2LXLA

Lip5(mit)2
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
163
structure length
163
Chain Sequence
MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of the Human LIP5 Regulatory Protein with Endosomal Sorting Complexes Required for Transport.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Vacuolar protein sorting-associated protein VTA1 homolog
total genus 56
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 2lxlA00
2LXLA 4U7EB 5H7PA 2LUHA 2RKKA 4TXPA 2LXMA 4TXRA 4TXQA
chains in the Genus database with same CATH superfamily
1V55E 2E0IA 5ENNA 2XRYA 1IXVA 3QDNA 4TXPA 1N4PA 3SD5A 5JHAA 3FEXA 2LSUA 3FU5A 4YNDA 3CHSA 3FWVA 3PRZA 5BXOA 3AU5A 1UN8A 2WXQA 3ZHEA 4FHJA 4XIFA 4W9RA 2WMOA 5EX3A 3JXJA 2X38A 2VGEA 3KS2A 4BSXA 4OAVB 1TNBA 5A23A 2V5FA 3B7UX 2VSNA 3T8KA 3U4TA 1S64A 4I6GA 3L54A 3RO2A 4NURA 2OEWA 5T4YA 3O48A 1E8YA 4U07A 4P29A 2IU1A 4UQYA 5AARA 4F6RD 5BPPA 1YYHA 3AS4A 2DZNA 4K03A 1E8XA 2I1KA 5ENQD 3Q47B 5H7PA 2XEHA 2PNNA 3L16A 2ZIRA 4GTTA 4ILHB 2NC9A 2XGMA 3L9TA 2F8XK 4ZHBA 4AIFA 4DI4A 4N3AA 4UWHA 5EIDA 4A55A 1YA0A 4DJAA 2KZTA 4JB8P 1BPOA 2IO3C 4DRXE 3B95A 2P9UG 3TWWA 2F8YA 2DVWA 1TNYA 5KJNA 1HXIA 2CHXA 3G2UA 4GMJA 2XZTG 4GZDA 3FUIA 4RG9A 2IO2C 4HXIA 4AY6A 5D2MC 3CVNA 3BU8A 3E37A 3TG4A 3CQCB 4GB9A 5KJKA 1OCCE 2XS1A 4RSYA 3CLJA 3GW4A 4I9EA 2R2LA 3J5QB 2VTBB 1N95A 2VSOE 3ULEG 2WQ7A 3CR3A 1FT2A 5T3RA 3KEZA 3T9KA 2QYUA 2IFUA 4GTMA 4GTVA 1NP7A 3V2OA 5ARFA 3RRNB 3U64A 3DEPA 3HDXA 3ZGQA 3JQ1A 4AM9A 1HF8A 2QYJA 4HB5A 5ENOD 4JZYA 3Q75A 4Q69A 1SW6A 4KZ0A 2MRIA 1BU9A 1O1TA 3EDTB 2PZIA 3EU5A 1U3CA 4GAAA 3UT4A 4XEIG 3DSWA 4HLEA 1UJJA 2LAHA 2XPZA 5D0QD 3KD7A 3HVEB 1G3NB 4I43A 5FT9A 4DPRA 3PEUB 3APDA 5E76A 4DX7D 3ABLE 4FADA 4A3TA 1LD7A 5G05J 3FU3A 4HI9A 1TR4A 4OVVA 1UJKA 1S63A 2J4DA 2NXPA 3KEAA 1DNPA 4I1AA 2LNIA 3PE3A 3I3NA 2DYRE 2P9LG 3P2BA 4O6FA 3ZKJA 3MZLB 2ZXWE 5ENPD 4AV7A 3V2XA 5AQ7A 4DX6D 2V0PA 2DYSE 2KCLA 4AOFA 4JHJA 4GTQA 4EHMA 3MA5A 4LERA 1EPUA 1OWOA 5IY5E 4CGWA 3NQPA 1IKND 4EECA 4MS6A 2NSZA 2IQCA 2ZISA 4RQIA 4TXRA 4JHKA 4N2QA 3SF4A 4G2VA 1OT8A 4IULA 5CMWA 1KPSB 