2LXLA

Lip5(mit)2
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
163
structure length
163
Chain Sequence
MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associated protein VTA1 homolog
publication title Interactions of the Human LIP5 Regulatory Protein with Endosomal Sorting Complexes Required for Transport.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 56
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 2lxlA00
2LXMA 4TXQA 4U7EB 4TXPA 4TXRA 2LUHA 5H7PA 2RKKA 2LXLA
chains in the Genus database with same CATH superfamily
1JWFA 1MJ0A 3CV0A 2PQRA 5KNGA 4AM9A 4HRMB 3LCAA 3C3OA 4UWKA 5AN8A 1SVXA 2CHZA 2WQHA 3MCXA 4HOUA 3TWXA 4ANUA 4C48B 2VSOE 3PZDA 1A5EA 1NFIE 3IXEA 2QFCA 4K5AB 4LG6A 2HR2A 3F6QA 1QQEA 3HDXA 4FULA 1O1RA 4HI8A 1UG3A 5IY5E 5D0OD 1L5JA 4ANXA 3NF1A 5DIZA 1LD8A 5B3SE 4AVXA 3DXMG 3MGBA 4D10C 1N4SA 1HXIA 3D9LA 3G2TA 1TNBA 4Z68A 4HOSA 2IF4A 3RRUA 5ARGA 3PZ4A 1AWCB 3SBTB 4XKBA 2CHWA 5CEDB 3EUVA 4HI9A 2RKKA 3RSEG 3APCA 5T3RA 3U66A 3ML9A 4ACKA 2WMNA 3L6AA 2R02A 5J90A 3AG1E 1MZCA 1BPOA 3MKQA 3FP3A 1HS6A 4FP7A 4MBGA 2WXFA 5JA4D 1N11A 4FA6A 1SW6A 5D2MC 1GW6A 2XGMA 3T8KA 4CDMA 5KNHD 2WXKA 3ABLE 3BU8A 3ZRHA 4CGVA 4BWRA 4RG9A 2IO2C 3JXIA 2IEJA 2WXJA 3ASDA 1YMPA 3AU4A 4ILHB 3SHFA 3UX4A 3CHOA 4XE0A 2OOEA 2XRYA 5FZRA 1IKND 3HG0D 3JYSA 4UWFA 3VLDA 4M3OA 1A17A 4RLYA 3VTXA 2V0PA 4V3IA 4KBQA 4B93B 3O4ZA 2XZDG 5BXOA 1SA4A 3UMVA 1H2VC 4LRZA 1HX8A 1QZ2A 2WB2A 3AG3E 3SY2A 3KAEA 3MV3B 3V30A 4GTPA 4EQFA 3QARA 5EILA 3GW4A 4X8QA 1FT1A 2KXPC 5AQ9A 3TG5A 3CK8A 1WG0A 2BEDA 3UI2A 4H7XA 3R7RA 4RVBA 5CCLA 3SFZA 4OAUC 4GU5A 2MRIA 2P9UG 3ISMC 3Q5MA 2IQCA 2LXMA 5CRUA 1UN9A 4DX2A 1UJJA 1NA3A 3CKCA 3CEQA 1N95A 2PZIA 5FINA 4CYMD 4JPSA 3SI5A 2WXLA 4O1OA 3MKQB 5JHBA 3FHEA 5HKPA 1D8EA 5BNWA 2GRRB 3MX3A 3FH7A 1FPPA 1W3BA 2DZOA 2QYUA 5CMWA 4QFVA 3LYAA 4JVSA 1QYMA 3L16A 2WQ7A 2VSNA 5LFAA 2WXRA 4NACA 1MYOA 2RD0A 2AJAA 1K3ZD 1PY1A 1E8YA 4OYSA 3LXUX 3L9TA 4DPRA 5KJNA 2P58C 3EHNA 4GYYA 4G11A 3AG4E 3O48A 4JB8P 3LPZA 2PM6A 2V8SE 4LNUD 4FHJA 3NZSA 4J7WA 4DLQA 1KT0A 2DZNA 4A63B 3JCKC 2LXLA 4DRXE 3GYZA 2X6JA 3TXMA 5AQBA 1O1SA 4KXKB 3Q7FA 1H6PA 5EN5D 1OCCE 2BKKB 4LEUA 4U8HA 1OWNA 2PQNA 3ASGA 1N94A 2BF0X 3UQ3A 2OEVA 1HG5A 4B94A 1D9SA 4PS3A 4K5CA 1P5QA 1MX2A 3CVPA 4NIKA 2VGEA 4UQXA 3DXKG 5C1DA 3UPVA 4R7LA 1LTXA 3QDNA 3FU6A 2XS8A 3RIBA 5FWQA 2H6IA 4GTTA 4J8YA 5FJYA 4U04A 3CHPA 3LVRE 2UWJG 3CVUA 2E2EA 4E6HA 3ABKE 4UWLA 4JA9A 3QK0A 3LJ3A 3MKRA 2ZXWE 4I1MA 3T5XA 4HVBA 4KT6B 4ME2A 2DWZA 3LY7A 2B0OE 5CBOA 1Y6IA 4UI9C 1LF8A 4U0SA 3DBSA 3FUKA 5ANLA 2R5SA 3L17A 1Z5SC 3QAQA 2A5UA 2OV8A 1WY6A 5HRYA 2XRZA 4GTMA 3NAWA 2DBAA 3UM3A 3SZ7A 2GRMA 3Q4AB 2VTBA 3QB2A 3Q75A 4J8EA 4NURA 4RSYA 3D9JA 3PREA 1SZ9A 2YHCA 2KBXA 4BESA 3CVWA 4H7YA 1TNZA 1ELRA 3PEUB 5LCWJ 3KSLA 4MRUA 1E8WA 3FEYA 3D9PA 3SO8A 4DK5A 3UUXA 2X6HA 4PUCA 2HE0A 2PM7A 