2LXFA

Solution nmr structure of a potential acylphosphatase from giardia lamblia, seattle structural genomics center for infectious disease target gilaa.01396.a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
121
structure length
121
Chain Sequence
MAHHHHHHMGTLEAQTQGPGSMQGSMPSSSEDVTTLCYRVTGKVQGVFFRKYTKKEADALSLVGYVTNNEDGSVSGVVQGPKEQVDAFVKYLHKGSPKSVVKKVSIHASSRVDADGFEIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of an acylphosphatase from Giardia lamblia, the etiological agent responsible for giardiasis
rcsb
source organism Giardia lamblia
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 22
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2012-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2lxfA00
1X0PA 1OQ6A 2AP6A 1SI9A 2AJ0A 1JK9B 5T7LB 3HFKA 3TRGA 1Q53A 1Q4RA 2GA7A 2QLXA 3BN7A 3TOQA 2XMVA 4EFAC 1IUJA 5B0AA 3KNGA 4A46A 1FD8A 2OKQA 5F0UA 2HQIA 2QIFA 5B0GA 1N5QA 4FNHA 2XMKA 3HDSA 1TL5A 1VQSA 2FB0A 2OP5A 4HH1A 4NL5A 3MCSA 2OFGX 4OIXA 2BJDA 2ZDOA 4DPOA 2KYZA 4YDXA 1RJJA 3HF5A 4A4JA 2PGCA 2XMTA 4OJHA 2ROGA 2QYCA 2HLUA 1Y0HA 2KT3A 1APSA 4HH0A 1OPZA 4FNIA 1YJVA 2GGPA 3GZ7A 1ULRA 1P6TA 1S6OA 1V3ZA 3BR8A 5KAKA 1OSDA 2FTRA 3KG1A 4HI1A 2K7KA 1SQEA 1P8GA 1N5SA 2XMUA 3DCAA 3FGVA 5T7LA 1TL4A 4OJGA 1AFJA 3IWXA 2OD6A 1X8DA 2LQ9A 2RU9A 1U7LA 3IWLA 2G9OA 2GO8A 1SB6A 4Y2IA 1N5VA 1YRXA 3QMQA 4OJ1A 4Y2MA 3HHLA 1FE4A 2XMMA 2OMOA 1FEEA 3UDCA 2GV1A 4Q2MA 3KG0A 1GXTA 3LO3A 2ACYA 1JWWA 1AW0A 3FMBA 1YJUA 2N4CA 1FVSA 2AJ1A 1R6YA 2FHMA 2JDJA 1N5TA 1YJRA 2HIQA 5B0FA 3BM7A 3HHLB 1CC8A 1TUVA 3MZIA 2N4DA 3HHLD 3BDEA 3QGPA 1MWZA 2HFOA 2AW0A 4DL0C 1Q8LA 2CRLA 2GCFA 2VV5A 2N7YA 3LGMA 1TZ0A 2GGPB 4A47A 2IYIA 4ZOSA 5B08A 1YJTA 2BJEA 1KVJA 1MWYA 1S6UA 2XMJA 3FRYA 2K7JA 1TR0A 1FVQA 1X7VA 3VTIA 2OD4A 2RMLA 3BB5A 2ZDPA 3DXSX 2HFNA 2K1RB 2RSQA 3HHLC 1Y9OA 2ROEA 2W4CA 4NPOA 1Q8BA 1FE0A 2LDIA 5B09A 4HI2A 2KT2A 3T9NA 1AFIA 2FIUA 2W4DA 2HLTA 1WD6A 1YG0A 2IYGA 3F44A 2EW9A 1Y3KA 2L3MA 2ASYA 5B0CA 1W2IA 2BYCA 3LGNA 4YEAA 5B0BA 4HL9A 5K9FA 5IXUA 3I9ZA 2BBEA 3WDOA 1VQYA 2OFHX 4ZA1A 3CJKA 1LQ9A 4A48A 2LXFA 5B0EA 1KVIA 2QLWA 1QUPA 5B0DA 4DN9A 4F67A 2IFXA 3HX9A 4Y2KA 3K7RA 3CJKB 2K1RA 2OAUA 5F0WA 2RILA 3BGUA 2LQBA 1XBWA 4OJ3A 2K2PA 2W4PA 3BF4A 4U9RA 5A6WA 1GXUA 2GFFA 2PD1A 2VH7A 1CC7A 2XMWA 2BUNA 1URRA 4QOTA 1Y3JA 3E8OA 3KKFA 4Q2LA 1KQKA 1FESA 3TNVA 5A6PA 1CPZA 2Q3PA 1OQ3A 2ROPA 1K0VA 2KKHA
chains in the Genus database with same CATH superfamily
1RYSA 1KVJA 5I3UB 3W64A 1BMQB 4MIAA 3TOQA 5GADU 2CQ3A 3M7VA 4JI3F 5D6GA 5HVFA 3R5GA 3KNGA 1FJEB 1FXLA 2C2NA 1VI7A 2NZCA 4Q0BB 3VCDA 2CQHA 2HNZA 3RRGA 2R7OA 1U2FA 2MGZB 2Q79A 2W9BA 2CQ1A 4EU0A 1NMEB 4OIXA 5ETMA 2CA9A 3UNYA 3UCUP 4YB6A 2W25A 3M6WA 2VKZG 1LK7A 3MM8B 3OPKA 2B9YA 4JYAF 2XC9A 4NLTA 1Y0HA 2Z2ZA 4PCQA 3A8KA 3G6YA 5A0YA 1APSA 3B82A 2MLZA 2VBZA 4W92B 2LEBA 2I5JA 1OIAA 1T9TA 4NXNJ 2XYGB 1MMLA 3OXFA 5DM7Q 4JI7F 1S9EA 2BOAA 3GJSB 3KG1A 3W5ZA 1NPRA 3GE9A 3QGGA 3G82A 3SQOP 2DCLA 3IBCB 4OJGA 3JYTA 5ADZA 2LQ9A 3VVUA 3PX4A 4P10A 1RTHB 4MK8A 1BY9A 4DJBA 3US5A 4OHVA 4EO8A 3FMWA 4CLKA 3KHLA 4LFCJ 3UN5A 3KUGA 1PILA 4KT0C 3NGKA 3M2RA 3LO3A 3WHIA 4HHJA 3MUTP 2EG2A 5FIIA 3D7SB 1XQIA 3M6VA 4GO5X 4RUCA 1D9AA 1FVSA 1N56A 2E7XA 4FPIA 1VK3A 2GIFA 1FF2A 3ZNUA 4X62J 3Q0AA 1N6QA 2VA2A 2CNOB 2YNGB 3BM7A 1TUVA 1SL2A 2JX2A 4AL6A 3HHLD 3IG1B 3GYXB 3TW0A 3X3UA 2XYHB 2X1FA 2CRLA 1WDDA 4ANCA 2XHCA 5CYMA 1DHMA 4ZVFA 5A8KA 1NBEB 4K4XA 2GGPB 3O2IA 2HVHA 4QYZK 4WKRA 4J9KA 1UMJA 4NASA 1CG2A 2YVSA 3UE2A 1NK0A 2QJ3A 4EI2A 2H48B 2CVIA 4F4KA 3DI6A 1YRUA 2E1RA 1U26A 4QWCA 2HHUA 2VDHA 3KJVA 1TKZA 4DFPA 2CPFA 3LAMA 1NK7A 4DPXA 1IWGA 4GVLA 3OR1A 2W4CA 3K89A 2RUGA 4ZHRB 2ZH4A 2OPSB 2MYFA 3P4UB 1IKYA 4R5PA 2XSJB 1UJ4A 5C7PA 5L9NA 4WFYA 3JAMU 5CAAA 2POKA 4P71A 3DOLA 3THPA 3JTNA 3NGSA 1S72S 4DL2A 4F02A 2M4MA 2P9CA 2GX8A 4H54A 2VF3A 1WC3A 2EK1A 3B6BA 4ZPDA 3CCQS 2Y1JA 1RT4B 3D3CJ 2CG8A 3OUYB 3C46A 4RBUA 1HWUA 3LANA 5D3GA 3MD3A 5T41A 3SQGB 5B7WA 4A48A 1Q16B 4OYOA 5D0HA 1JLBA 3BN4A 1IBCB 4USVA 3GMGA 2IVYA 3EX7B 3D0GE 5J2PB 4DV5F 1M1KT 2MZJA 1YJ7A 3SMZA 4CDIA 1HR0J 1ZTWA 3HHNB 3QRRA 3PIOQ 3S1TA 5HP1B 4LSLB 1N33J 1KFDA 1K1SA 2D9OA 3MDFA 4OV6A 4OJ3A 1OS5A 4GMKA 2WVDA 5ETLA 3M8RA 3EYZA 4F3OA 1BGXT 1HQEB 1G7CB 2BJ7A 1NDLA 1KC8T 3CF5Q 3TAMA 3BSAA 2OTLS 1PJ6A 2AZ3A 3FZBA 1E6YB 4EK2A 1URRA 5IWAF 5J2PA 2NXUA 3KKFA 4RNNA 1U6BA 1PBUA 2XWXA 4OI2A 1QAYA 3GB0A 1K0VA 1QJHA 2ZBCA 1OQ6A 2PIIA 1UEVA 3BPDA 3MM9A 4QJVA 7FDRA 4JI8F 3I32A 3ICLA 2XMVA 4GVBB 6FDRA 4LR8A 3IN5A 5B0AA 2HHPA 4MKVA 3IFEA 4AYBD 5EX0A 2RUSA 2ACMA 2HQIA 2QIFA 3AB2B 4Y2CA 3RZAA 4DR7J 2I38A 4P72A 1YLXA 2XY6A 2FGCA 1JLCB 2L41A 3P45B 1RP5A 1RHRB 2BJDA 2J0XA 3ZZTA 2KYZA 1B0VA 1RJJA 1RT5A 2RHQB 4X64J 1I51B 4LF5F 4LF7J 1WNEA 1KBRA 3RYLA 2HHHJ 3IBWA 3FEYB 1JJCB 4DX8H 4NCBA 1GX5A 3KJQB 1N6QB 4KKOA 5AXLA 1N54B 5E3QA 3H5XA 2FJAB 1ZA2B 1F3FA 1ZETA 1SKSA 1YIJS 4JV2A 4F04B 1H74A 4L72B 1S6OA 4X4OA 3OL8A 3T5JA 2MKYA 2BX6A 2ZC3A 3BH7B 4KGVB 3O8WA 2IIHA 2ZOFA 4B17A 4B3MF 4P2XA 1HI1A 3IWXA 5EUHA 1RB0A 3J81Y 4LFCF 3CJ0A 2BMBA 4CYUB 2CQ0A 3T6JA 1LWFA 2EFNA 