB 2N00A 4RHWA 4ZBWA 1E3YA 2BBRA 4F44A 4N1KA 2A9IA 2YU0A 3LQQA 2NSNA 4D8OA 2KN6A 4FH0A 2LS7A 4IZ7B
chains in the Genus database with same CATH superfamily
3MOPA 3KATA 1PN5A 3YGSP 4M9ZA 2XV9A 3J63A 2N97A 2MPCA 1D2ZA 2MS8A 4N1LA 3J6JA 2LWEA 4IZ5E 1DGNA 1DDFA 2DBHA 4F42A 4M9XA 1D2ZB 1NGRA 2P1HA 4NQKA 2MB9A 4JQWA 4P4HA 2N7ZA 2VGQA 4A2WA 4N1JA 2LWDA 2DO9A 1CWWA 1CY5A 2N83A 4EWIA 2YGSA 2DBGA 1C15A 3MOPK 2B1WA 4IZAB 1N3KA 2N80A 2BBZA 2KM6A 2D96A 3EZQA 4O6XA 4I16A 1UCPA 4RHWE 2L6AA 4UZ0A 3T6PA 2DBDA 1Z6TA 3CL3A 2F1SA 4A2QA 4DWNA 1ICHA 2HM2Q 1FADA 1A1WA 2O71A 4JUPA 3YGSC 2DBFA 2A5YB 3MOPG 2G7RA 2MJMA 1YGOA 4LWDA 1E41A 1WXPA 2YQFA 2GF5A 3LQRA 2YVIA 2NAQA 4QOBA 2MS7A 2MN4A 2OF5A 3CRDA 4O7QA 1WMGA 2N1FA 2L9MA 4O9FA 2OF5H 4P4HI 4O9LA 1WH4A 2IB1A 1A1ZA 2M5VA 4E9MA 4M9SA 2NZ7A 3QF2A 3EZQB 2N00A 4RHWA 4ZBWA 1E3YA 2BBRA 4F44A 4N1KA 2A9IA 2YU0A 3LQQA 2NSNA 4D8OA 2KN6A 4FH0A 2LS7A 4IZ7B
chains in the Genus database with same CATH topology
3MOPA 3KATA 1PN5A 3YGSP 4M9ZA 2XV9A 3J63A 2N97A 2MPCA 1D2ZA 2MS8A 4N1LA 3J6JA 2LWEA 4IZ5E 1DGNA 1DDFA 2DBHA 4F42A 4M9XA 1D2ZB 1NGRA 2P1HA 4NQKA 2MB9A 4JQWA 4P4HA 2N7ZA 2VGQA 4A2WA 4N1JA 2LWDA 2DO9A 1CWWA 1CY5A 2N83A 4EWIA 2YGSA 2DBGA 1C15A 3MOPK 2B1WA 4IZAB 1N3KA 2N80A 2BBZA 2KM6A 2D96A 3EZQA 4O6XA 4I16A 1UCPA 4RHWE 2L6AA 4UZ0A 3T6PA 2DBDA 1Z6TA 3CL3A 2F1SA 4A2QA 4DWNA 1ICHA 2HM2Q 1FADA 1A1WA 2O71A 4JUPA 3YGSC 2DBFA 2A5YB 3MOPG 2G7RA 2MJMA 1YGOA 4LWDA 1E41A 1WXPA 2YQFA 2GF5A 3LQRA 2YVIA 2NAQA 4QOBA 2MS7A 2MN4A 2OF5A 3CRDA 4O7QA 1WMGA 2N1FA 2L9MA 4O9FA 2OF5H 4P4HI 4O9LA 1WH4A 2IB1A 1A1ZA 2M5VA 4E9MA 4M9SA 2NZ7A 3QF2A 3EZQB 2N00A 4RHWA 4ZBWA 1E3YA 2BBRA 4F44A 4N1KA 2A9IA 2YU0A 3LQQA 2NSNA 4D8OA 2KN6A 4FH0A 2LS7A 4IZ7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MOP A;  3KAT A;  1PN5 A;  3YGS P;  4M9Z A;  3J63 A;  2N97 A;  2MPC A;  1D2Z A;  2MS8 A;  4N1L A;  3J6J A;  2LWE A;  4IZ5 E;  1DGN A;  1DDF A;  2DBH A;  4F42 A;  4M9X A;  1D2Z B;  1NGR A;  2P1H A;  4NQK A;  2MB9 A;  4JQW A;  4P4H A;  2N7Z A;  2VGQ A;  4A2W A;  4N1J A;  2LWD A;  2DO9 A;  1CWW A;  1CY5 A;  2N83 A;  4EWI A;  2YGS A;  2DBG A;  1C15 A;  3MOP K;  2B1W A;  4IZA B;  1N3K A;  2N80 A;  2BBZ A;  2KM6 A;  2D96 A;  3EZQ A;  4O6X A;  4I16 A;  1UCP A;  4RHW E;  2L6A A;  4UZ0 A;  3T6P A;  2DBD A;  1Z6T A;  3CL3 A;  2F1S A;  4A2Q A;  4DWN A;  1ICH A;  2HM2 Q;  1FAD A;  1A1W A;  2O71 A;  4JUP A;  3YGS C;  2DBF A;  2A5Y B;  3MOP G;  2G7R A;  1YGO A;  4LWD A;  1E41 A;  1WXP A;  2YQF A;  2GF5 A;  3LQR A;  2YVI A;  2NAQ A;  4QOB A;  2MS7 A;  2MN4 A;  2OF5 A;  3CRD A;  4O7Q A;  1WMG A;  2N1F A;  2L9M A;  4O9F A;  2OF5 H;  4P4H I;  4O9L A;  1WH4 A;  2IB1 A;  1A1Z A;  2M5V A;  4E9M A;  4M9S A;  2NZ7 A;  3QF2 A;  3EZQ B;  2N00 A;  4RHW A;  4ZBW A;  1E3Y A;  2BBR A;  4F44 A;  4N1K A;  2A9I A;  2YU0 A;  3LQQ A;  2NSN A;  4D8O A;  2KN6 A;  4FH0 A;  2LS7 A;  4IZ7 B; 