5EKQD 5JHAA 4BX9A 3WG7E 4TRQA 2FI7A 3Q15A 2QYJA 5AYWD 4C9BB 4J0UA 1KZPA 4Q96A 4BERA 1SZAA 4Q69A 4TV3A 3FUJA 2GRPB 4E85A 4ZHBA 4HXIA 4RG6A 2X38A 3B7SA 3QKYA 4M7CA 2R05A 4FU3A 4JL0A 3NQPA 3SBSA 3FTUA 4N3BA 3B7TA 2KC7A 4G2VA 1E90A 5C2YA 3OXGA 3KEAA 2X6KA 3ZPJA 1BI7B 3MZLB 5M72A 1E8XA 3CHMA 1JUQA 3RO2A 4WUYA 3LY9A 5G55A 4U95D 1OCRE 2IJGX 2DYSE 4AXHA 1X5BA 2QZAA 2FULA 1K8KG 3EHMA 4ANWA 3PZ2A 2V4HC 3DSVA 5JJTA 2HO1A 3OTNA 2XCCA 2FBNA 4HORA 2ZU6B 5FQ4A 5ENTD 3JXJA 4NQ0A 4AV7A 2VGYA 2P2CP 4TXRA 3ZU7B 2VTBB 1H19A 3LS8A 3ENEA 3MYVA 3JUIA 1FT2A 4GMLA 2L6BA 4UWGA 5FIOA 4AY5A 3KSQA 4YDYA 1N0QA 3UKRG 4L2YA 3FTXA 3FWVA 3UTMA 4Y6WA 3D3MA 1OWPA 4HOQA 4BFRA 2R17C 4ANVA 4GCNA 2R2LA 2JEKA 5G04J 3DPYA 3DSXA 2DCPA 4ILGA 4F7AA 4BSZB 2FO1E 5AAOA 3FY4A 3CVXA 1ZBPA 4GZCA 3AS8A 2CFUA 4ZFHA 2XZTG 4GTVA 5E76A 4A1GA 1N4PA 1N54A 4LSZE 3PUJA 3ASFA 5JMND 3GZ2A 4WNGA 4G8LA 3LVQE 2Y69E 4WWPA 4G1TA 3Q79A 3EU5A 3FUDA 2NYJA 3UIOC 1S64A 3MEKA 3SD5A 1TJCA 2ETCA 2IOLA 4CCAA 3EHRA 3ASHA 2PNNA 1K1BA 3NOCD 2I1KA 3PZ1A 4N39A 4QQIA 2GRNB 3P2BA 3PRZA 1H0AA 3E4BA 1AP7A 3G2SA 4U7EB 3VLFA 4GTRA 2J49A 2FEZA 2LSUA 1FVFA 3S7JA 2XGSA 3Q9UC 2EINE 1UJKA 3TWTA 4GA0A 1LD7A 1OWMA 2YQ8A 2L9BA 3APFA 4UI9J 1OXJA 2J9QA 2XPIA 3ULQA 4GAAA 4JW1A 5ITZF 4U8VD 2ILRA 5KJLA 3HXFA 2WXGA 2Y0BG 4YDEA 5FQ8A 2F8XK 2FF4A 3RU0A 5EX3A 4EBAA 4HLEA 5LP0A 3TWQA 1MHQA 1IHGA 1S63A 4CT4A 1UN8A 4TXPA 3CQCB 4J6IA 1INZA 3T8MA 3V31A 3PE3A 2X3MA 4GYWA 1H6OA 3J5PA 3EIJA 4CT0A 3SF4A 2JABA 4DX7D 4EZJA 3U9WA 4RQIA 3PVLA 2MYOA 4U07A 4XI9A 4P29A 3Q9NC 4WWOA 3CHSA 1PAQA 1BLXB 1DVPA 4BY6A 5BXUA 4A1SA 2I9CA 2JLBA 2LO6A 2VQ2A 4UQYA 2VSXE 4OAVB 1JCRA 3BG1B 5J08A 4B8CB 4JC8A 2ZIRA 5CECB 3QWPA 3TL5A 3TG4A 2RG8A 1BD8A 2WPVA 4Q94A 2X6FA 5FQ7A 2H6FA 3GZSA 3Q49B 4GMRA 4L9PA 1E7VA 3TAXA 4HBDA 3L82A 4HB5A 4N5QA 3CVYA 1KZOA 1HZ4A 3PE4A 3ZYLA 3CVNA 2J4DA 1IXVA 3CGHA 5FZSA 3IEGA 2IOSA 3G2UA 4F1SA 3ONKA 3ZYKA 4JA7A 2P9LG 1VDYA 3FUIA 4XIFA 2CG2A 4HLLA 2YHEA 4A3VA 4XX5A 4J8DA 4OVVA 4DI4A 4APFA 4EZLA 3B7BA 2XPYA 4F3VA 1WM5A 3G2VA 5A6CA 4PS8A 4I6GA 3AU5A 3L08A 3FTSA 3B95A 3TXNA 2V4LA 3D9KA 3I5PA 4K5BA 4EECA 2WXQA 3TWUA 4AY6A 3HVEA 3QWVA 4G23A 3HXBA 3JUEA 3E30A 2OCCE 5ENNA 4NRHB 3GZ1A 2MOWA 2GRLA 4K03A 1U3CA 4U0ZA 3CIAA 2KCVA 4FC8A 1FCHA 3D9NA 1YYHA 3ZHEA 4PH4B 4TUUA 4IULA 1HU3A 4DX5D 2OVFA 4LCTA 4HNAD 4J8SA 4F6RD 3PS6A 3BUAA 3EU9A 4JHKA 2ZGDA 4KVMA 2AVPA 3C3QA 3IHYA 2HM8A 3FTWA 5D0QD 4G8KA 3B13A 1E8ZA 4U96D 4KZCA 5KJMA 2Y4UA 3MA5A 3U4TA 4YVQC 5CHEE 3RKVA 3UT7A 3QOUA 3BQOA 3DEOA 2GROB 5ENSD 2OEWA 2P9KG 2PL2A 1KT1A 2KATA 2LUHA 5EIBE 4ACLA 3C3RA 3UT8A 4LNBA 2CG3A 3PNLB 2OVBA 4FHKA 2BKGA 3AS4A 1YA0A 3E37A 3ZVVA 5KJKA 1OCZE 1BU9A 1Z6TA 5ARFA 5E75A 3ML8A 1BI8B 4BT9A 5ENRD 4WAFA 1D8DA 4I43A 3TJPA 3OXFA 1SA5A 3RO3A 2R03A 2ETBA 2M63A 5CCMA 5DBKA 3SNXA 3DEPA 4JHJA 3ZYMA 4WNFA 4DX1A 3HVEB 3FUEA 4CGWA 1JCQA 2DVWA 