2JLFA 4O44B 1U24A 3KHGA 2GQCA 4GKKJ 1TL3A 2B51A 4Y2MA 1C0UB 4P52A 3J81U 5KT6A 1S10A 2FLNA 3CXCR 2CWXA 5K20B 1NPPA 5DG8A 4X4VA 1Y11A 1FFGB 1V3SA 3N4WA 3KK2B 1E6VA 4A8SA 2AD9A 2DEIA 1TMJA 5HI7A 1J5OA 1NB7A 4DV6J 2J8AA 2JSXA 3PW5A 3ZZYA 4NI2B 2VOPA 1U8SA 3MPYA 2YX7A 2ZBIA 2DH7A 3PV8A 1IQTA 1P9YA 3CJ3A 5KOXA 5KFUA 3V6DB 1FX4A 1NZ8A 5HK4A 4YS2A 1ZAXA 3T1AA 4A8OA 4XK8C 1NJZA 1M5SA 2C22A 1WSRA 3AOAA 1IBKJ 1OJ4A 4ICLA 3AD9C 3ZTSA 1D8YA 1TP7A 4RPFA 4IUFA 1LEOA 2VONA 2R7XA 1YDLA 3OVAA 4WE1B 2J7UA 1YJTA 2V94A 2ZNZA 3HD1A 2N82B 3M2VB 1B4SA 1D09B 4TXSA 2KFYA 2WTFA 3DRYA 3W8GA 2EFQA 2ZWOA 3K8VA 3PHTA 2HRTA 1ZM4A 5HN0A 3SCKE 3P6YC 2BJ8A 1JLQB 1RABB 2LVWA 2I0XA 2KJWA 1N52B 4M8LA 3OHBA 1YJWS 4JV5J 2QEXS 3NL0A 2HRUA 4K4ZA 3GIMA 5B09A 3G8TA 2NCKL 3IM8A 5I4MA 1EKSA 4JYAJ 3M8SA 4EWTA 2M88A 2WCXA 4OMFG 4YHHF 4NMLA 3SSRA 2W8KA 2BANA 1S4FA 4ECSA 1NK8A 3QRQA 5DG7A 4H4MA 4LRBA 5KFOA 4NLWA 2ZE2B 1OWXA 4KFBA 1OYDA 2OPRB 3TO8A 2W9AA 3I6PA 1S6PB 2VZ9A 3W2VA 3JS9A 5KFKA 3SV4A 3C16B 4QZVB 2KTQA 4I2PB 3CPWR 2C1EB 4ALZA 2CJKA 1Q7LB 1R31A 1UVIA 5EGYA 4G1QB 1U0HB 5DLGA 2XZDB 4HHUA 1RTDB 3SSQA 2W2NP 1VBZA 3E51A 1F6TA 2NR0A 1FERA 3L7PA 4URGA 3TUJC 1IKWB 4DEZA 1MW7A 3NG8A 3BGUA 2W01A 4LREA 4WWSA 3FFIA 3BF4A 1VMBA 2GMJA 1WUUA 2DGQA 5K8MA 1FDAA 1DLOB 3Q8UA 2PT0A 1R43A 1X4BA 3EZOA 3GSDA 5C25B 1H38A 1RE1B 2XZTB 4USUA 4J9RA 1X5SA 3M2UB 2IM2A 2R8JA 4C11B 4LVOP 3ILIA 4WP9A 1SQFA 5HSPA 4UQGA 4QYRA 1ZM3A 1Q53A 4C8NA 5F8HA 4Q44A 4IH5A 3SEOA 4ENOA 4Q5VA 2QMXA 2V69A 3ILLA 4DX5A 3W66A 5KFCA 2HZVA 3CIMA 5HBMA 4QIWD 3DXBA 3GR1A 1CS4B 1F9FA 2QL5B 1IKXB 3AD8C 3G9CA 1UEKA 2O66A 4TNOA 1LXNA 2YX1A 2B6AA 3FBFA 2YWEA 3AJ2A 1GQEA 4RW6B 3ENQA 2DGUA 3DMJB 2N3OA 2ZDOA 2YTCA 3G6VA 2B4VA 4ED1A 2GQQA 4WP3A 5EDWA 4OJHA 2NREA 3KJNB 3FC9A 4M5IA 1S0VA 4UZCA 2BQUA 3MR7A 5EHHA 3JQMA 4HH0A 1OPZA 1JLGB 1VJQA 4X4TA 5KT4A 1JLQA 3EICA 2XLJA 4Q8FA 1RT1B 2MMYA 2D69A 1SJ4P 1UZDA 2FTRA 2M0GB 2HQFA 4LF6F 3FGVA 2H3EB 4WE1A 5C5JA 5AJ3F 4A8MP 2UVUA 4WZMA 1HARA 2E1PA 1X8DA 3IWLA 2ZFHA 4Y2IA 2CFXA 3DU6A 1HYSB 5LSLA 2Z0GA 2PFDA 3NS5A 1VRUA 1SVDA 3A3NB 3C6UB 1WEXA 4YY3J 1S6PA 2QG9B 3CCVS 1KNZA 1SL0A 2RF2A 2HWIA 3RG6A 1FWKA 2I9SA 1HWKA 3DRRB 2O3DA 3PW0A 4NWBA 3KDNA 2BE2B 2NXEA 2JVRA 1CC8A 2GO9A 3QAUA 3QT7A 2V5HG 4O3SA 3TA0A 1EQMA 1UL3A 5JUMA 5F8GA 3GIJA 2AW0A 4DL0C 5J2QA 1B7YB 2BM1A 2Y0SD 3N01A 3OV7A 2NUHA 5LSRA 2X1BA 4DG1A 3M8PA 4A47A 2RS8A 4DV2J 4KAIA 4KV8B 1XMQJ 4NLYA 2GIQA 4BC9A 1VQ9S 1UP1A 4ILMA 4L74A 2HHXA 5F8NA 3MEDA 1L3SA 2RMLA 3WZ0A 1RTDA 4NLOA 3NAIA 4ES1A 3CJ8A 2EC0A 1ZPVA 1CLFA 4Y00A 3JQJA 3Q8VA 3D1QA 4H4KA 2FQQB 5ETQA 4K4VA 2XWYA 4K2JA 1VLOA 1HBUB 2ZC4A 3C66A 2DRDA 1NJXA 1LW0B 3K5MA 5HMWA 2C2EA 4CTAB 4DV0J 2E9RX 3ZNJ1 2VJVA 3F44A 4X66F 3LP0A 1WC5A 4R0JA 3T3FA 2R7TA 5ETOA 2XGPA 3DOMA 4DLGA 1TAUA 5D0EA 2IM1A 2AJ2A 2MSSA 2KU7A 4S0MA 1XR6A 1N36J 3EVOA 2CQ4A 3NCPA 3QSIA 4ZCMA 5JVGQ 3JSYA 2A10A 4FXVA 3TZZA 5HP1A 4UOGA 1UVNA 3J7AN 2Z2LA 1LQ9A 1JJHA 3MM9B 4U7UK 3W63A 4GC7A 4OHXA 1D3WA 3THTA 2QLWA 1L3TA 1YZ7A 4K4TA 1EP4A 4IH6A 1HBOB 1NUEA 2DH9A 2DNGA 3MHYA 1HNIA 4PWUA 2H4YB 3MMAA 5GMEA 2LA6A 1C1CA 2XM3A 3Q24A 2AGPA 1TK0A 5D0RA 3M4XA 4F7VA 3UW1A 2ZM6J 2GAGC 4QIEA 5HROA 2V68A 3BDPA 1WF2A 2FZKB 3LW5C 3CULA 4MMOA 1S0MA 4M95A 5RUBA 1SH3A 2VDIA 1N0VC 3VR1A 1GNKA 2BEFA 2Q3PA 2ROPA 1MMNA 1CVJA 1FXDA 1UFWA 1CJKA 4I7FA 2DNQA 3G96A 1TKXA 3H5SA 4J9VA 5KT5A 1BWEA 1JMTA 1WF0A 5D3GB 2DGWA 4Y2AA 1JLEA 4AL5A 4I67A 5K5MA 1FI4A 1N4LA 4UOCA 1N48A 2JEIA 2DR7A 1WTFA 4OLOA 3QSYB 2MQOA 2ZNYA 2MZSA 4ZVSB 1YBUA 2LDYA 1LWFB 2OFGX 4M1KA 4JI2F 2HIYA 4CLLA 3M2RB 3WC0A 4L76A 3OTOF 3HHKA 4ER8A 1O8BA 3EWGA 5GAHI 3V6HA 3FSXA 2WAQD 3T1YJ 2HLUA 2FYXA 2XI2A 4ZVQB 1LXJA 5F9NA 4ZVUB 3DLHA 4N41A 4DR5J 1YJVA 3OL9A 3AD7C 3LP2B 4KY3A 4PPZA 1U45A 3Q8QB 3O6QA 2ZM6F 1BC6A 1H2TZ 4URSA 5LXYA 2B0GA 2K7KA 3M05A 2JOQA 1P8GA 2GHVC 5ETKA 1TTHB 3NCQA 2PMZD 4ECXA 2HKEA 3GFXA 1C4CA 3G6XA 2OD6A 3EGNA 3R7NB 1BQXA 4PUOA 4C8KA 2G9OA 4NA2A 2I6WA 3QMQA 5DM6Q 3H20A 1VHIA 3L4BC 3HHLA 3DYAB 4WU2A 2OMOA 4DPTA 2YH0A 4ECVA 4JI0F 1GT8A 3AHPA 1RWWB 1GXTA 4LSNA 1S48A 4LR7A 1R0AB 4U96A 4OI4A 3MGJA 5DGBA 2CPYA 2V34A 3BBFA 2EK6A 4IG0B 4ZP8A 2R8KA 3NGDA 4JI1F 1JX4A 2KO1A 3C6UA 5DDOC 2IMWP 3CIZA 3RB3A 1CULB 5HAOA 4M5KA 2RDJA 3HLUA 1RWUA 1EX8A 1S1UA 2N4DA 2W2QP 2CWKA 2LLZA 2W7AA 3FBEA 4RO0A 4DPUA 3KLEA 2JEGA 3LOUA 3EGWB 1KOOA 1OO0B 1QUVA 1J2VA 1WOPA 2GVZB 2M3DA 3M8QA 4ZLJA 4I64A 4F4WA 3W8PA 1T9YA 3CDWA 2W9BB 2DO0A 4OYXA 2D3ZA 4IR9A 1FRIA 2HNYA 3JSBA 2VASA 4K59A 2FD2A 4P2SA 1DARA 2IVMA 1JLGA 2D7SA 2C2KB 2H1YA 3H8YA 4WFNQ 3CMAS 3DLJA 4RNMA 1RYRA 4FBUA 3IXQA 3TARA 2NSCA 2GZOA 4PWWA 5C24B 2U1AA 2JFDA 1UVMA 2A6MA 4NPOA 1S1TB 1DRZA 1Q8BA 2DR9A 1RKIA 2ILYA 2RRNA 3OW2R 1MSWD 2MZ1A 5DG9A 5D8HB 5CZVA 3AOBA 3M30A 2Y8WA 2FIUA 3UFCX 7FD1A 5H9EJ 4XPEA 1RBLA 1WORA 2H5EA 2V63A 1Y3KA 5B0CA 4KH0B 1ZAWA 4I2PA 4KYZA 1K73T 1DTTA 2BYCA 3LGNA 1S9GA 5IC4B 5IXUA 4Q7AA 2LA4A 1T8EA 1EJ7L 2DJWA 3DNCA 2QZ8A 4CH7A 4DR2F 4DR6J 1RA7A 2HQDA 5ETTA 4ZHRA 4HTIA 3GV5B 4RWWA 4TN2A 2VIHA 1KHVA 3DLKA 1NJIT 4QYZJ 1WHXA 2FHOB 3CJRA 2MLYA 1BQMB 3I0RB 2VQFJ 3PFEA 3C19A 