#chains in the Genus database with same CATH topology
 3MOP A;  3KAT A;  1PN5 A;  3YGS P;  4M9Z A;  2XV9 A;  3J63 A;  2N97 A;  2MPC A;  1D2Z A;  2MS8 A;  4N1L A;  3J6J A;  2LWE A;  4IZ5 E;  1DGN A;  1DDF A;  2DBH A;  4F42 A;  4M9X A;  1D2Z B;  1NGR A;  2P1H A;  4NQK A;  2MB9 A;  4JQW A;  4P4H A;  2N7Z A;  2VGQ A;  4A2W A;  4N1J A;  2LWD A;  2DO9 A;  1CWW A;  1CY5 A;  2N83 A;  4EWI A;  2YGS A;  2DBG A;  1C15 A;  3MOP K;  2B1W A;  4IZA B;  1N3K A;  2N80 A;  2BBZ A;  2KM6 A;  2D96 A;  3EZQ A;  4O6X A;  4I16 A;  1UCP A;  4RHW E;  2L6A A;  4UZ0 A;  3T6P A;  2DBD A;  1Z6T A;  3CL3 A;  2F1S A;  4A2Q A;  4DWN A;  1ICH A;  2HM2 Q;  1FAD A;  1A1W A;  2O71 A;  4JUP A;  3YGS C;  2DBF A;  2A5Y B;  3MOP G;  2G7R A;  2MJM A;  1YGO A;  4LWD A;  1E41 A;  1WXP A;  2YQF A;  2GF5 A;  3LQR A;  2YVI A;  2NAQ A;  4QOB A;  2MS7 A;  2MN4 A;  2OF5 A;  3CRD A;  4O7Q A;  1WMG A;  2N1F A;  2L9M A;  4O9F A;  2OF5 H;  4P4H I;  4O9L A;  1WH4 A;  2IB1 A;  1A1Z A;  2M5V A;  4E9M A;  4M9S A;  2NZ7 A;  3QF2 A;  3EZQ B;  2N00 A;  4RHW A;  4ZBW A;  1E3Y A;  2BBR A;  4F44 A;  4N1K A;  2A9I A;  2YU0 A;  3LQQ A;  2NSN A;  4D8O A;  2KN6 A;  4FH0 A;  2LS7 A;  4IZ7 B; 
#chains in the Genus database with same CATH homology
 3MOP A;  3KAT A;  1PN5 A;  3YGS P;  4M9Z A;  2XV9 A;  3J63 A;  2N97 A;  2MPC A;  1D2Z A;  2MS8 A;  4N1L A;  3J6J A;  2LWE A;  4IZ5 E;  1DGN A;  1DDF A;  2DBH A;  4F42 A;  4M9X A;  1D2Z B;  1NGR A;  2P1H A;  4NQK A;  2MB9 A;  4JQW A;  4P4H A;  2N7Z A;  2VGQ A;  4A2W A;  4N1J A;  2LWD A;  2DO9 A;  1CWW A;  1CY5 A;  2N83 A;  4EWI A;  2YGS A;  2DBG A;  1C15 A;  3MOP K;  2B1W A;  4IZA B;  1N3K A;  2N80 A;  2BBZ A;  2KM6 A;  2D96 A;  3EZQ A;  4O6X A;  4I16 A;  1UCP A;  4RHW E;  2L6A A;  4UZ0 A;  3T6P A;  2DBD A;  1Z6T A;  3CL3 A;  2F1S A;  4A2Q A;  4DWN A;  1ICH A;  2HM2 Q;  1FAD A;  1A1W A;  2O71 A;  4JUP A;  3YGS C;  2DBF A;  2A5Y B;  3MOP G;  2G7R A;  2MJM A;  1YGO A;  4LWD A;  1E41 A;  1WXP A;  2YQF A;  2GF5 A;  3LQR A;  2YVI A;  2NAQ A;  4QOB A;  2MS7 A;  2MN4 A;  2OF5 A;  3CRD A;  4O7Q A;  1WMG A;  2N1F A;  2L9M A;  4O9F A;  2OF5 H;  4P4H I;  4O9L A;  1WH4 A;  2IB1 A;  1A1Z A;  2M5V A;  4E9M A;  4M9S A;  2NZ7 A;  3QF2 A;  3EZQ B;  2N00 A;  4RHW A;  4ZBW A;  1E3Y A;  2BBR A;  4F44 A;  4N1K A;  2A9I A;  2YU0 A;  3LQQ A;  2NSN A;  4D8O A;  2KN6 A;  4FH0 A;  2LS7 A;  4IZ7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...