3SQVA 3CSFA 3CVVA 2WVIA 2XPZA 1NA0A 2L0TB 3MJWA 5B1BE 3ZHEB 1MX4A 3L54A 4AOFA 3AJIA 1N4RA 5ENOD 1N0RA 1U2VG 4TUMA 1H6KA 3B7UX 4I1AA 3B7RL 2I2OA 3MV2B 2MHKA 5BW8C 4GMJA 4GTQA 4KZ0A 4WNEA 5HQ8A 1RZ4A 4CEMA 4CZ2D 3URZA 3NB2A 4Y6CA 4U8YD 3IHVA 2WXMA 4KMOA 4O1PA 4JD2G 4YNDA 3TWVA 3VTYA 2C0MA 3FULA 3DSTA 4EHMA 5D66A 5JJ6A 3P1UA 3R7QA 1NI1A 2ETAA 2XHEA 2I1JA 5FQ6A 4FADA 3KS2A 4ATZD 4LERA 4YVOA 4W9RA 1IQUA 1S0PA 3Q47B 4B8AA 4URKA 2C0LA 4J8FA 4OVUA 1NL4A 1NZNA 3ZYQA 2XQ0A 5HS0A 2B6CA 1N4QA 4DLOA 3S2AA 1HH8A 2EIKE 3E33A 4N2QA 1S70B 2IFUA 4N5CA 3UKUG 4N3AA 2X6IA 4B0ZA 1ELWA 4BEPA 3Q7AA 3ASOE 4BT8A 2P9NG 3W9GA 3DPDA 3KD7A 3ZXPA 2H6HA 1HE8A 5AQAA 3AG2E 3EJNA 3Q78A 2C2LA 4XEIG 2J08A 3FH5A 3FH8A 4IRUA 2QC9A 5AJDA 3BG0B 3U64A 3BEEA 3CK7A 3UIPC 2IONA 4UUCA 1UOHA 3PDNA 1NP7A 5A23A 3UXGA 3CR3A 4XKCA 1E7UA 3L13A 4I9CA 3FTVA 1ELKA 2QY7A 5CMYA 3J5QB 1Z3YA 1TN6A 4I9EA 5EDSA 4UI9K 2XEVA 3N71A 2F37A 3CHRA 1SQMA 2V5FA 3LDZA 1TNOA 4GYOA 3FU5A 4I17A 3S7FA 1K1AA 1ZU2A 3D9HA 2RFMA 5BPPA 3CHQA 4HFGA 1IYGA 1N9AA 3APDA 1TNUA 2ZISA 4YDWA 2VGXA 2H6GA 4JXTA 5G05C 2Y3AA 3HXEA 4G26A 3DSUA 3V79K 4L2LA 2ONDA 1OY3D 2KCKA 3Q73A 2BUGA 2L0IA 1HG2A 1QBQA 3IV0A 4G24A 2NSZA 2P9PG 1ZB1A 4DI3A 4AP2A 1YCSB 4GPMA 3KEZA 1O5MA 4GA2A 3AS5A 5BT1A 2XEHA 3FUMA 1E96B 1IHBA 1H2UA 3QNKA 3FU3A 3FUHA 2GGFA 3JQ0A 1FVHA 2AW6A 2VSYA 3ZUVB 4IN3B 2BTDA 2KZTA 4A3TA 3UINC 4F53A 3RRNB 1XNFA 1TN7A 3CSTA 3RK6A 5LCWC 3ULYA 4KVOA 4BTBA 1KLXA 4O6FA 3L22A 2XGOA 2XEEA 4CDRA 3SFYA 2AXUA 3CVLA 3FUFA 2EIJE 3WXXA 1KPSB 3QWWA 3FTYA 3ZN3A 4A55A 5T8IA 4MKTA 4JZYA 4JEHA 4GZ5A 3IKOB 2Y4TA 3LY8A 3DRAA 4C0MA 5A7DB 2DYRE 3T5VA 2J8SD 1Q2ZA 5FT9A 3CKBA 3CQGB 2WM9A 1WDYA 3W9FA 2NC9A 4B89A 5LOZA 2WXHA 3ONLA 4GZ3A 4HOTA 3HYMB 4I6JA 5EYPF 2VGXB 3ESLA 5ENPD 3VLEA 3PZ3A 3IBEA 3HHMA 3RRMB 2P9SG 4PDXA 1N52A 4UWHA 1TEZA 3D9MA 1X81A 1EYHA 1Y8MA 5ANRA 5ENQD 2EIME 1G3NB 3UM1A 2EILE 4N2SA 3ZIMA 3V2XA 2F8YA 3LKUA 2LNIA 4APOA 4AIFA 1OUVA 3HIZA 1V54E 2GRQB 3UM0A 5LX8A 4UQZA 4K0RA 4AEZC 4GZDA 3RAUA 3PEVB 4ATGA 1WAO1 3RJVA 4BTAA 3ABME 3EIQC 2E0IA 1Z3XA 2KZTB 2I6HA 3TWSA 2V5QC 4EBAG 1PC2A 3X2QE 2IO3C 3S7DA 4EPZA 5BV0A 4BSXA 5AJLA 3ULEG 1TJFA 4C0EA 2VJ8A 5G04C 4FJZA 3SFXA 3LJNA 3NOGD 1TN8A 4CRWA 3CLJA 2Q7FA 1RW2A 1DC2A 4L1BA 4WNDA 5AQ7A 3E32A 3I4RB 3ZW3A 5FZQA 2DIWA 2WXOA 4XZ4A 2WXIA 3PH0C 5H7PA 2KM4A 2A5EA 1DCEA 3ZNGA 1OCOE 3ZFWA 2RFAA 2YNQA 1HO8A 1HFAA 5BUZA 5CBNA 3AAAC 4FLBA 2EQXA 3JQ1A 3TWRA 1U3DA 1JPLA 4IYPA 3C5RA 2F0YA 4GB9A 3PNTB 2WXNA 3C72A 1TNYA 1OWLA 4U63A 3OAWA 1DCQA 3U3WA 2A4ZA 3OXLA 5KBAA 5G05J 1JWGA 4GPKA 2WMOA 3I4GA 1H2TC 5FTPA 2GW1A 4O60A 2UY1A 4LNGA 4GZ6A 4U0UA 1B89A 1EDUA 1OWOA 2WXPA 3FDHA 3G2WA 5EIDA 4HS2A 4L23A 2XENA 2WQ6A 4L7TA 5BV1A 3ZKJA 4F1PA 4YDOA 4FLHA 2IU1A 3K9IA 1OT8A 4BETA 3DSWA 5KCMA 2R59A 3R9AB 3ZXSA 4HRNA 4N3CA 2NXPA 4KYOB 5HI7A 4LUNU 1O1TA 5T4YA 1EPUA 5CEAA 3CVQA 