3Q86A 1R3NA 2LMIA 4KH1B 4W4MA 4F67A 1T3NA 3CDUA 4K4UA 2CJBA 2F4VF 4MJKA 3VAHA 4M5JA 4K4YA 2OAUA 3TX8A 1LKZA 2VKRA 3CDAA 2RILA 3EM1A 4LUBA 3PO4A 1T11A 1MU2A 5A6WA 2W4PA 2F65A 3AQPA 5GMKa 3R27A 5F41A 2Q6BA 2YWKA 1Q86T 1IM4A 2I8EA 2UUBF 2VODA 2BUNA 5A0YB 2HFZA 1U02A 2YNIB 1S1XB 3LP1A 3A3OB 3EXYA 3PG9A 1H3DA 1JK9B 5T7LB 5IOLA 2IJRA 5KFVA 3H5YA 3BN7A 4OZNA 4EFAC 5KFLA 2KG0A 2RU3A 5IQ6A 3VZIA 1FFWB 1QD1A 3GIKA 4DV1F 3V6DA 2C28A 2VQEF 2PC6A 3KLHB 3FBCA 3BH6B 2KVQE 4MK9A 4PG6A 2RD5C 3KLGB 1BUXA 1WG5A 5CYJA 2DGOA 2MZTA 2HPUA 2RH3A 2ZEJA 4ZJOA 4JB8B 4ATNA 4IYQA 4HH1A 2ADCA 4JI4J 3PYFA 4OFZA 3V6KA 1VISA 3G86A 4EMDA 2BXJA 2G0JA 2QLJB 4KPCA 2W1BA 2P5VA 1TL1A 3MAHA 5GAHU 3LWLA 2B4PA 1U1RA 4ZLLA 1S0NA 2OIHA 3LP1B 2QX0A 4I6AA 2G4BA 5GADI 4F8RA 3CSKA 1VYAA 1KONA 1IR1A 1RT7B 3J7ZT 4DI6A 4JP8A 4ED8A 4NLDA 5KFXA 4DV7J 4C3MA 2GVDA 4OI3A 1HL6A 2CNNB 4N5SA 4DV3J 4RU2A 1XNQJ 1N5SA 4YQWA 4FF1A 1SC1B 1SC4B 4C8LA 4DSKA 4LF4F 3TVZA 2C2DA 3OJUA 2RKIB 1EAYC 1S49A 5FLXU 1SB6A 3Q2TC 1DBDA 1RLCL 4PYDA 3MCOA 3H4DA 4U8YA 3KMQA 3LTOA 1RBAA 2F8HA 3GFZA 2JL9A 1M5OC 2GAHC 1WG1A 4USMA 4R8UA 3HKWA 4O3RA 3VGTA 2UUTA 1I3OB 3V81B 3A13A 1RSCA 2GHWA 2W24A 3PEHA 4LVNP 4ZPAA 1LFWA 3AA8A 5IQQA 1LWXA 1KS2A 5C42B 2BJ3A 2HBZB 1WG4A 1Q82T 1RTZA 2FHJA 3DLEA 1Y4ZB 3QBCA 4ED3A 4QW9A 1B70B 3SCJE 2IM3A 2VV5A 3PJ9A 4N47A 1H0HB 1S12A 3N9UC 4OLPA 3JSMA 1HD0A 4USKA 2C3OA 4X64F 4I6YA 3BO2A 1MWYA 1U2RA 2AYGA 4KJIA 3FRYA 2RHSB 1DFDA 3L95X 3QFHA 4G1QA 4ELTA 1QLNA 3RB0A 4ECUA 3QJPA 1UWAA 4FYYB 3MUVP 1SV5B 5GAGU 4ZPWR 4I1TA 1YI2S 3HK2A 3CJTA 1BD6A 2LDIA 1ICEB 5CHCB 3PACA 2YKAA 1HNVA 1RAFB 1S1UB 2BZ2A 2ZOMA 3MPUB 1YQHA 4P75A 3RAMA 4CO5A 3I4HX 2HK3A 2BJ1A 2J0WA 3QAEA 3CD6S 5J1EB 3ISNC 3H2UB 2MKKA 3VGVA 4IG0A 2FGOA 5IM0B 1Q79A 3SV3A 2ZH6A 3ENAA 4DR7F 2F9DA 3D28A 4M5MA 5BYQA 1GEHA 3MR5A 4LSNB 4ZA1A 4DR4J 4MK7A 3QQCD 2QSFA 4NEZA 4WPAA 4JUZA 3W9IA 4YHHJ 2H5JB 2DPIA 2EEYA 3DRXA 1CULA 1KHWA 2ZZTA 2C3YA 4LFAJ 1RWXB 2KM8C 1GMWA 1PYTA 4NE9C 3TVYA 2R8HA 2WB1D 4HHHA 3PW4A 4TVAB 3HX9A 2BDPA 2XCPA 3MOZA 5HROB 2UUBJ 1U48A 2GQ2A 4XDDA 2WOMB 3MEEB 3IR7B 3N6MA 4CLWA 3Q89A 1J5EF 1FNOA 2NUUG 2ATCB 3MAAA 1KTVA 4QIFA 4Y0FA 1NSPA 2WVCA 3LP0B 5A6PA 1X4DA 3R5DA 1S76D 2CPDA 1KQKA 3AA9A 1TL7A 5DS7A 1UFLA 1X31C 2V2VA 1SKUB 1OQ3A 3HVTB 4FYWB 5HATA 2KKHA 4DU7A 4ZKAA 3HMJG 3MR6A 3KFWX 1QE1A 1SQGA 2AP6A 2HRYA 5L9XA 5KFHA 4J9QA 2CPXA 2MDAA 1HPZB 4DV4J 3TANA 5IT9U 2DNNA 4CCHA 8ATCB 2QFIA 3D5MA 3DRSB 2E1MC 4NYZA 4LRFA 2Y1RI 1NRKA 2DGVA 1JKHB 5MLCV 2IRUA 3DOLB 2JHEA 4CM2A 5LMUF 5CCLA 4QWEA 5ETPA 1IBLF 1HNXF 2VC1A 4CT9A 3CJ5A 4DPOA 3IAM9 4DV0F 2J7KA 2JLEA 3DHWC 4U6PA 4DQSA 1UJ6A 2PGCA 2ZH9A 3A8EA 3T1HF 1K0TA 2MTLA 2QYCA 2OUGA 4JBCA 1TKZB 2KRBA 3RU0A 2HHWA 3QO9A 4P73A 2EBEA 2BE2A 2WVEA 1LNQA 5ETNA 2JC1A 2A0FB 2V4JB 3AQOA 2NYIA 3PW2A 2G0IA 2YX4A 4N56A 1RDRA 1M1HA 2VG7A 4LIWA 4KHMA 1PAUB 2XMUA 4HT5A 1LWCA 3EVWA 4V1Ak 4PR6A 3D1HA 1AFJA 1RHUB 5KFMA 3F41A 3UN3A 3W2WA 2OMLA 4QW8A 3ZTOA 2UXCF 2BJ9A 1RWOB 1T94A 2DY1A 4YB5A 3QFWA 4FXWA 4OJ1A 4JI4F 3BO3A 3F73A 2MKHA 3OXLA 1T03B 2V8PA 1KTQA 3M30B 3IRWP 5CCMA 3L3CA 4I68A 3MEGA 2DY9A 4IDKA 1ZTTA 3EDQB 4J9SA 1JXEA 1WOSA 3EJMA 2ALYB 5EN1A 3KYLA 1UVJA 1F1BB 2FHMA 1HBNA 4DZDA 3FSYA 4M5LA 1YJRA 2GIRA 2C42A 4PYAA 5B0FA 4YUDA 2XO6A 1X5TA 4YB7A 2GJ2A 3VQTA 3WQPA 4QWAA 2HNYB 4DR1F 5E3RA 5F8LA 3EE3A 2R7UA 4PXBA 1QSLA 3PR5B 1VFJA 3LGMA 2YNFB 3VAMA 3U7JA 3MM7B 5AE2A 4ZOSA 4YOEA 2MSTA 2Q1LA 4MKAA 3VAIA 5IV4A 1WHVA 2ZKUA 3UDEA 1T03A 4ZS6A 4DX6A 5IT4A 1TR0A 2J5AA 2R2SA 2E1AA 2ZHOA 2QA1A 4KB7A 4X4SA 2RJZA 3EXCX 2ZUAA 1HMVB 3G4SS 1IBMF 2ZDPA 4B3MJ 2V4RA 3QATA 4NEYA 3W2WB 4ZK7M 5LMNJ 3MMBB 4IOAQ 1K44A 3GTYX 3MM6B 4WIQA 1N8RT 2VPWB 2RSQA 3TP2A 1SUQA 2V0NA 2UP1A 2HSEB 1FE0A 1MG7A 2DNKA 4KQZA 4LRAA 4RNFA 1V5VA 3CJ4A 2KT2A 3I5BA 4MFBA 3RBEA 1AFIA 2ZVSA 4M63A 5CYQA 4B3TJ 2PEBA 5FJ4A 1C1BA 1W2IA 1C0TA 4KV8A 3LQVA 1QTNB 1NHUA 2XYPB 3GFHA 3MM5A 1IJEB 4FZVA 4HT7A 5LJ5Y 2IA0A 1L5UA 4GKKF 4WFAQ 3CEDA 4CLZA 2LXFA 1D8ZA 3W60A 2V8GA 1XR7A 1F5CA 3AODA 3W65A 4ZJQA 4DV3F 4M94A 1SKWA 1GX6A 3UDVA 1V5IB 3DLGA 4JI3J 3NGRA 4A8QA 2K1RA 3M1VA 2KDOA 2G2OA 1A6LA 2NPIA 4ZCLA 1RWNB 4CTAA 4TKTA 5LJ3Y 4LMZA 2FVQA 2A2CA 3PDNA 3OVBA 3RR7A 1AXQA 1W25A 5L1LA 1RT3B 5D15A 4DV2F 4U95A 2G2YA 4I6WA 4RW8B 1S6QB 4ECRA 4DR6F 1TMMA 1CC7A 2A3JA 2WONB 1ROFA 1VQ7S 2J0SD 2F9JA 2MQ8A 1TQLA 3E8OA 3G87A 3G8QA 3HULA 3O5TB 3IRXA 4OZ3A 3KOAA 4DU8A 2IPOB 4AE5A 1PYOB 3IGVA 3GR0A 2DXDA 2H5IB 4GKJJ 2HEKA 4OHYA 1NU4A 1WC6A 4L75A 4ED4A 3R6GB 5F3TA 4C2MA 4Y6IA 5CQGA 2KG1A 2YY3A 3SCIE 4OX9J 1FRKA 5F0UA 3OBIA 4O4GB 2EFPA 2XMKA 3GJRB 4HDGA 4DCJB 4IOCQ 1TL5A 2UUCF 3K0JA 5EWEA 1RISA 4F2SA 2VA3A 1FX2A 3DGPA 1SC6A 2C2OB 2WW4A 1M5VC 4LSZB 4RW4A 4U67Q 1X0FA 3ENVA 4NYPA 2QE5A 1FFSB 3BPSP 3PW7A 3CW2C 1Q7YT 1UPPA 3DC2A 2XTJP 2EFOA 2ZITA 4FNIA 4WKYA 3G6ES 4E0DA 1NAQA 3G2XA 4E8UA 4L3KA 4YR3A 2XY5A 2DRAA 1ULRA 1EQ0A 4DR3J 4D3GA 3RR8A 5KAKA 4RUHA 2HQGA 3ZZ0A 1TL1B 4DWIA 3CCUS 3CJSA 2YKNA 4WYLA 2M7SA 2IVFB 4DL7A 2VOOA 3H59A 2MGZA 2HHTA 1U7LA 5A8RB 1JNRB 2FLOA 3I5AA 5GVQA 1FE4A 1SJQA 2B8QA 3HFZB 4B02A 4CO0A 2XLIA 1FEEA 