3G2SA 3RSEG 1TN7A 2LXLA 5G55A 3AG2E 3UUXA 2VYIA 1QBQA 3K9IA 4GTOA 4GZ6A 4PS7A 3SY2A 3GZ2A 5FQ6A 1OCOE 4LRZA 1ZB1A 1WG0A 3FH8A 1JWGA 5HKPA 4CDRA 2UY1B 1SQMA 4U96D 4YDOA 2BKGA 1L5JA 4YDWA 2Y4UA 2V4HC 1FCHA 2CG3A 5EYPF 2OCCE 3HG0D 3HVEA 4L9PA 1ZU2A 2WXRA 3SGHA 3ZUVB 4OAUC 3ASHA 2GRRB 3ESKA 5CBOA 3OTNA 3JCKC 3SI5A 3DWLG 2XRZA 4E6HA 2Q7FA 2X3MA 3F6QA 4GU5A 1INZA 3NBNB 3BQOA 3AG1E 3QWPA 4FJYA 3ULYA 4UI9J 1IHGA 4FLHA 3W9FA 1H2UA 4TRQA 5FINA 3PE4A 3DSUA 4MLPA 1K1AA 3IEGA 4XI9A 4J6IA 2B0OE 3VLEA 3CK7A 1OUVA 4LCTA 2CHZA 4L23A 1RZ4A 4KZCA 3ASDA 3ZYQA 4FA6A 2ETAA 4OYSA 3C3OA 3CHOA 2FBNA 1HE8A 2PL2A 2RFAA 3WG7E 4B94A 3LY8A 2I9CA 4NIKA 1ZBPA 3ASOE 2YQ8A 1MYOA 4BERA 4C0EA 1QZ2A 2C2LA 4F53A 5AN8A 2MYOA 3FDHA 2PM6A 4A3VA 4GZ3A 3B7RL 2WXGA 2WXOA 2UWJG 3CHQA 3LXUX 2MOWA 3AAAC 3Q7AA 2QC9A 4AXHA 3G2TA 3C3RA 4PH4B 5CBNA 1WDYA 3UM1A 1OWPA 5ANLA 3ONLA 1DC2A 3CV0A 4PS8A 4I2WA 4ANVA 2EIKE 1NFIE 2KZTB 3SZ7A 2KCKA 4EBAG 2DWZA 5JJ6A 4I6EA 4AY5A 3Q78A 4XX5A 2H6HA 3FFLA 1ELWA 2Y1LE 2YHCA 2F37A 4EPZA 4IN3B 4UUCA 2P9NG 2ILRA 2L6JA 5CRVA 2RKKA 3MEKA 1NI1A 1O5MA 3PZDA 5EIBE 2GRPB 4ZFHA 4HRNA 1X5BA 2BKKB 1JCQA 3HXDA 3SFXA 5ENRD 1E90A 3R7QA 2GROB 3DXMG 4CEMA 3S7FA 1KZPA 1AP7A 3IKOB 4HLLA 3L13A 3L17A 2LXMA 2XZDG 5DBKA 1U3DA 5D0OD 4JVSA 3L82A 3HXFA 3ZHEB 1SZAA 3FUKA 4JW1A 4G23A 2OEVA 3HXBA 3ZXSA 3ZIMA 4UWKA 2AW6A 3QNKA 4U8YD 4HBDA 4BWRA 2X6FA 1EF1C 1TNUA 1MJ0A 2GRQB 3MV3B 2EILE 2R02A 3TWXA 4J8SA 5LCWC 1N4SA 3SBTB 4APFA 3UINC 4GCOA 4LUNU 3MKQA 2WVIA 4N39A 2WXMA 4CDNA 4N5CA 2MHKA 1DCEA 2ZGDA 4ATZD 3B13A 4L2YA 3MKRA 4GPMA 1NL4A 4AJWA 4U63A 1TN8A 3ABME 2WXKA 2KBXA 4OVUA 2GGFA 1TNZA 4KYOB 3FY4A 3RIBA 4BEPA 4ANUA 3T5XA 2FO1E 4L2LA 2GRLA 5CMYA 3SFZA 2XCBA 4CYMD 2I1JA 5ENSD 2A4ZA 3ZXPA 3MGBA 2JLBA 1N4QA 4JA7A 4GZ5A 4HORA 1E8ZA 2X6JA 3ZU7B 1N52A 5G04C 2V4LA 3AS8A 3L22A 4N5QA 4A1SA 3C98A 4EZKA 3ML8A 4NRHB 3E32A 3FU0A 2CG2A 2EQXA 1NA0A 1SZ9A 4WUYA 2WB2A 5AQ9A 1LTXA 1P5QA 3E33A 1MX6A 4I1OB 2HYZA 2XQ0A 1HG5A 3Q9UC 1YMPA 3CVPA 4DK5A 3PEVB 2WXIA 4FU3A 3TG5A 3LEWA 1UN9A 2H6FA 4GA2A 4ILIA 5HQ8A 3D9JA 2WXPA 4H7XA 4C9BB 1Z3YA 2F0YA 