4MS6A 3TWWA 4I2ZA 2CFZA 3FEXA 5B1AE 5AENA 4HRLA 2J07A 5EYLA 3S7BA 4I6EA 3HXDA 2L6JA 3ZGQA 3LEWA 3QC1A 3C98A 2AXVA 2HYZA 5G2NA 4WWNA 4XI0A 1V55E 5AARA 4BX8A 3FTZA 5EX0A 3DSSA 4ABNA 3NZUA 4JEUA 2VYIA 5JJ7A 4CDNA 1XGWA 4DX6D 2XCBA 4PS7A 3PUKA 1IQRA 3QJZA 3D9IA 3EHQA 5KWDA 4GA1A 4ILIA 2ZGGA 3V2OA 2XS1A 4HQDA 3ESKA 2YINA 3I3NA 1TR4A 2J09A 3FFLA 5AIJA 2LAHA 3DWLG 1HF8A 2UY1B 2Y1LE 2LSVA 1MQSA 3T9KA 2CHXA 4AJWA 5CRVA 4FJYA 3R9MA 3HRAA 3D9OA 4I2WA 2P9IG 2AXZA 3EDTB 1MX6A 4I1OB 2FO7A 3TGOA 1JCSA 4JHRA 2KCLA 2J4BA 4GTOA 4TXQA 4DJAA 3UM2A 4DUIA 4MLPA 3NBNB 3UT4A 4G25A 1QNFA 3FUNA 2AWIA 1TYQG 1EF1C 3FU0A 2IY0C 3SGHA 3CK9A 4EZKA 3HXCA 3ASNE 5CERB 1DNPA 3ZEFA 4GCOA 1UW4B 2LAIA 4GTSA 3E34A
chains in the Genus database with same CATH topology
2LXMA 4TXQA 4U7EB 4TXPA 4TXRA 2LUHA 5H7PA 2RKKA 2LXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXM A;  4TXQ A;  4U7E B;  4TXP A;  4TXR A;  2LUH A;  5H7P A;  2RKK A;  2LXL A; 
#chains in the Genus database with same CATH topology
 1JWF A;  1MJ0 A;  3CV0 A;  2PQR A;  5KNG A;  4AM9 A;  4HRM B;  3LCA A;  3C3O A;  4UWK A;  5AN8 A;  1SVX A;  2CHZ A;  2WQH A;  3MCX A;  4HOU A;  3TWX A;  4ANU A;  4C48 B;  2VSO E;  3PZD A;  1A5E A;  1NFI E;  3IXE A;  2QFC A;  4K5A B;  4LG6 A;  2HR2 A;  3F6Q A;  1QQE A;  3HDX A;  4FUL A;  1O1R A;  4HI8 A;  1UG3 A;  5IY5 E;  5D0O D;  1L5J A;  4ANX A;  3NF1 A;  5DIZ A;  1LD8 A;  5B3S E;  4AVX A;  3DXM G;  3MGB A;  4D10 C;  1N4S A;  1HXI A;  3D9L A;  3G2T A;  1TNB A;  4Z68 A;  4HOS A;  2IF4 A;  3RRU A;  5ARG A;  3PZ4 A;  1AWC B;  3SBT B;  4XKB A;  2CHW A;  5CED B;  3EUV A;  4HI9 A;  2RKK A;  3RSE G;  3APC A;  5T3R A;  3U66 A;  3ML9 A;  4ACK A;  2WMN A;  3L6A A;  2R02 A;  5J90 A;  3AG1 E;  1MZC A;  1BPO A;  3MKQ A;  3FP3 A;  1HS6 A;  4FP7 A;  4MBG A;  2WXF A;  5JA4 D;  1N11 A;  4FA6 A;  1SW6 A;  5D2M C;  1GW6 A;  2XGM A;  3T8K A;  4CDM A;  5KNH D;  2WXK A;  3ABL E;  3BU8 A;  3ZRH A;  4CGV A;  4BWR A;  4RG9 A;  2IO2 C;  3JXI A;  2IEJ A;  2WXJ A;  3ASD A;  1YMP A;  3AU4 A;  4ILH B;  3SHF A;  3UX4 A;  3CHO A;  4XE0 A;  2OOE A;  2XRY A;  5FZR A;  1IKN D;  3HG0 D;  3JYS A;  4UWF A;  3VLD A;  4M3O A;  1A17 A;  4RLY A;  3VTX A;  2V0P A;  4V3I A;  4KBQ A;  4B93 B;  3O4Z A;  2XZD G;  5BXO A;  1SA4 A;  3UMV A;  1H2V C;  4LRZ A;  1HX8 A;  1QZ2 A;  2WB2 A;  3AG3 E;  3SY2 A;  3KAE A;  3MV3 B;  3V30 A;  4GTP A;  4EQF A;  3QAR A;  5EIL A;  3GW4 A;  4X8Q A;  1FT1 A;  2KXP C;  5AQ9 A;  3TG5 A;  3CK8 A;  1WG0 A;  2BED A;  3UI2 A;  4H7X A;  3R7R A;  4RVB A;  5CCL A;  3SFZ A;  4OAU C;  4GU5 A;  2MRI A;  2P9U G;  3ISM C;  3Q5M A;  2IQC A;  2LXM A;  5CRU A;  1UN9 A;  4DX2 A;  1UJJ A;  1NA3 A;  3CKC A;  3CEQ A;  1N95 A;  2PZI A;  5FIN A;  4CYM D;  4JPS A;  3SI5 A;  2WXL A;  4O1O A;  3MKQ B;  5JHB A;  3FHE A;  5HKP A;  1D8E A;  5BNW A;  2GRR B;  3MX3 A;  