2ZVIA 2DO4A 1NK4A 4X66J 1U49A 4WFXA 3NOGA 2KRRA 3EVMA 4DUZJ 2MKJA 5SZTA 4DUYJ 1JWWA 3R5JB 1RTJB 3FSIA 5BYRA 3J7YI 1O0PA 5A8RA 4DLEA 3BGOP 1Q8KA 1FDNA 4KKOB 1WELA 3FJ2A 1VQ6S 2KVIA 2HZCA 2YKNB 1JQGA 3GYGA 2APOA 4CI0B 1SPBP 4ED7A 4ED0A 3BQ0A 4GRSA 4OYBA 1ZZNA 2MKSA 2HMIB 3FBBA 3SI8A 4YDDB 5B08A 2DNMA 1VQ4S 2V9KA 3C14B 3ZZUA 2MY8A 2IA6A 1IKWA 2DNHA 4C8MA 1VBYA 2LXUA 1IR0A 1NHVA 4FDFA 4DQQA 4NRTA 1Z1ZA 4Z7YA 3TAPA 2D9PA 5H1SV 3WBZA 1NSQA 4ICLB 3OD2A 4Q43A 2FY8A 3OL6A 3LPYA 3PJXA 4NLSA 2RF2B 3DLBA 4EZ9A 3C16A 2VU5A 3K5NA 2E9TA 1GMWD 5KT2A 3NMRA 2GVDB 4DUZF 1EHWA 2OPRA 3RRHA 1LV5A 4ZLNA 2HLTA 3JTPA 5EX3A 3R5BA 3TJ9A 4ELUA 1DJ0A 3IBFB 1FO1A 3V2UC 5EWGA 3KK3A 4B9LA 5AXNA 3GP9A 3C3LA 3CJ2A 2VPYB 4LBPA 4YEAA 4ZIWA 1X9MA 2OEKA 1R89A 3CCJS 1SXLA 2YKOA 3PRVA 5G0RB 1NDCA 4ECZA 4KPYA 3TQEA 4K7QA 3G71S 1RT6A 1KQFB 1DTQA 1FDBA 4O3OA 4EBEA 4O4GA 1BXNA 1DLOA 3HSDA 4C8YA 2WVBA 3B4DA 2ZOGA 5CABA 4DFMA 1P27B 5IFMA 4AL7A 2J6UA 2ZKTA 1R8BA 2F8EX 4IOBA 2YQ3A 1CEZA 3K7RA 1D9DA 2IBOA 2LEAA 5JXSA 1ZOTA 5BR8F 4DL4A 4I4BA 2WSFC 5JJBA 2VUGA 3DGVA 3DMJA 4W98A 1HQ2A 4WBFA 5KFZA 3ZO7A 3AOCA 1WI6A 3SDEB 5KOWA 2J6SA 5LL6d 1FESA 4LF9J 1EETA 1TV6A 2E66A 2F8MA 4AXJA 4MKYA 3NP5A 1UAWA 3ETOA 2Y0BB 4ZPCA 2R2RA 4LFBJ 3TRGA 2BRKA 4AD6A 1Y00A 3VQSA 3IS9B 1EARA 2P9GA 3NKYA 2HS3A 2ATLA 2FJVA 3CCES 1FT8A 3OFHA 3C2PA 5M2UA 2MQMA 1S79A 3GV7B 1N5QA 2QLFB 3Q8RB 2EXUA 4ETZA 1C0UA 3QYYA 3GPAA 3FEXB 3MCSA 1W2BR 5DDPC 3KLVA 2HS4A 2BV3A 1HBNB 1PIEA 3MM5B 4G6VB 2CIMA 4U8VA 5A8KB 4IO9Q 1FK9B 1FNXH 2B56A 4NCAA 2ROGA 3FDSA 1JLCA 1S59A 3CC4S 1P1TA 5CA5A 1VIOA 2OPPB 1JKHA 2OO4A 3J7A1 3SXLA 1H73A 2KI2A 4AQYJ 2HVDA 1V6HA 2AYMA 2BW2A 1WC0A 2HNDA 3DDKA 1NK9A 4BDPA 2ZWPA 2E7VA 2F5GA 1BWVA 1XMQF 4ED5A 1SQEA 1WKJA 3KUHA 2JH3A 3BV8A 3C6TA 2V8DA 1NHKL 2JVOA 4RUAA 3BQ2A 4B3SJ 3T41A 1IJFB 1I1GA 3PJWA 2KL8A 2VFRA 3RBZA 2MB0B 1DAXA 1MNEA 4P7TA 1UA1A 1NSKL 3M9NB 5L1JA 2XMMA 3W3SA 3CWJA 2HHSA 3T6BA 4MFBB 2KYXA 2QMUB 3M32B 1N33F 1WSVA 2EFGA 1NSAA 3K2YA 1B64A 4LF8J 2N4CA 4LF8F 1TFWA 4M5HA 1VQOS 2MHNA 1WKKA 2EKYA 2Z57B 1HWIA 3MCNA 4CQ1A 2CVEA 2VG6A 3CVKA 3PR4A 3K58A 5HQLA 3BJYA 4FPRA 5AXKA 1VBXA 3PM9A 4X65F 4AT1B 3EGZA 3CB4A 3OUYA 1ZZFA 4DSIA 3DGPB 4F0HA 3CMES 2IYIA 2FVCA 4XO0A 3TUZC 1ZBTA 3MM6A 3ZZZA 1QE1B 2L08A 1X7VA 2RIJA 5KFAA 4K0KJ 3J7YU 2LYVA 1LK5A 3E01A 4AFFA 4ILLA 2HHVA 2XSJA 6AT1B 2VC0A 4HLBA 2FC8A 4DV5J 3TAMB 3QIPA 3KXDA 4HACB 4LF7F 1RAJA 1N34J 1VR6A 2V4JA 4ZVPB 4NZ7A 3TJ8A 4J9LA 1L3KA 2MJNA 3T9NA 1U2CA 1BE4A 1ZS6A 3OFEA 3GIRA 1RWPB 4LSLA 5K14A 2B7CB 1HWLA 1OY9A 5D4NA 2DXEA 2ASYA 2M8HA 3TEHB 5EWFA 2HFUA 3QT5A 4GVBA 3BREA 3OR2A 2YQ0A 4RW8A 5K9FA 4JV1A 1S4EA 4DSJA 1FK9A 4G65A 5CYMB 3TZWA 1O5JA 5H9FJ 4UT4A 1UPMB 4X65J 4C9DA 2HHQA 2KFNA 2CPHA 3MXHP 3OFGA 3VWSA 1YRTA 2OELA 5DO2A 1JB0C 3MAAB 5B0EA 3DRSA 4NOHA 5CD4A 2FY1A 2CUYA 2AX1A 4TU8A 5KG3A 5IM0A 2N7CA 1PC5A 3ETMA 2H51B 2EG1A 1ZH5A 4ECYA 4Y2KA 3CJKB 2DNOA 4K0KF 4HEA9 4B3OB 4FVMA 2YQ1A 2Y1IA 1XBWA 1TKXB 1NK6A 3PRBA 3QGHA 1FDDA 2H4WB 4LF5J 2QL9B 5J2QB 1KLNA 2FLLA 3BYRA 4RW7A 1T7PA 3D0IE 4EGLA 1FKAF 1NKCA 4ZDNA 1CPZA 4YN3B 4Q2LA 1JNZB 1X4CA 1QY7A 1NDKA 2DH8A 3JYTB 1RXOB 3LGHA 2HBRB 2O5DA 3HFKA 1FKOA 1ZPWX 2IJNA 1ACMB 2QLXA 3W61A 1M90T 3N5FA 1JLAB 2X3DA 1BLUA 1PYSB 4O0NA 1HYSA 2K8GA 3NWRA 4L3NA 1RKJA 1HNZJ 2RS2A 4KHPF 4NA3A 2CQCA 2NXCA 3PX0A 2NLWA 3HCXA 4PG8A 3MECB 2XMTA 4NLPA 1K47A 2HW3A 2AYEA 2FC9A 5FDLB 2JEFA 4GO7X 3IGNA 4DSLA 3ZTQA 4X4PA 2V67A 1G6BA 1S1VB 2GGPA 4DX7A 4PG4A 3TQ1A 1AROP 1TVRB 1ZM2A 3B78A 2UXBJ 3DCAA 4H4OA 5T7LA 2ZH8A 2C3MA 3HT0A 3MMJA 4ZVHA 3R2CJ 3P96A 3D2WA 1S7IA 1S5ZA 2JZ5A 3U1LA 5KG2A 4KIAA 2VBXA 2CJAA 3SCLE 3RBDA 4FKXA 2OSRA 3H2VE 4EYHB 1RA6A 2A1BA 4ECTA 4WK3A 2LQJA 3PCOB 3R97A 3KG0A 4NXMJ 2VQEJ 1LWCB 3JAMY 4RKUC 4ZP9A 3VF0B 1YJUA 3DLEB 1IXKA 3POTB 2M52A 2AJ1A 4TYAA 2JDJA 3VAFA 2AYBA 3KDOA 3M32A 1CJUB 2HAIA 4ZPTR 5F3ZA 2HGMA 3MZIA 1JXLA 1R8CA 3GV8B 2VHGA 2FJXA 2QN6B 8AT1B 2IJFA 4J9OA 2KZZA 2V4QA 1FWLA 3EPIA 4LFBF 3CNQP 1ZYQA 1MROA 2HHHF 3D6MB 1TZ0A 2IY5B 2UUCJ 3RAQA 3K5OA 1PAEX 5KG5A 2XMJA 1QM9A 2FDNA 2J9EA 3AH6A 2K7JA 4QWDA 2W7PA 2UU9J 3VTIA 4DF4A 1Y10A 3IM9A 2CJXB 1U09A 5GAEI 3L7OA 2DEJA 1Q0NA 1WHYA 1WTBA 2DR5A 4F26A 4A8FA 2BRLA 3MTJA 4CLTA 2AEMA 2ZJPQ 2KHDA 4DV1J 4CP5A 2OTJS 3OLAA 2DNZA 1FNMA 2BE7D 2DIVA 4CRJA 1H6KX 4FYVB 2C3UA 2PA3A 2BKPA 5ETRA 2L3MA 2EVZA 1SJFA 3D1OA 2UUAJ 2PI4A 1IR2A 1A7GE 3PRDA 5IV3A 2CPJA 5LXRA 3I0RA 3I9ZA 2ZJRQ 5E3CA 2GVZA 2VFTA 2X3GA 4ZCKA 4C3LA 2VPZB 3ZZRA 1RGVA 1SJ1A 2VD3A 3C15B 1R6VA 5KFBA 4ID8A 4NYOA 1VBKA 3OJSA 5I42A 2M2BA 2R7VA 5K8PA 2K3IA 3J81j 1TELA 4NLUA 4DPWA 3VAKA 1C2PA 4P9SA 3WC2A 4DN9A 3CTRA 3LF0A 2OPQB 3RJMB 5HBMB 4YP3A 2OEJA 4MT1A 3H25A 2UXDF 1TAQA 1SH0A 1KVKA 4NLQA 1XEZA 3M8WA 3MM8A 3SBMA 3WX8A 3KMSA 2K2PA 1A9NB 2CPZA 1KLMA 3NS6A 3M2UA 4NZ0A 1RT2A 2IC3B 2IAJB 1BQMA 2PMWA 2VH7A 3AJDA 3ITHA 5IWAJ 1TU0B 1SL1A 3HI9A 1EB0A 5KFQA 4UOHA 2F40A 4RLEA 3K59A 3KLHA 2XG8A 1YBAA 4ES2A 4TQSA 3M9OB 2NSBA 3GWCA 3D67A 2B3TB 1T02A 1RHJB 2M9KA 4UZBA 4F50A 3CDBA 3HJFA 3KG4A 4ILRA 3W5XA 2MKIA 2DIUA 1GMVA 2I2YA 2V9WA 2BABA 3KHRA 2NZ4A 2VFVA 2C2RA 