5HRYA 2P2CP 3T5VA 5CEAA 4GTRA 5C2YA 3LJNA 1MHQA 4K5CA 2OVFA 5EKQD 2L0IA 1WY6A 2VGXA 2IOSA 4GMRA 1N0QA 2RG8A 3AS5A 5D66A 1FT1A 2GRNB 3ZN3A 3CVUA 2E2EA 1E7UA 4L1BA 3R7RA 4M7CA 3EHRA 4J8DA 4B89A 4B8CB 5CEDB 2EIJE 3CHRA 4V3IA 5AQAA 5ANRA 4Q96A 3FTUA 2QY7A 3URZA 1KT1A 3UIPC 2A5UA 1E8WA 5JJTA 1SA5A 1VDYA 3E34A 3D9IA 3AG3E 1TJFA 1XNFA 1E96B 4N3CA 5JMND 3FUNA 4JEUA 1QYMA 2A5EA 3TWVA 3HHMA 1OWLA 4QFVA 3FUJA 2C0LA 3RU0A 4G8LA 2DCPA 3DXKG 4QQIA 4L7TA 3IV0A 4FULA 3JYSA 3JUEA 2AXZA 3KSQA 3PNLB 5JHBA 1IQUA 5FJYA 2FEZA 2PQRA 2XPIA 4HOSA 5J08A 5J90A 3UX4A 3MX3A 3GZSA 1MX4A 4U95D 3C72A 4XE0A 4FC8A 3OXGA 1K8KG 1V54E 2I2OA 4UI9K 5AQBA 3UKUG 3Q7FA 5CHEE 4BTBA 2RFMA 1LD8A 2AXUA 3EU9A 4HRMB 4HQDA 4GTSA 2LSVA 2XGOA 4F1PA 5HS0A 3D9OA 3GYZA 4XI0A 1BI7B 5C1DA 3N71A 2VQ2A 1UW4B 3LPZA 3ZYMA 1BD8A 2WXHA 4KVMA 3R9MA 1B89A 4HRLA 4HI8A 3HXEA 3SFYA 3FUDA 3V79K 2YNQA 3BEEA 3UT8A 3LVQE 3PZ4A 5EDSA 4DUIA 3RO3A 2CFZA 5EYLA 2OVBA 3LYAA 3ZNGA 3ZYKA 1UOHA 2R17C 1A5EA 1WM5A 3UTMA 3RRUA 3W9GA 1FVFA 3CVVA 1FVHA 3ZW3A 4UWGA 1PC2A 3UPVA 2X6KA 3CSFA 3I4RB 3EUVA 3D9MA 1Q2ZA 3VLFA 4R7LA 4N2SA 5KBAA 4PDXA 3UIOC 2AVPA 4I1MA 2WXFA 5FQ8A 2LO6A 4DLOA 2VSXE 3EIJA 2YINA 4GYYA 5BV0A 1NA3A 5BNWA 4HOUA 4CGVA 1GW6A 3Q49B 4JXTA 2XGSA 5LCWJ 3LCAA 4U8HA 2VSYA 1EDUA 2XEVA 5AYWD 4N3BA 4E85A 2EIME 3FP3A 3G2WA 4EZJA 1HU3A 5G04J 3S7BA 2P58C 3CIAA 3FTWA 2IJGX 3Q73A 3D9PA 3LY7A 1EYHA 3SO8A 4CT0A 3OAWA 4FLBA 4DI3A 4JPSA 4BT8A 4PS3A 1Z5SC 4BETA 4X8QA 1HFAA 1HS6A 3UI2A 4F1SA 2P9PG 3LJ3A 3TGOA 2WMNA 3B7SA 1Y8MA 3FEYA 1A17A 4EZLA 1H19A 3SBSA 3CQGB 4BT9A 3QOUA 3Q15A 3LY9A 3QC1A 3ZEFA 3L08A 4APOA 3TXNA 4J8FA 1Z3XA 1H6PA 5KNHD 4U04A 4U0ZA 2L9BA 4XKBA 3PVLA 3QAQA 1X81A 3RKVA 4JD2G 3EHQA 3FUEA 1HX8A 3HYMB 1HZ4A 3D9KA 4J8YA 4K5BA 3QKYA 3KSLA 4KBQA 3ML9A 3UKRG 2FULA 3Q4AB 1MX2A 3ESLA 2H6GA 4IYPA 5DIZA 1TNOA 1S0PA 3ASGA 3JUIA 4WWNA 2DBAA 4GCNA 3UT7A 2R03A 5LP0A 3Q79A 5KWDA 1PAQA 1RW2A 2HO1A 1N94A 1OWMA 3PDNA 2XHEA 4C0MA 4J8EA 4ABNA 3B7TA 4MKTA 5FWQA 3FH5A 3CVQA 4LNUD 4MBGA 4KMOA 2KATA 2IOLA 3E4BA 5FQ7A 3ENEA 3G2VA 4WWPA 4G25A 3SQVA 2GRMA 3IHVA 5ARGA 4U7EB 