3FH7 A;  1FPP A;  1W3B A;  2DZO A;  2QYU A;  5CMW A;  4QFV A;  3LYA A;  4JVS A;  1QYM A;  3L16 A;  2WQ7 A;  2VSN A;  5LFA A;  2WXR A;  4NAC A;  1MYO A;  2RD0 A;  2AJA A;  1K3Z D;  1PY1 A;  1E8Y A;  4OYS A;  3LXU X;  3L9T A;  4DPR A;  5KJN A;  2P58 C;  3EHN A;  4GYY A;  4G11 A;  3AG4 E;  3O48 A;  4JB8 P;  3LPZ A;  2PM6 A;  2V8S E;  4LNU D;  4FHJ A;  3NZS A;  4J7W A;  4DLQ A;  1KT0 A;  2DZN A;  4A63 B;  3JCK C;  2LXL A;  4DRX E;  3GYZ A;  2X6J A;  3TXM A;  5AQB A;  1O1S A;  4KXK B;  3Q7F A;  1H6P A;  5EN5 D;  1OCC E;  2BKK B;  4LEU A;  4U8H A;  1OWN A;  2PQN A;  3ASG A;  1N94 A;  2BF0 X;  3UQ3 A;  2OEV A;  1HG5 A;  4B94 A;  1D9S A;  4PS3 A;  4K5C A;  1P5Q A;  1MX2 A;  3CVP A;  4NIK A;  2VGE A;  4UQX A;  3DXK G;  5C1D A;  3UPV A;  4R7L A;  1LTX A;  3QDN A;  3FU6 A;  2XS8 A;  3RIB A;  5FWQ A;  2H6I A;  4GTT A;  4J8Y A;  5FJY A;  4U04 A;  3CHP A;  3LVR E;  2UWJ G;  3CVU A;  2E2E A;  4E6H A;  3ABK E;  4UWL A;  4JA9 A;  3QK0 A;  3LJ3 A;  3MKR A;  2ZXW E;  4I1M A;  3T5X A;  4HVB A;  4KT6 B;  4ME2 A;  2DWZ A;  3LY7 A;  2B0O E;  5CBO A;  1Y6I A;  4UI9 C;  1LF8 A;  4U0S A;  3DBS A;  3FUK A;  5ANL A;  2R5S A;  3L17 A;  1Z5S C;  3QAQ A;  2A5U A;  2OV8 A;  1WY6 A;  5HRY A;  2XRZ A;  4GTM A;  3NAW A;  2DBA A;  3UM3 A;  3SZ7 A;  2GRM A;  3Q4A B;  2VTB A;  3QB2 A;  3Q75 A;  4J8E A;  4NUR A;  4RSY A;  3D9J A;  3PRE A;  1SZ9 A;  2YHC A;  2KBX A;  4BES A;  3CVW A;  4H7Y A;  1TNZ A;  1ELR A;  3PEU B;  5LCW J;  3KSL A;  4MRU A;  1E8W A;  3FEY A;  3D9P A;  3SO8 A;  4DK5 A;  3UUX A;  2X6H A;  4PUC A;  2HE0 A;  2PM7 A;  5EKQ D;  5JHA A;  4BX9 A;  3WG7 E;  4TRQ A;  2FI7 A;  3Q15 A;  2QYJ A;  5AYW D;  4C9B B;  4J0U A;  1KZP A;  4Q96 A;  4BER A;  1SZA A;  4Q69 A;  4TV3 A;  3FUJ A;  2GRP B;  4E85 A;  4ZHB A;  4HXI A;  4RG6 A;  2X38 A;  3B7S A;  3QKY A;  4M7C A;  2R05 A;  4FU3 A;  4JL0 A;  3NQP A;  3SBS A;  3FTU A;  4N3B A;  3B7T A;  2KC7 A;  4G2V A;  1E90 A;  5C2Y A;  3OXG A;  3KEA A;  2X6K A;  3ZPJ A;  1BI7 B;  3MZL B;  5M72 A;  1E8X A;  3CHM A;  1JUQ A;  3RO2 A;  4WUY A;  3LY9 A;  5G55 A;  4U95 D;  1OCR E;  2IJG X;  2DYS E;  4AXH A;  1X5B A;  2QZA A;  2FUL A;  1K8K G;  3EHM A;  4ANW A;  3PZ2 A;  2V4H C;  3DSV A;  5JJT A;  2HO1 A;  3OTN A;  2XCC A;  2FBN A;  4HOR A;  2ZU6 B;  5FQ4 A;  5ENT D;  3JXJ A;  4NQ0 A;  4AV7 A;  2VGY A;  2P2C P;  4TXR A;  3ZU7 B;  2VTB B;  1H19 A;  3LS8 A;  3ENE A;  3MYV A;  3JUI A;  1FT2 A;  4GML A;  2L6B A;  4UWG A;  5FIO A;  4AY5 A;  3KSQ A;  4YDY A;  1N0Q A;  3UKR G;  4L2Y A;  3FTX A;  3FWV A;  3UTM A;  4Y6W A;  3D3M A;  1OWP A;  4HOQ A;  4BFR A;  2R17 C;  4ANV A;  4GCN A;  2R2L A;  2JEK A;  5G04 J;  3DPY A;  3DSX A;  2DCP A;  4ILG A;  4F7A A;  4BSZ B;  2FO1 E;  5AAO A;  3FY4 A;  3CVX A;  1ZBP A;  4GZC A;  3AS8 A;  2CFU A;  4ZFH A;  2XZT G;  4GTV A;  5E76 A;  4A1G A;  1N4P A;  1N54 A;  