3J80Y 4A46A 2OKQA 4PQUB 2NS1B 1VDHA 2B5JB 2O01C 1NK5A 1U0HA 2E9ZA 1MWQA 4Y28C 2YKMA 1K1QA 4FYXB 3G8SA 1L3UA 1FHTA 1HW9A 2CJQA 5KFFA 1IM6A 1MROB 2XNQA 3I5CA 1MU2B 2PA8D 4NLXA 3W2VB 1CJVB 1UW9A 1Z4UA 3GILA 1DTTB 3IR5B 4F4YA 2JEJA 4PRFA 3T9ZA 4CT8A 2WBRA 3RAXA 4AXIA 1FRMA 1TUGB 1X4GA 5IC6B 3A3PB 1XNRJ 3VVTA 2ZH7A 1U4BA 1N0UA 1U25A 3TYTA 4IRCA 5C42A 1X4EA 1VLYA 2ALZA 2WRMA 2E1CA 3BR8A 2HVZA 4OV1A 3R1LA 2P6SA 4HI1A 3UVJA 1AUSL 3D4JA 1VQ8S 4R8UB 4JI1J 4CZCA 2VBYA 1S1VA 1UEUA 1UFKA 2B9EA 1H72C 1S9GB 1DQ8A 3NGTA 2DYAA 5A2QU 4C98A 4UOFA 2X1AA 1K8AT 1KQGB 2MEWA 3IA0A 3MECA 1U1LA 2HYIB 2YXLA 3LA0A 4FBTA 4ZVGA 1IWAA 1HIYA 1S1TA 1WOOA 3FMBA 3DYAA 1PG5B 2R7SA 2L48A 4A8KA 1TKTB 2VG5B 2J0QD 1JJ4A 3TA2A 3K8WA 4URQU 2E5GA 1NEEA 3UR0A 2MXYA 1X9WA 2HIQA 4OX9F 4GKJF 1S1WA 3W7BA 1VQPS 3R8YA 2XS2A 1ZA1B 3BDEA 3QGPA 2FJEB 3RB4A 2GCFA 1RAAB 2CZ4A 2H54B 4XIUA 3BGFA 3BBCA 3DOKB 2L9NA 1FRHA 3B54A 3CCZA 4G1PA 4H4OB 5KFGA 4Z2XA 2QFJA 1SCJB 2R2TA 4HKQA 3DOMB 2BJEA 1TVRA 1UWBB 3JXOA 1Z2ZA 5KFTA 3OVSA 4EBDA 3R2DJ 1EZZB 5E41A 1GTEA 1JLBB 1UCNA 3GCWP 3QLHA 1FWPA 1N32J 5DQHA 1YKWA 2AJ4A 4FKYA 4CYUA 4LF6J 1G1XA 1RHQB 4WTYA 3BGRB 4DN0A 3H2LA 4LQ3A 3THVA 1N5YA 3ET6B 2HNDB 4ZIVA 1O6XA 5A76A 3JTOA 1TUWA 1HKAA 2FHJD 2P9EA 4Q45A 2R2UA 1UZHA 2ADBA 4ZLPA 4DR4F 2B9WA 3I31A 2YNHB 2CQ2A 1F5AA 2WHOA 2Z56B 4B08A 4F2RA 3TUPA 3AFGA 3UPFA 3HD2A 4RW7B 1RZMA 2F63A 2V2KA 1IKYB 2C2ZB 4M5GA 1JLAA 4I7FB 4NX9A 3GG0A 4E2FB 1BQNB 2LQ8A 2J6TA 3R6LB 4ZN1A 1HD1A 4KO0A 4DCOB 2ZBPA 1XERA 4R25A 1NCLA 3CJKA 1C1BB 1NJYA 4BWJA 5K14B 2CPIA 1B0TA 1QDUB 2V50A 1H2UX 3FUYA 2BW7A 4XDCA 3ZXWA 2UXDJ 2B4UA 3PYDA 3UCGA 1JLEB 3I87A 4NZ6A 5A8WB 2CKWA 4IFYA 4DXLA 2IFXA 4WZQA 2WONA 5F0WA 1AZSA 1RUSA 1IKVA 1SUQB 2QYGA 2IRXA 4KO0B 4E98A 4YMEA 1SC3B 4C8OA 3MOJB 3QJLA 1HBUA 2V8VA 4O3NA 5ETVA 3DHXA 1P9QC 1IBMJ 2UV8A 3OTOJ 3KHHA 2UUAF 1YX2A 4F3QA 4QCLA 2XMWA 2ZZNA 2E5HA 1YVFA 2W9CB 3HJVA 3TNVA 1FKPA 4Q0BA 2DGSA 1VC5A 2CJYB 3CMQA 5D77A 4K2XA 4OZ5A 1KVIA 3I96A 1X4AA 4USIA 4IFVB 2DCUB 2GJIA 2C3PA 2IHR1 3B8HA 5GAEU 3P3DA 1RT1A 4B9VA 1QVFR 4F36A 3S6EA 3QT6A 1HHTP 2M8DB 2LFVA 5B0GA 4FNHA 2CZ9A 4YY3F 4UY8T 2HBQB 2R4FA 3MAQA 3GCXP 3ZZPA 2YWGA 4NL5A 4EYIB 3SQGA 1N36F 1PJ7A 1W7WA 2YNHA 1NH7A 3ONQA 2OLWA 3DRRA 3T19A 1X9SA 5HQ8A 3TZXA 1FJGJ 2QO3A 2RB7A 2CQBA 1FKPB 3MEDB 2VPXB 1UVLA 3HSJA 2VL1A 4KBIA 4B9NA 4USJC 1N88A 2DR8A 1OYEA 1VOMA 2K3KA 3R9LA 2QA4G 1IVZA 2RT3A 2KT5A 3U27A 1P6TA 2ABYA 1V3ZA 2VBWA 3TX0A 4NXMF 2QLBB 5D0GA 1AUDA 4UUWA 5JMNA 4IFYB 2NPFA 5LSOA 3TWZA 1IQZA 3KJVB 5HVGA 2OPPA 4M5DB 1ZAVA 1KP6A 2DNPA 2VG6B 5F9LA 4B3TF 1U1KA 1VJWA 4K8RA 4J7CA 5FLXY 1LW0A 4CLPA 4OL8A 3WIVA 3N0VA 2BACA 5AE3A 3OTCA 2ACYA 5DZ6A 2PDAA 3S7RA 1RT6B 4YB1P 4DR1J 4DS4A 3T5HA 3NNCA 2QL7B 1XMBA 2EWHA 2YKMB 2Z8QA 3BGLA 3UWTA 3M8YA 4B9TA 1R6YA 1X4HA 3HHEA 2D3UA 4J90A 2BA9A 1F60B 2RDDA 3KK3B 1D0EA 4BBYA 1GH8A 1RTJA 4CLUA 4P2FA 4QPTA 3QNWB 1RCXB 2PO4A 3EDRB 2NYHA 1HNZF 4YR0A 1VRUB 1LFPA 2D1CA 2NXJA 4BHQA 5J2MB 1VQKS 3R1HA 3PHEA 4Y34A 4UQTA 1LWEA 2FVPA 3R7SB 1X60A 2OD4A 3O3LA 2XS5A 1HBMB 3ILJA 1Q8IA 1KLMB 2IDEA 2YH1A 1HW8A 2HWTA 3CCLS 2XNRA 2DISA 2C2MB 4X4UA 3F56A 1GXLA 3M8PB 1QTMA 3MMCA 5KFWA 1REVA 3FFIB 2LXIA 3MPDA 4C0HA 1S9EB 3MPVA 2XLKA 2W2MP 2XB2D 1RLDA 3SDEA 3I55S 5AE1A 4TQRA 3RGIA 4MYUA 5I42B 1RT2B 2IC3A 3ITHB 4BLGA 3EPGA 2QV6A 1XIQA 4C11A 2DGXA 2V8HA 2XSFA 3SIPB 2HZAA 1C1CB 2HGNA 3MI7X 4CLFA 4RNOA 1HPZA 4LF4J 1XN9A 3IMQJ 4J9NA 4C4WA 2COLA 3GJTB 4O3QA 2AWZA 1T05B 1CBKA 1IKXA 2JNJA 3W1YC 1VQ5S 1CS4A 1KEKA 4Z37A 1QUPA 4ZJLA 3HKZD 4RW9B 3RTVA 3QLHB 4LF2A 1TL7B 2K06A 4U7CA 1HNVB 5E3AA 1DTQB 4QPXA 3X1LB 3NBPA 4LRCA 4TU7A 3UVJB 1FJ7A 3W5YA 2HS0A 2AF6A 2GMLA 3KTQA 1KFSA 1SV5A 1MLAA 3T5KA 1XK8A 2QRRA 3MPWA 2H65B 4H4KC 1TL3B 1WC4A 1Y3JA 3OTEA 2Y1LB 5L8RC 1VC0A 4C3KA 4FF3A 1T9XA 2UXBF 2DNRA 5E5NA 4PXEA 4DS5A 4I2QA 1Q4RA 1WF1A 4DV7F 1G3OA 1S9FA 1YHQS 1N34F 3TA1A 1RHMB 2YKQA 3GLJA 3PTWA 1FD8A 4DQPA 3V5RA 1TK8A 4JI0J 5L46A 4DL3A 1R8AA 4OZ1A 3HPOA 2IRYA 2FHKA 2MZRA 4K5RA 1VK8A 4F0KA 1S97A 1KWMA 3J80U 3D9BA 4WXOA 5IT9Y 4RJVA 3EMTA 5L1IA 2E5LF 5KG4A 2YKPA 3HVAA 2ZH3A 2ASLA 4RL1A 3FEZA 4X62F 5KG7A 3KK2A 1KSPA 3P49B 5IS2A 1M0SA 1NPKA 1CJUA 3BSNA 3CCSS 5AJ3J 3GZ7A 2RKIA 1H98A 2KXFA 5D4OA 5THWA 3K5LA 2AX0A 1Q5VA 3C14A 2WSEC 4O44A 2AGQA 4CLYA 2BKOA 2HAFA 4NLRA 3NNAA 2YBVA 2D41A 1TL4A 2OPQA 2E5IA 3MD1A 4OX8A 2R42A 3M1VB 2B4OA 2HQ3A 3H90A 2ZUGA 2ZH1A 4DDFA 2XULA 4NI2A 2MZQA 3EUNA 4X84A 3CDEA 3B4MA 4IH7A 3ADAC 3HT3A 5KFNA 4UW2A 3SYZA 2HWHA 1WJ9A 1R8HA 2RE1A 1IBKF 3ZFVA 1YBTA 1G2EA 4ITSA 5ETSA 3HM9A 1RADB 3M8QB 2DTJA 3CO9A 2HBYB 4A8YA 2CAJA 4F25A 4HR2A 3A8JA 4C7QA 4OHZA 2ZE2A 4KFBB 3UDLA 4DZ6A 2ZH5A 1NJWA 1HHSA 1WWHA 3KK1B 2NQPA 3SSSA 3LALA 3M2VA 2LP4A 4OYPA 2IAJA 1E6VB 1V3RA 2FJBB 3CCMS 3QZ7A 5M2PA 3D6HB 4QR0A 5CH7B 2QC3A 4BWMA 3Q22A 2CADA 3R5CA 4DCPB 1VIXA 3LUYA 3N28A 4M5NA 2G1DA 3VHQA 3V4IB 3J7Z5 5H9FK 2MKCA 4N7TA 5LMUJ 1RACB 3UD5A 1M5KC 4ED6A 1F2HA 1Q1KA 4PG7A 3NAHA 3OT9A 4WF9Q 1XNQF 3I0SB 2XI3A 2VB6A 3O44A 4CNZA 4KRWA 2K1RB 1XTZA 2CDRB 1QAXA 1Y5IB 4NLGA 3PKYA 1FEHA 2RQMA 5DGAA 5A8WA 4K4WA 1HFEL 1FJGF 3DKDA 1DURA 4PQAA 4QWBA 1EIYB 2J9CA 2AIRB 4OHWA 4ID5A 1VCTA 4OZ0A 1PSDA 2DHSA 3AJ1A 4J5OA 4C97A 3TUIC 3ISND 3HZGA 3RRKA 2AU0A 4DBQA 4PWDA 1DQ9A 2CNLB 4B9MA 1IN0A 4ZVTB 5CD4H 1SKRA 2E7WA 5CYQB 2UVWA 3NMAA 3N79A 2HQCA 5BYSA 5K8OA 5KFSA 3H98A 2VQFF 3FQKA 3GYNA 3KLIB 3CC2S 3H4BA 2AKWB 2F4VJ 4FYDA 1T95A 3E3XA 1S1XA 2YWFA 5J2MA 4DR5F 3MURP 3UQSA 4C8ZA 3BGRA 4FVCA 4UUXA 1NM2A 3FCWA 1WACA 2EC2A 4HACA 2LQBA 3QIPB 3RB6A 2O67A 5KFIA 1RT5B 2J7WA 4V19J 1YWXA 3ZC4A 1XJWB 3PO5A 4A8WA 1YSJA 1H7WA 2R7QA 3DLLQ 3GFYA 2G1HA 2Q6CA 3DRPB 2FVRA 1SIZA 1RTIB 2KB2A 5G4DA 1CSJA 1RAIB 2DD8S 5D4LA 3UD4P 2AQ4A 3BR9A 4C0BA 3PEJA 1I94F 4F4AA 2UVVA 2GMHA 3PIPQ 3I0SA 2XS7A 3V81A 2CNKB 1U1MA 4PXDA 4RU9A 1R7IA 2FJWA 4OYIA 3FQLA 2CPEA 3ISZA 2OPSA 3IG1A 2OGUA 3Q8YA 4WJBA 3UI3A 1HQEA 3GSIA 3I4PA 4YDXA 4TY8B 3SFUA 5HLFB 2J76E 4P74A 1F9EB 1HWJA 4IO1A 4KR0B 3N5BA 3DRPA 4WP8A 4NMXA 5KFDA 1QAJA 2Z30B 3QWPA 3HP6A 1RAEB 4Y65A 2PE8A 2EFVA 3WIUA 2Y3YA 3RW6A 2WZ1A 1HMVA 1FXRA 1KD1T 2PEHA 2PN6A 3FKBA 3KLFA 2M5YA 1B3TA 1D9FA 4DQRA 4EZ6A 5F8IA 3TJAA 4LR9A 2V2QA 3OR1B 5FDLA 3VAGA 2Q66A 5I3UA 5KG6A 1J5OB 2QA2A 2WW8A 4KE5A 2MJUA 1RTIA 3VV2B 4NCGB 1JXVA 3DI6B 2GO8A 3CCWA 1N5VA 1YRXA 2MQNA 1NZAA 5LM7E 1WI8A 1S1WB 4CLSA 4OI1A 6FD1A 4WTOB 3H5UA 2G0CA 3KLFB 1S57A 2CQIA 4MYTA 1YTYA 2LU2A 2P8IA 4RWXA 4IQXA 2IMOA 1FD2A 3V4MA 4IQMA 1AW0A 3KJFB 3MTKA 2LKZA 3OSNA 2AGOA 1Q81T 3DU5A 2QTWA 2RQKA 4UY85 2Y9HA 4WFZA 2V6AA 4ID5B 4XAKA 3KLIA 3HXMA 2W8LA 4DF8A 3TI0A 1QSYA 1U47A 4AQYF 4K4SA 3NY0A 4OZ2A 2F1FA 4P6QA 2N7YA 3K17A 2WK4A 8RUCA 1U1OA 1ELOA 4DSFA 1RAHB 2JC0A 4Q8EA 1YK9A 2RNEA 1RTHA 5CZXA 4PPDA 3GJQB 4XPCA 2F4FA 5E3PA 3HO1A 1YGYA 3BZQA 3RUBL 4N8NA 2AHOB 3FRZA 3AAWB 5J2NB 2JLGA 2LQ5A 2DHAA 1B0PA 2WSCC 3UN2A 2VJUA 1U0SA 2I1RA 4HI2A 1EP4B 4PAAA 1T9UA 2HGLA 4I69A 3HVTA 1HA1A 4DOZA 3Q23A 1RAGB 2W4DA 1WD6A 4OX7A 2XMAA 1E6YA 5HMZA 2QT7A 2AMCB 3C15A 3QJJA 1UA0A 3JB9k 2DHXA 1U6FA 3MEKA 1RQ0A 2KZMA 3S01A 2P6TA 2WOMA 3ENWA 3MEEA 3P8BB 4OYAA 3MR2A 9RUBA 3IS9A 2OEMA 1Q5YA 4WYWA 2ZBQA 5CXTA 2B7BB 1RU1A 1MN7A 2FJDB 1CJKB 1FRJA 4PWDB 3KLGA 4F4ZA 5B0DA 3E01B 2GNKA 1WHWA 4NXNF 1VRQC 1UWBA 2R7RA 2KHCA 3V4IA 4ECQA 1O51A 4ZITA 4W90B 3M8ZA 2W7OA 3CGIA 4L73A 4TY8A 1J5EJ 3BQ1A 4HYKA 2RAQA 4CO3A 2MPUA 1GXUA 4EEYA 1D1UA 4DQIA 2DK2A 4MIWA 3CC7S 3CO0P 1REGX 1RBOB 1RWMB 1TK5A 4QOTA 5DQGA 1KN6A 1FTRA 1RT7A 4OX6A 1TKDA 4LJMA 3KNAA 3UCZP 2A18A 3FVYA 1X0PA 1SI9A 3H7HB 1T0TV 3L9ZA 2ASDA 4DR3F 3UO0A 1CQMA 3R5AA 4I56A 1R27B 1RWKB 3A4TA 2JRSA 4KGMA 4EUVA 2HURA 2P2CB 1H7XA 2CDQA 4JI5F 1VQSA 2CG4A 4OYZA 4XTTA 4J9MA 1LOUA 2KM8B 2UVRA 4OZLA 4I2QB 3K57A 4ANEA 9ATCB 3DN9A 2HMIA 3UNGC 3DM2B 3HF5A 1F3VA 2IBKA 2HFSA 4A4JA 4QU7A 3C6TB 3U02A 2QA4S 1EETB 1TV6B 2AT1B 5U47A 3FNNA 4JV0A 4ERDA 2RDIA 5D78A 4G1IA 3GQCA 4RBVA 4CM0A 7AT1B 2JWNA 2R7WA 1U1NA 1OY8A 1I94J 3I82A 1CJTB 4WIIA 1OSDA 4J91A 4KHRA 1NKBA 2YPYA 1QAIA 3JSMB 4NLVA 4UTGA 4X4NA 4DG1B 4KGXB 2QGFB 2FUG9 4LT6A 5HANA 1YJ9S 4D3HA 2ERRA 2DRBA 4B9UA 2DT9A 3OTBA 1S99A 4MIBA 2B5JA 4MAKA 3T1YF 5KTQA 1L3VA 1T9VA 3UDCA 4ETXA 2MHEA 1B99A 3HVRA 1X5OA 4OQJA 5G0RA 3UD3P 1NNDA 2Q43A 3G82B 1VHFA 3KUEA 4OYMA 4PABA 3VGSA 3KLEB 1GTHA 3LPEA 1OMSA 2G13A 5AXMA 4X4QA 4FXDA 4KSEB 3I9V9 3TAQA 1N5TA 2I5JB 5KT3A 2D3OR 1X5PA 4DL6A 1JLFB 5F8MA 1R0AA 3A8IA 4F0MA 2R8IA 2YWWA 1F2GA 4ZPBA 4ZP7A 3D6TB 3QT8A 4B9SA 2OSQA 4JI2J 2GS8A 2DKOB 4CH0S 3UR3C 2MQQA 4C0OC 4X4RA 1C4AA 4RW9A 4L6V3 3BB5A 3Q2SC 4B3RF 1KOHA 1NH8A 1RT3A 1DY3A 1OSCA 1VGYA 3DXSX 3U1MA 4O0IA 3PVXA 2PI5A 4QBUA 4B3OA 2VICA 3OSPA 2ROEA 4BS2A 2HFVA 2G2ZA 5HJXA 1MMDA 2J8SA 4DHVA 5KFEA 4ZVRB 2PMHA 1HBMA 3LAKA 2B8PA 3NOCA 4F3MA 4YR2A 2MY7A 3K5PA 1LWEB 1PCAA 1YG0A 2BM0A 3AXKA 2AEFA 4PG5A 4PXCA 5HMXA 1S7HA 2W9CA 2B6AB 3CE8A 3TEGA 4QQBA 1UKUA 4WU3A 1AT1B 3LWMA 1S6QA 4ANDA 3HSGA 4IG3B 1HNXJ 3V6JA 1IBLJ 1SH2A 3MMCB 3F0NA 2FPHX 2LCWA 3HFVA 2N3LA 2BQRA 3QIDA 4H4MB 4BC7A 1F0XA 1UTAA 4IRKA 2HVEA 2ILZA 3W62A 4LIRA 5J1PA 1HNWJ 3BBBA 5HMYA 5KFPA 3H42A 2DGTA 2Z2MA 3DFEA 2RRBA 3IRXB 4MTPA 2CQPA 4UF4A 2GJFA 3ZTPA 3BSOA 4PUOB 1Y5NB 5C24A 5J1NA 5L39A 3MFHA 2Z58B 5HJYA 5LMNF 2X7IA 4HTJA 4U9RA 1RU2A 5HQMA 4ELVA 4CO2A 3W9HA 4FS1A 1ZM9A 2PSZA 3EZUA 2GFFA 1C0TB 3D66A 3SFGA 4JI6F 5BXIA 2XCAA 2X1GA 4M5DA 4JI6J 2BE9B 2UXCJ 2DITA 3S8SA 3IC1A 4DUTA 5IT0A 2FLPA 1W26A 3POTA 5HVHA 3QGIA 2DNYA 4ZCIA 1NO8A 3VALA 3QPIA 3BEGB 5HO4A 2HK2A 4DFKA 2LECA 1YJNS 1IUJA 2ASJA 4ED2A 2NXNA 3PX6A 4LFAF 3M6UA 1WKLA 3HSZA 2KJVA 2WB4A 1GAOA 4J9PA 4WXWA 4PKDB 5GAGI 1M5HA 4USHA 5K8NA 1REVB 1AYEA 1RK8A 3HDSA 4HDHA 1UVKA 4RZRA 3Q8PB 4NCGA 1Y5LB 2F3JA 2MQLA 4LQ9A 3T1HJ 1QVGR 3TVKA 2UU9F 2OJ3A 1GK8A 2UZAA 2ZD1B 3MEGB 2YNFA 4IDKB 1FA0A 2RQ4A 5D4PA 3U1NA 4ECWA 4ZPVR 2A6OA 2DNLA 1VQLS 3NBPB 5ITHA 5DRKA 5DJBA 2VFSA 2KT3A 3R3TA 3TR5A 3ELHA 3H0PA 4KGKA 4AUKA 3BKTA 2JFKA 4TLQA 1XR5A 2AEJA 1HI0P 4OYWA 1RWVB 1WEYA 1T05A 4R5PB 3ULHA 2J9DA 5JVHQ 4KTQA 2EI5A 2DHGA 1AZSB 5HLFA 3IR6B 3JQKA 3CT9A 5A2QY 1PKUA 2H9ZA 4U7UD 3JSRA 3DLGB 3LP2A 3MM7A 1FRLA 1VRTB 1HNIB 1OY6A 2RU9A 3PXGa 5H9EK 1LW2B 1PGZA 2MLXA 3NCRA 3CCRS 5DDRC 2CYYA 3AB4B 5DLFA 4PEOA 4ES3A 3BKUA 3IWNC 