4LSZ E;  3PUJ A;  3ASF A;  5JMN D;  3GZ2 A;  4WNG A;  4G8L A;  3LVQ E;  2Y69 E;  4WWP A;  4G1T A;  3Q79 A;  3EU5 A;  3FUD A;  2NYJ A;  3UIO C;  1S64 A;  3MEK A;  3SD5 A;  1TJC A;  2ETC A;  2IOL A;  4CCA A;  3EHR A;  3ASH A;  2PNN A;  1K1B A;  3NOC D;  2I1K A;  3PZ1 A;  4N39 A;  4QQI A;  2GRN B;  3P2B A;  3PRZ A;  1H0A A;  3E4B A;  1AP7 A;  3G2S A;  4U7E B;  3VLF A;  4GTR A;  2J49 A;  2FEZ A;  2LSU A;  1FVF A;  3S7J A;  2XGS A;  3Q9U C;  2EIN E;  1UJK A;  3TWT A;  4GA0 A;  1LD7 A;  1OWM A;  2YQ8 A;  2L9B A;  3APF A;  4UI9 J;  1OXJ A;  2J9Q A;  2XPI A;  3ULQ A;  4GAA A;  4JW1 A;  5ITZ F;  4U8V D;  2ILR A;  5KJL A;  3HXF A;  2WXG A;  2Y0B G;  4YDE A;  5FQ8 A;  2F8X K;  2FF4 A;  3RU0 A;  5EX3 A;  4EBA A;  4HLE A;  5LP0 A;  3TWQ A;  1MHQ A;  1IHG A;  1S63 A;  4CT4 A;  1UN8 A;  4TXP A;  3CQC B;  4J6I A;  1INZ A;  3T8M A;  3V31 A;  3PE3 A;  2X3M A;  4GYW A;  1H6O A;  3J5P A;  3EIJ A;  4CT0 A;  3SF4 A;  2JAB A;  4DX7 D;  4EZJ A;  3U9W A;  4RQI A;  3PVL A;  2MYO A;  4U07 A;  4XI9 A;  4P29 A;  3Q9N C;  4WWO A;  3CHS A;  1PAQ A;  1BLX B;  1DVP A;  4BY6 A;  5BXU A;  4A1S A;  2I9C A;  2JLB A;  2LO6 A;  2VQ2 A;  4UQY A;  2VSX E;  4OAV B;  1JCR A;  3BG1 B;  5J08 A;  4B8C B;  4JC8 A;  2ZIR A;  5CEC B;  3QWP A;  3TL5 A;  3TG4 A;  2RG8 A;  1BD8 A;  2WPV A;  4Q94 A;  2X6F A;  5FQ7 A;  2H6F A;  3GZS A;  3Q49 B;  4GMR A;  4L9P A;  1E7V A;  3TAX A;  4HBD A;  3L82 A;  4HB5 A;  4N5Q A;  3CVY A;  1KZO A;  1HZ4 A;  3PE4 A;  3ZYL A;  3CVN A;  2J4D A;  1IXV A;  3CGH A;  5FZS A;  3IEG A;  2IOS A;  3G2U A;  4F1S A;  3ONK A;  3ZYK A;  4JA7 A;  2P9L G;  1VDY A;  3FUI A;  4XIF A;  2CG2 A;  4HLL A;  2YHE A;  4A3V A;  4XX5 A;  4J8D A;  4OVV A;  4DI4 A;  4APF A;  4EZL A;  3B7B A;  2XPY A;  4F3V A;  1WM5 A;  3G2V A;  5A6C A;  4PS8 A;  4I6G A;  3AU5 A;  3L08 A;  3FTS A;  3B95 A;  3TXN A;  2V4L A;  3D9K A;  3I5P A;  4K5B A;  4EEC A;  2WXQ A;  3TWU A;  4AY6 A;  3HVE A;  3QWV A;  4G23 A;  3HXB A;  3JUE A;  3E30 A;  2OCC E;  5ENN A;  4NRH B;  3GZ1 A;  2MOW A;  2GRL A;  4K03 A;  1U3C A;  4U0Z A;  3CIA A;  2KCV A;  4FC8 A;  1FCH A;  3D9N A;  1YYH A;  3ZHE A;  4PH4 B;  4TUU A;  4IUL A;  1HU3 A;  4DX5 D;  2OVF A;  4LCT A;  4HNA D;  4J8S A;  4F6R D;  3PS6 A;  3BUA A;  3EU9 A;  4JHK A;  2ZGD A;  4KVM A;  2AVP A;  3C3Q A;  3IHY A;  2HM8 A;  3FTW A;  5D0Q D;  4G8K A;  3B13 A;  1E8Z A;  4U96 D;  4KZC A;  5KJM A;  2Y4U A;  3MA5 A;  3U4T A;  4YVQ C;  5CHE E;  3RKV A;  3UT7 A;  3QOU A;  3BQO A;  3DEO A;  2GRO B;  5ENS D;  2OEW A;  2P9K G;  2PL2 A;  1KT1 A;  2KAT A;  2LUH A;  5EIB E;  4ACL A;  3C3R A;  3UT8 A;  4LNB A;  2CG3 A;  3PNL B;  2OVB A;  4FHK A;  2BKG A;  3AS4 A;  1YA0 A;  3E37 A;  3ZVV A;  5KJK A;  1OCZ E;  1BU9 A;  1Z6T A;  5ARF A;  5E75 A;  3ML8 A;  1BI8 B;  4BT9 A;  5ENR D;  4WAF A;  1D8D A;  4I43 A;  3TJP A;  3OXF A;  1SA5 A;  