1T9WA 3WX4A 1BHNA 4WCEQ 4FN5A 5KG0A 4FS2A 2RQCA 5DETA 2LEPA 1FKOB 4IFVA 1RI7A 3OTDA 1SJRA 2Y8YA 3RW7A 3BKFA 1M5PC 4QIGA 1H2VZ 4KC5A 1LW2A 4ZN3A 2CJ9A 3Q8SB 1KR4A 3HHLB 1WEZA 3QO9B 2AZ1A 3TZYA 5KFYA 1VC6A 3CD7A 1S77D 1HQUB 2D3O1 3R7BB 1Q8LA 2BR0A 4Y3CA 3NGUA 4LRDA 2ZJQQ 1NKEA 4YFUA 1PBAA 2XHWA 3VAJA 4WK1A 2ZHAA 1J27A 3CJQA 4TLRA 2E5LJ 4FF4A 4TYBA 5AT1B 3OQ2A 4K5SA 3EGVA 4P7VA 2DXFA 1AA1B 5M2RA 5DQIA 4A8XA 3OLBA 4KHPJ 1VRTA 2EKNA 2JJ4D 3QRPA 1NXIA 2AJFE 4MH8A 1WC1A 3MMAB 3DOKA 1UETA 4OZJA 1GMUA 1UJ5A 3NS7B 1KDNA 2XZWA 2EPIA 2XQCA 2E44A 2QMWA 1KRPA 4DV6F 1HR0F 2IDLA 2SXLA 3HVWA 4EBCA 4MKBA 1IKVB 1HQUA 1PJ5A 2HG4A 2IYGA 2EW9A 3HZEA 1U8WA 3Q83A 4KGZB 3OL7A 4RUBA 5L1KA 4OI0A 3FK4A 1RCOB 5LOQA 1URNA 1FCAA 1TFYA 4K50A 4HL9A 4CO4A 2ZD1A 3QWUA 2KXHA 2XBPA 3IP0A 5BJRA 2FZCB 3ET6A 3VGUA 2BQ3A 4QR1A 3ZTRA 2L9WA 1M1GA 3CCTA 3PYGA 4Z7CA 1HBOA 1KQSR 3BSCA 2KFZA 1T3OA 1MN9A 2A2DA 5GMDA 2AJQA 3MMBA 3A12A 4IG3A 4NRUA 5C2CA 2CZVC 2HNZB 3MCMA 5J1EA 2B43A 4O23A 5KT7A 4B3RJ 1N32F 1GFWB 2AV5A 3GIIA 5C2GA 4DR2J 4QIVA 2LU1A 3BS9A 4JI8J 5F8JA 4R0EA 4JV5F 1U1PA 1SJ3P 3PKMA 1R0CB 1Z2LA 4ZVOB 5KFRA 5BR8J 2XO7A 2WVFA 5FD1A 4RNHA 4GC6A 3L09A 1FTCA 1Q95G 4PZVA 3EZ5A 4RBTA 2IM0A 4N8OA 4LBIA 4USWA 3PY8A 4JI5J 4QU6A 5DDQC 4CH1A 3ZZOA 3CD5A 3M6XA 3QZ8A 3PZPA 1JJ2R 1BQNA 2AJ0A 2GA7A 3AXMA 4JI7J 1DZ5A 4DL5A 2UV8G 1FJCA 3PNIA 1XNRF 4DUYF 1HNWF 2W2OP 5T14A 1RT4A 5I3QA 2YNGA 3MFIA 3GU0A 4V19X 3NWGA 3C8YA 2FZGB 2DR6A 3AY0A 3BO4A 2FB0A 4JOUA 1I5OB 2OP5A 3D54A 3P5TL 3I56S 3M9MB 4IRDA 2PFFB 2DBBA 4LBHA 2KN4A 2WBMA 4HVZA 2E29A 2DVIA 1V9OA 2L9DA 4OI6A 5LT5A 2KH9A 1R0BG 3NLCA 3CUNA 4LF1A 2R8GA 3KK1A 1NDPA 2VG7B 4ZP6A 2FVSA 2OH2A 2KXNB 2ZHBA 1HHQA 1P1LA 4WFBQ 1AB8A 2CQDA 2J9DE 2OI2A 1VS3A 4N77A 2U2FA 3MWBA 1PO6A 1XMOF 3GONA 1SBRA 2V2ZA 3NXZA 4CWBA 3D3BJ 3FZ2A 2M70A 3BYPA 4RW4B 1SIWB 4O4RA 5E7OB 1WDTA 2GV1A 3NEKA 4Q2MA 4NA1A 1KKHA 2RVJA 2DB1A 3IAS9 3OFFA 4ZMMA 5E0OA 1N5YB 1S0OA 3L7UA 3GG1A 4DMZA 1JLFA 4O3PA 2HVIA 1JIHA 4N76A 3OHAA 2DHHA 4TU9A 2VFUA 4X2BA 4USTA 1RHKB 2BANB 3MUMP 1MWZA 1G4CA 2HFOA 4C6AA 2W2PP 1CJTA 3D68A 4CNYA 1XC9A 3E2EA 3O1LA 3MR3A 2QSWA 3N6LA 2ZH2A 1YITS 1U1QA 2R3VA 4F4XA 4TY9A 1A0OB 1PC4A 5SUHA 3KWMA 3H40A 2DPJA 1S6UA 4RX6A 3RBXA 4FF2A 2ZZMA 1FVQA 4C48A 4B3SF 1YZ6A 3D0HE 5DZ7A 3A1YG 1I6JA 3NNHA 2BOPA 3AT1B 1TKTA 2VG5A 2HFNA 4FP9A 1XWLA 3HHLC 3FCHA 1Y9OA 1R8PA 1RAOA 2X51A 2D74B 3HHDA 4IR1A 2ZBRA 3FCVA 2XEXA 1VQNS 3IO1A 4RW6A 4BCAA 4DFJA 4PQUA 2GC8A 5IZHA 5C25A 2YNIA 4ZVEA 5KG1A 2MQPA 3DDNA 1FRXA 1CQNA 4J37A 4CIOA 4G3IA 1QSSA 2YPZA 2B9XA 1HI8A 3D6FB 1OPIA 3DLKB 4QR2A 5B0BA 5MAOA 5KFJA 3T5LA 2BBEA 3WDOA 1VQYA 5E2QA 2OFHX 5HL7Q 3PFOA 3W9JA 2R9LA 4DV4F 5E33A 1EKRA 2YWHA 4IKAA 1NB2A 1F9HA 1X4FA 2XGQA 4DSEA 2OHDA 2GW8A 2O1PA 1Q78A 3CD0A 4J9UE 4DPYA 5L38A 3SZ2A 2E5JA 1VQMS 3ILOA 1Y7PA 2RRAA 1F5BA 3NRBA 3PYEA 3VZHA 4EO6A 2BKNA 4P2MA 2UUWA 1CJVA 3LH2S 1B7FA 1HLWA 3DM2A 4I0WA 4CO1A 3P5BP 1UW4A 2XY7A 4LF9F 1DQAA 1NLKL 2BVZA 2F7VA 2GHPA 2PD1A 3MF5A 2CQGA 3N6NA 3DDIA 2EBGA 3OR2B 4RR5A 5J2NA 3OXGA 1ITPA 1XMOJ 2Z2YB 1K9MT 2Z4PA 2CXEA 1U6ZA 5I3PA
chains in the Genus database with same CATH topology
1RYSA 1KVJA 5I3UB 4JI3F 4MIAA 3TOQA 5GADU 2CQ3A 5D6GA 3KNGA 1FJEB 1FXLA 1VI7A 3VCDA 2CQHA 2HNZA 3RRGA 2R7OA 1U2FA 2MGZB 2Q79A 2W9BA 2CQ1A 4EU0A 4OIXA 3UCUP 4YB6A 2W25A 3M6WA 2VKZG 1LK7A 3MM8B 3OPKA 2B9YA 4JYAF 2XC9A 4NLTA 1Y0HA 4PCQA 3G6YA 5A0YA 1APSA 3B82A 2VBZA 4W92B 2LEBA 2I5JA 1OIAA 1MMLA 3OXFA 5DM7Q 4JI7F 1S9EA 3KG1A 3GE9A 3QGGA 2DCLA 4OJGA 3JYTA 5ADZA 2LQ9A 3PX4A 1RTHB 4MK8A 1BY9A 4DJBA 3US5A 4OHVA 4EO8A 3FMWA 3KHLA 1PILA 4KT0C 3NGKA 3M2RA 3LO3A 4HHJA 3MUTP 2EG2A 5FIIA 3M6VA 4GO5X 4RUCA 1D9AA 1FVSA 1N56A 2E7XA 1VK3A 1FF2A 3Q0AA 1N6QA 2VA2A 2YNGB 3BM7A 1TUVA 1SL2A 2JX2A 4AL6A 3HHLD 3IG1B 3GYXB 3TW0A 3X3UA 2X1FA 2CRLA 5CYMA 1DHMA 4ZVFA 5A8KA 4K4XA 2GGPB 3O2IA 4WKRA 4J9KA 1UMJA 1CG2A 2YVSA 3UE2A 1NK0A 4F4KA 2CVIA 3DI6A 1YRUA 2E1RA 1U26A 4QWCA 2HHUA 3KJVA 4DFPA 1TKZA 2CPFA 3LAMA 1NK7A 3OR1A 2W4CA 2RUGA 4ZHRB 2ZH4A 2OPSB 2MYFA 1IKYA 4R5PA 2XSJB 1UJ4A 5L9NA 4WFYA 2POKA 1S72S 3DOLA 3THPA 3JTNA 4DL2A 4F02A 2M4MA 2P9CA 2GX8A 4H54A 4ZPDA 2EK1A 2Y1JA 3CCQS 1RT4B 3OUYB 3C46A 4RBUA 1HWUA 3LANA 5D3GA 3MD3A 5T41A 3SQGB 5B7WA 4A48A 1Q16B 1JLBA 3BN4A 3EX7B 4DV5F 3GMGA 2IVYA 1M1KT 3D0GE 5J2PB 2MZJA 3SMZA 4WZMA 1ZTWA 3HHNB 3PIOQ 3S1TA 5HP1B 4LSLB 1KFDA 1K1SA 2D9OA 3MDFA 3M8RA 4OJ3A 1OS5A 4GMKA 3EYZA 4F3OA 1BGXT 1HQEB 1G7CB 1KC8T 3CF5Q 3TAMA 3BSAA 2OTLS 5IWAF 3FZBA 3NMAA 1E6YB 1URRA 5J2PA 2NXUA 3KKFA 4RNNA 1U6BA 2XWXA 4OI2A 1QAYA 3GB0A 1K0VA 1QJHA 2ZBCA 1OQ6A 2PIIA 1UEVA 4QJVA 3MM9A 7FDRA 4JI8F 3I32A 3ICLA 2XMVA 6FDRA 3IN5A 5B0AA 2HHPA 3IFEA 4AYBD 5EX0A 2HQIA 2QIFA 3AB2B 4Y2CA 3RZAA 2I38A 2XY6A 2FGCA 1JLCB 2L41A 1RP5A 2BJDA 3ZZTA 2J0XA 2KYZA 1B0VA 1RJJA 1RT5A 4LF5F 1WNEA 3RYLA 3IBWA 3FEYB 4DX8H 4NCBA 1GX5A 1N6QB 4KKOA 5AXLA 1N54B 5E3QA 3H5XA 2FJAB 1SKSA 1ZETA 4JV2A 1YIJS 4L72B 4X4OA 1S6OA 3OL8A 3T5JA 2ZC3A 3O8WA 4B17A 2ZOFA 4B3MF 1HI1A 3IWXA 5EUHA 4LFCF 3J81Y 3CJ0A 2CQ0A 3T6JA 1LWFA 2EFNA 2JLFA 4O44B 1U24A 3KHGA 2GQCA 1TL3A 