3RO3 A;  2R03 A;  2ETB A;  2M63 A;  5CCM A;  5DBK A;  3SNX A;  3DEP A;  4JHJ A;  3ZYM A;  4WNF A;  4DX1 A;  3HVE B;  3FUE A;  4CGW A;  1JCQ A;  2DVW A;  3SQV A;  3CSF A;  3CVV A;  2WVI A;  2XPZ A;  1NA0 A;  2L0T B;  3MJW A;  5B1B E;  3ZHE B;  1MX4 A;  3L54 A;  4AOF A;  3AJI A;  1N4R A;  5ENO D;  1N0R A;  1U2V G;  4TUM A;  1H6K A;  3B7U X;  4I1A A;  3B7R L;  2I2O A;  3MV2 B;  2MHK A;  5BW8 C;  4GMJ A;  4GTQ A;  4KZ0 A;  4WNE A;  5HQ8 A;  1RZ4 A;  4CEM A;  4CZ2 D;  3URZ A;  3NB2 A;  4Y6C A;  4U8Y D;  3IHV A;  2WXM A;  4KMO A;  4O1P A;  4JD2 G;  4YND A;  3TWV A;  3VTY A;  2C0M A;  3FUL A;  3DST A;  4EHM A;  5D66 A;  5JJ6 A;  3P1U A;  3R7Q A;  1NI1 A;  2ETA A;  2XHE A;  2I1J A;  5FQ6 A;  4FAD A;  3KS2 A;  4ATZ D;  4LER A;  4YVO A;  4W9R A;  1IQU A;  1S0P A;  3Q47 B;  4B8A A;  4URK A;  2C0L A;  4J8F A;  4OVU A;  1NL4 A;  1NZN A;  3ZYQ A;  2XQ0 A;  5HS0 A;  2B6C A;  1N4Q A;  4DLO A;  3S2A A;  1HH8 A;  2EIK E;  3E33 A;  4N2Q A;  1S70 B;  2IFU A;  4N5C A;  3UKU G;  4N3A A;  2X6I A;  4B0Z A;  1ELW A;  4BEP A;  3Q7A A;  3ASO E;  4BT8 A;  2P9N G;  3W9G A;  3DPD A;  3KD7 A;  3ZXP A;  2H6H A;  1HE8 A;  5AQA A;  3AG2 E;  3EJN A;  3Q78 A;  2C2L A;  4XEI G;  2J08 A;  3FH5 A;  3FH8 A;  4IRU A;  2QC9 A;  5AJD A;  3BG0 B;  3U64 A;  3BEE A;  3CK7 A;  3UIP C;  2ION A;  4UUC A;  1UOH A;  3PDN A;  1NP7 A;  5A23 A;  3UXG A;  3CR3 A;  4XKC A;  1E7U A;  3L13 A;  4I9C A;  3FTV A;  1ELK A;  2QY7 A;  5CMY A;  3J5Q B;  1Z3Y A;  1TN6 A;  4I9E A;  5EDS A;  4UI9 K;  2XEV A;  3N71 A;  2F37 A;  3CHR A;  1SQM A;  2V5F A;  3LDZ A;  1TNO A;  4GYO A;  3FU5 A;  4I17 A;  3S7F A;  1K1A A;  1ZU2 A;  3D9H A;  2RFM A;  5BPP A;  3CHQ A;  4HFG A;  1IYG A;  1N9A A;  3APD A;  1TNU A;  2ZIS A;  4YDW A;  2VGX A;  2H6G A;  4JXT A;  5G05 C;  2Y3A A;  3HXE A;  4G26 A;  3DSU A;  3V79 K;  4L2L A;  2OND A;  1OY3 D;  2KCK A;  3Q73 A;  2BUG A;  2L0I A;  1HG2 A;  1QBQ A;  3IV0 A;  4G24 A;  2NSZ A;  2P9P G;  1ZB1 A;  4DI3 A;  4AP2 A;  1YCS B;  4GPM A;  3KEZ A;  1O5M A;  4GA2 A;  3AS5 A;  5BT1 A;  2XEH A;  3FUM A;  1E96 B;  1IHB A;  1H2U A;  3QNK A;  3FU3 A;  3FUH A;  2GGF A;  3JQ0 A;  1FVH A;  2AW6 A;  2VSY A;  3ZUV B;  4IN3 B;  2BTD A;  2KZT A;  4A3T A;  3UIN C;  4F53 A;  3RRN B;  1XNF A;  1TN7 A;  3CST A;  3RK6 A;  5LCW C;  3ULY A;  4KVO A;  4BTB A;  1KLX A;  4O6F A;  3L22 A;  2XGO A;  2XEE A;  4CDR A;  3SFY A;  2AXU A;  3CVL A;  3FUF A;  2EIJ E;  3WXX A;  1KPS B;  3QWW A;  3FTY A;  3ZN3 A;  4A55 A;  5T8I A;  4MKT A;  4JZY A;  4JEH A;  4GZ5 A;  3IKO B;  2Y4T A;  3LY8 A;  3DRA A;  4C0M A;  5A7D B;  2DYR E;  3T5V A;  2J8S D;  1Q2Z A;  5FT9 A;  3CKB A;  3CQG B;  2WM9 A;  1WDY A;  3W9F A;  2NC9 A;  4B89 A;  5LOZ A;  2WXH A;  3ONL A;  4GZ3 A;  4HOT A;  3HYM B;  4I6J A;  5EYP F;  2VGX B;  3ESL A;  5ENP D;  3VLE A;  3PZ3 A;  3IBE A;  3HHM A;  3RRM B;  