2B51A 4Y2MA 1C0UB 5KT6A 1S10A 2FLNA 3CXCR 5DG8A 4X4VA 1V3SA 3N4WA 3KK2B 1E6VA 4A8SA 2AD9A 1J5OA 5HI7A 2VOPA 1NB7A 3PW5A 2J8AA 2JSXA 3ZZYA 1U8SA 3MPYA 2YX7A 2ZBIA 2DH7A 3PV8A 1IQTA 3CJ3A 5KOXA 5KFUA 3V6DB 1ZAXA 3T1AA 4A8OA 4XK8C 1NJZA 1M5SA 2C22A 4ICLA 1D8YA 1TP7A 2VONA 4IUFA 2R7XA 3OVAA 4WE1B 2J7UA 1YJTA 2V94A 2ZNZA 2KFYA 2N82B 3M2VB 4TXSA 2WTFA 3DRYA 2EFQA 3K8VA 1ZM4A 5HN0A 3SCKE 1JLQB 2LVWA 2I0XA 2KJWA 1N52B 4M8LA 3OHBA 1YJWS 2QEXS 3NL0A 2HRUA 4K4ZA 3GIMA 5B09A 3G8TA 5I4MA 3M8SA 4EWTA 2M88A 2WCXA 4OMFG 4YHHF 4NMLA 3SSRA 2W8KA 2BANA 1S4FA 4ECSA 1NK8A 5DG7A 4H4MA 5KFOA 4NLWA 2ZE2B 1OWXA 4KFBA 3TO8A 2OPRB 2W9AA 3I6PA 1S6PB 2VZ9A 3W2VA 5KFKA 3SV4A 4QZVB 2KTQA 4I2PB 3CPWR 4ALZA 2CJKA 1R31A 1Q7LB 1UVIA 5EGYA 4G1QB 5DLGA 1RTDB 3SSQA 1VBZA 3E51A 2NR0A 1FERA 3L7PA 4URGA 3TUJC 1IKWB 4DEZA 1MW7A 3NG8A 3BGUA 3FFIA 3BF4A 1VMBA 2GMJA 2DGQA 5K8MA 1FDAA 1DLOB 2PT0A 1R43A 1X4BA 5C25B 3GSDA 1H38A 4J9RA 1X5SA 3M2UB 2IM2A 2R8JA 4C11B 4LVOP 4UQGA 3P6YC 4QYRA 1ZM3A 1Q53A 4C8NA 5F8HA 4Q44A 4IH5A 3SEOA 4Q5VA 2QMXA 5KFCA 3CIMA 5HBMA 4QIWD 3DXBA 3GR1A 1F9FA 1IKXB 3G9CA 2O66A 4TNOA 1LXNA 2YX1A 2B6AA 2YWEA 3AJ2A 1GQEA 4RW6B 3ENQA 2DGUA 3DMJB 2N3OA 2ZDOA 2YTCA 3G6VA 2B4VA 4ED1A 2GQQA 5EDWA 4OJHA 2NREA 1S0VA 2BQUA 5EHHA 4HH0A 1OPZA 1JLGB 4X4TA 2XLJA 5KT4A 1JLQA 4Q8FA 1RT1B 2MMYA 1SJ4P 2M0GB 2FTRA 4LF6F 3FGVA 4WE1A 5C5JA 5AJ3F 4A8MP 2UVUA 1HARA 1X8DA 3IWLA 2ZFHA 4Y2IA 2CFXA 3DU6A 1HYSB 5LSLA 2Z0GA 3NS5A 1VRUA 3C6UB 1WEXA 1S6PA 1KNZA 3CCVS 1SL0A 2RF2A 2HWIA 2I9SA 1HWKA 3DRRB 2O3DA 3PW0A 4NWBA 2BE2B 2JVRA 1CC8A 2GO9A 3QAUA 2V5HG 4O3SA 3TA0A 1UL3A 5JUMA 5J2QA 5F8GA 3GIJA 2AW0A 4DL0C 2BM1A 2Y0SD 3N01A 3OV7A 2NUHA 5LSRA 2X1BA 4DG1A 3M8PA 4A47A 2RS8A 4KAIA 4KV8B 4NLYA 2GIQA 4BC9A 1VQ9S 1UP1A 4ILMA 2HHXA 5F8NA 3MEDA 1L3SA 2RMLA 3WZ0A 1RTDA 4NLOA 3NAIA 4ES1A 2EC0A 4Q0BB 1ZPVA 1CLFA 4Y00A 3D1QA 4H4KA 4K4VA 2XWYA 1HBUB 2ZC4A 3C66A 1NJXA 1LW0B 3K5MA 5HMWA 2C2EA 4CTAB 2E9RX 3F44A 4X66F 3LP0A 2R7TA 4R0JA 3T3FA 2XGPA 3DOMA 4DLGA 1TAUA 2IM1A 2MSSA 2KU7A 1XR6A 2CQ4A 3NCPA 4ZCMA 5JVGQ 3JSYA 2A10A 4FXVA 1UVNA 5HP1A 2Z2LA 1JJHA 1LQ9A 3MM9B 4U7UK 4GC7A 4OHXA 1D3WA 3THTA 2QLWA 1L3TA 4K4TA 1EP4A 4IH6A 1HBOB 2DH9A 2DNGA 3MHYA 4PWUA 1HNIA 3MMAA 2AGPA 2LA6A 1C1CA 3Q24A 1TK0A 3M4XA 3UW1A 4QIEA 3BDPA 1WF2A 3LW5C 3CULA 4MMOA 1S0MA 4M95A 1SH3A 1N0VC 3VR1A 1GNKA 2Q3PA 2ROPA 1MMNA 1CVJA 1FXDA 1UFWA 4I7FA 2DNQA 3G96A 1TKXA 3H5SA 5KT5A 1BWEA 1JMTA 1WF0A 5D3GB 2DGWA 4Y2AA 1JLEA 4AL5A 4I67A 5K5MA 1N4LA 4UOCA 1N48A 2JEIA 2DR7A 1WTFA 4OLOA 2MQOA 2ZNYA 2MZSA 2LDYA 1LWFB 2OFGX 4M1KA 4JI2F 3M2RB 3WC0A 3OTOF 3HHKA 1O8BA 5GAHI 3V6HA 3FSXA 2WAQD 2HLUA 2XI2A 5F9NA 1LXJA 3DLHA 4N41A 1YJVA 3OL9A 3LP2B 4PPZA 1U45A 3Q8QB 3O6QA 2ZM6F 1BC6A 1H2TZ 4URSA 5LXYA 2B0GA 2K7KA 3M05A 2JOQA 1P8GA 2GHVC 2PMZD 5HROA 3NCQA 4ECXA 3GFXA 1C4CA 3G6XA 2OD6A 3EGNA 1BQXA 4PUOA 4C8KA 2G9OA 4NA2A 3QMQA 5DM6Q 3H20A 3HHLA 3DYAB 4WU2A 2OMOA 4ECVA 2YH0A 4JI0F 1GT8A 3AHPA 4LSNA 1GXTA 2HVHA 1S48A 1R0AB 4OI4A 3MGJA 5DGBA 2CPYA 4ZP8A 2EK6A 4IG0B 2R8KA 4JI1F 3NGDA 1JX4A 2KO1A 3C6UA 5DDOC 2IMWP 3CIZA 3RB3A 2RDJA 3HLUA 1RWUA 1S1UA 2N4DA 2W7AA 3KLEA 2LLZA 2JEGA 3LOUA 3EGWB 1KOOA 1OO0B 1QUVA 1J2VA 3M8QA 2M3DA 4I64A 3CDWA 4IR9A 2W9BB 2DO0A 2D3ZA 1FRIA 2HNYA 3JSBA 2VASA 4K59A 2FD2A 4P2SA 1DARA 2IVMA 1JLGA 2D7SA 3H8YA 4WFNQ 3CMAS 1RYRA 4FBUA 3DLJA 4RNMA 3IXQA 3TARA 2NSCA 5C24B 2U1AA 2JFDA 1UVMA 4NPOA 1S1TB 1DRZA 1Q8BA 2DR9A 1RKIA 2ILYA 2RRNA 3OW2R 1MSWD 2MZ1A 5DG9A 5D8HB 5CZVA 3M30A 2FIUA 3UFCX 7FD1A 5H9EJ 4XPEA 2H5EA 1Y3KA 5B0CA 1ZAWA 4I2PA 1K73T 1DTTA 2BYCA 3LGNA 1S9GA 5IXUA 1T8EA 4Q7AA 2LA4A 3DNCA 2DJWA 2QZ8A 4CH7A 4DR2F 1RA7A 4ZHRA 3GV5B 4HTIA 4RWWA 4TN2A 1KHVA 3DLKA 1NJIT 4QYZJ 1WHXA 2FHOB 1BQMB 3I0RB 3PFEA 1R3NA 2LMIA 1T3NA 4F67A 4K4UA 3CDUA 2CJBA 2F4VF 4MJKA 3VAHA 4K4YA 2OAUA 3TX8A 1LKZA 2VKRA 3CDAA 2RILA 4LUBA 3PO4A 1MU2A 5A6WA 2W4PA 3AQPA 5GMKa 3R27A 5F41A 2Q6BA 2YWKA 1Q86T 1IM4A 2I8EA 2UUBF 2VODA 2BUNA 5A0YB 2HFZA 2YNIB 1S1XB 3LP1A 3EXYA 1H3DA 1JK9B 5T7LB 3H5YA 5KFVA 3BN7A 4OZNA 4EFAC 5KFLA 2KG0A 2RU3A 5IQ6A 3VZIA 4DV1F 3V6DA 3GIKA 2C28A 2VQEF 2PC6A 3KLHB 4MK9A 4PG6A 3KLGB 2RD5C 1WG5A 5CYJA 2DGOA 2MZTA 2HPUA 2RH3A 2ADCA 4ATNA 4IYQA 4HH1A 4OFZA 3V6KA 3G86A 2BXJA 1U1RA 2P5VA 1TL1A 3MAHA 5GAHU 3LWLA 2B4PA 1S0NA 2OIHA 3LP1B 4I6AA 2G4BA 5GADI 4F8RA 3CSKA 1KONA 1RT7B 3J7ZT 4ED8A 4NLDA 5KFXA 4C3MA 4OI3A 1HL6A 4N5SA 4RU2A 1N5SA 4YQWA 4FF1A 4C8LA 4DSKA 4LF4F 3TVZA 2C2DA 3OJUA 2RKIB 1S49A 1SB6A 3Q2TC 1DBDA 3H4DA 3KMQA 2F8HA 3GFZA 2JL9A 1M5OC 1WG1A 4R8UA 3HKWA 4O3RA 2UUTA 4ZPAA 2GHWA 3PEHA 2W24A 4LVNP 5IQQA 3ZZ0A 1LFWA 3AA8A 5C42B 1KS2A 1WG4A 1Q82T 2FHJA 3DLEA 1Y4ZB 4ED3A 4QW9A 3SCJE 2IM3A 2VV5A 4N47A 1H0HB 3N9UC 4OLPA 3JSMA 1HD0A 2C3OA 4X64F 4I6YA 3BO2A 1MWYA 1U2RA 2AYGA 4KJIA 3FRYA 1DFDA 3L95X 4G1QA 4ELTA 1QLNA 3RB0A 4ECUA 3QJPA 3MUVP 1SV5B 5GAGU 4ZPWR 4I1TA 3HK2A 1BD6A 2LDIA 5CHCB 3PACA 2YKAA 1HNVA 1S1UB 3RAMA 2BZ2A 2ZOMA 4CO5A 1YQHA 3I4HX 3QAEA 2J0WA 3CD6S 5J1EB 3ISNC 3H2UB 2MKKA 4IG0A 2FGOA 5IM0B 1Q79A 3SV3A 2ZH6A 4DR7F 2F9DA 3D28A 5BYQA 3MR5A 4LSNB 4ZA1A 4MK7A 2QSFA 4JUZA