2P9S G;  4PDX A;  1N52 A;  4UWH A;  1TEZ A;  3D9M A;  1X81 A;  1EYH A;  1Y8M A;  5ANR A;  5ENQ D;  2EIM E;  1G3N B;  3UM1 A;  2EIL E;  4N2S A;  3ZIM A;  3V2X A;  2F8Y A;  3LKU A;  2LNI A;  4APO A;  4AIF A;  1OUV A;  3HIZ A;  1V54 E;  2GRQ B;  3UM0 A;  5LX8 A;  4UQZ A;  4K0R A;  4AEZ C;  4GZD A;  3RAU A;  3PEV B;  4ATG A;  1WAO 1;  3RJV A;  4BTA A;  3ABM E;  3EIQ C;  2E0I A;  1Z3X A;  2KZT B;  2I6H A;  3TWS A;  2V5Q C;  4EBA G;  1PC2 A;  3X2Q E;  2IO3 C;  3S7D A;  4EPZ A;  5BV0 A;  4BSX A;  5AJL A;  3ULE G;  1TJF A;  4C0E A;  2VJ8 A;  5G04 C;  4FJZ A;  3SFX A;  3LJN A;  3NOG D;  1TN8 A;  4CRW A;  3CLJ A;  2Q7F A;  1RW2 A;  1DC2 A;  4L1B A;  4WND A;  5AQ7 A;  3E32 A;  3I4R B;  3ZW3 A;  5FZQ A;  2DIW A;  2WXO A;  4XZ4 A;  2WXI A;  3PH0 C;  5H7P A;  2KM4 A;  2A5E A;  1DCE A;  3ZNG A;  1OCO E;  3ZFW A;  2RFA A;  2YNQ A;  1HO8 A;  1HFA A;  5BUZ A;  5CBN A;  3AAA C;  4FLB A;  2EQX A;  3JQ1 A;  3TWR A;  1U3D A;  1JPL A;  4IYP A;  3C5R A;  2F0Y A;  4GB9 A;  3PNT B;  2WXN A;  3C72 A;  1TNY A;  1OWL A;  4U63 A;  3OAW A;  1DCQ A;  3U3W A;  2A4Z A;  3OXL A;  5KBA A;  5G05 J;  1JWG A;  4GPK A;  2WMO A;  3I4G A;  1H2T C;  5FTP A;  2GW1 A;  4O60 A;  2UY1 A;  4LNG A;  4GZ6 A;  4U0U A;  1B89 A;  1EDU A;  1OWO A;  2WXP A;  3FDH A;  3G2W A;  5EID A;  4HS2 A;  4L23 A;  2XEN A;  2WQ6 A;  4L7T A;  5BV1 A;  3ZKJ A;  4F1P A;  4YDO A;  4FLH A;  2IU1 A;  3K9I A;  1OT8 A;  4BET A;  3DSW A;  5KCM A;  2R59 A;  3R9A B;  3ZXS A;  4HRN A;  4N3C A;  2NXP A;  4KYO B;  5HI7 A;  4LUN U;  1O1T A;  5T4Y A;  1EPU A;  5CEA A;  3CVQ A;  4MS6 A;  3TWW A;  4I2Z A;  2CFZ A;  3FEX A;  5B1A E;  5AEN A;  4HRL A;  2J07 A;  5EYL A;  3S7B A;  4I6E A;  3HXD A;  2L6J A;  3ZGQ A;  3LEW A;  3QC1 A;  3C98 A;  2AXV A;  2HYZ A;  5G2N A;  4WWN A;  4XI0 A;  1V55 E;  5AAR A;  4BX8 A;  3FTZ A;  5EX0 A;  3DSS A;  4ABN A;  3NZU A;  4JEU A;  2VYI A;  5JJ7 A;  4CDN A;  1XGW A;  4DX6 D;  2XCB A;  4PS7 A;  3PUK A;  1IQR A;  3QJZ A;  3D9I A;  3EHQ A;  5KWD A;  4GA1 A;  4ILI A;  2ZGG A;  3V2O A;  2XS1 A;  4HQD A;  3ESK A;  2YIN A;  3I3N A;  1TR4 A;  2J09 A;  3FFL A;  5AIJ A;  2LAH A;  3DWL G;  1HF8 A;  2UY1 B;  2Y1L E;  2LSV A;  1MQS A;  3T9K A;  2CHX A;  4AJW A;  5CRV A;  4FJY A;  3R9M A;  3HRA A;  3D9O A;  4I2W A;  2P9I G;  2AXZ A;  3EDT B;  1MX6 A;  4I1O B;  2FO7 A;  3TGO A;  1JCS A;  4JHR A;  2KCL A;  2J4B A;  4GTO A;  4TXQ A;  4DJA A;  3UM2 A;  4DUI A;  4MLP A;  3NBN B;  3UT4 A;  4G25 A;  1QNF A;  3FUN A;  2AWI A;  1TYQ G;  1EF1 C;  3FU0 A;  2IY0 C;  3SGH A;  3CK9 A;  4EZK A;  3HXC A;  3ASN E;  5CER B;  1DNP A;  3ZEF A;  4GCO A;  1UW4 B;  2LAI A;  4GTS A;  3E34 A; 
#chains in the Genus database with same CATH homology
 2LXM A;  4TXQ A;  4U7E B;  4TXP A;  4TXR A;  2LUH A;  5H7P A;  2RKK A;  2LXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...