3APFA 3T8MA 2HM8A 1ELKA 2Y3AA 5A7DB 2Y69E 4Q94A 2VJ8A 4BX8A 1O1RA 2L0TB 4J0UA 3L6AA 3FTVA 5ENTD 4UWLA 3UM0A 4B93B 1LF8A 3CSTA 3TJPA 3WXXA 4LNBA 2PM7A 4ATGA 3FU6A 5T8IA 2J07A 2BTDA 3PUKA 4U8VD 1SA4A 3AU4A 3V31A 5LFAA 5JA4D 4D10C 3J5PA 2V5QC 3TL5A 3LKUA 4GMLA 4M3OA 1N11A 3E30A 2QFCA 3P1UA 4AEZC 2J49A 1JCRA 4GA0A 4BX9A 1O1SA 3FULA 5FQ4A 3U66A 3D3MA 3DPYA 4I6JA 4UWFA 4UQZA 2Y4TA 5KJMA 4YDEA 1MZCA 4I2ZA 4G24A 4PUCA 3EIQC 2WQHA 3HIZA 4LSZE 1S70B 3D9HA 4A63B 5AJLA 1OXJA 3AG4E 4JEHA 2FF4A 2V8SE 1K3ZD 5LX8A 5EN5D 3EJNA 2BEDA 3ONKA 5AIJA 2L6BA 2X6HA 2BF0X 3BG0B 2P9SG 4KXKB 5EILA 4F3VA 3DEOA 4LEUA 1JPLA 1BLXB 3OXFA 1HG2A 3ASFA 2C0MA 5A6CA 2EINE 4GYWA 3CGHA 4Y6CA 3DBSA 3HXCA 4WNGA 5BT1A 3DPDA 4O1PA 3U9WA 3S7JA 2I6HA 3MV2B 2QZAA 4JA9A 1H0AA 4WWOA 5CRUA 4WNFA 2KCVA 5CCLA 3VLDA 4YDYA 4G8KA 2WPVA 1HO8A 3O4ZA 2J08A 2R05A 3GZ1A 4HOTA 2FO7A 4WNEA 4BESA 2ETCA 3EHMA 4FHKA 3ZPJA 1H2VC 3C3QA 4RG6A 3TWSA 1AWCB 2XEEA 3S7DA 2XENA 2DZOA 4XKCA 1D9SA 4YVQC 1WAO1 5BXUA 4KVOA 3JQ0A 4BY6A 5BV1A 2HR2A 2UY1A 5EX0A 3RAUA 3DSSA 4G11A 3ZRHA 2R59A 2IF4A 3QWVA 5BUZA 3FTXA 1OWNA 2XCCA 1QNFA 3ZYLA 3IXEA 3QARA 1IYGA 4JC8A 2P9KG 3NAWA 3FTZA 1H6OA 4F7AA 4GTPA 2VTBA 2VGXB 1QQEA 3EHNA 3LVRE 5KJLA 3B7BA 4AVXA 2VGYA 3TXMA 5BW8C 4EQFA 2Y0BG 3PS6A 3MCXA 4O1OA 3X2QE 4CCAA 3U3WA 1KZOA 4J7WA 4LNGA 5KCMA 2IY0C 3JXIA 1TEZA 2AWIA 3QB2A 3RRMB 3R9AB 3NB2A 4URKA 2KM4A 3NOCD 1N54A 4HS2A 1JUQA 3SHFA 3D9LA 3APCA 4CDMA 1IHBA 2NYJA 3TAXA 2ZU6B 3VTXA 5AENA 2KC7A 3LDZA 3QJZA 4EBAA 1Z6TA 2WXJA 3DRAA 2H6IA 5B1AE 5B1BE 3NF1A 3TWUA 3CKBA 3QWWA 4ACLA 3PUJA 4HOQA 4LG6A 1OCZE 2OOEA 3IBEA 4O60A 3UM3A 2JEKA 2M63A 2DIWA 2J8SD 3CHPA 2KXPC 1E7VA 1Y6IA 4AP2A 4RVBA 2AXVA 4A1GA 4CT4A 4KT6B 3MJWA 1N9AA 3S2AA 5E75A 4G1TA 5HI7A 3FH7A 4H7YA 3CHMA 1JWFA 3BG1B 1H2TC 3KAEA 5LOZA 3MYVA 5JJ7A 4HVBA 1K1BA 2B6CA 3RJVA 2JABA 2XPYA 2YHEA 5ITZF 5M72A 2X6IA 3CVXA 3DSTA 3ZFWA 2WQ6A 2WXNA 1N4RA 5FZSA 5FZRA 3CVYA 4K0RA 1SVXA 3OXLA 3UMVA 4ANWA 1BI8B 4DX5D 3PNTB 3HRAA 4K5AB 5B3SE 4JL0A 4GPKA 2BUGA 3PZ2A 4UQXA 4BFRA 2J9QA 3UM2A 4DLQA 3FTSA 3NZUA 4CZ2D 4MRUA 1NZNA 4JHRA 1H6KA 3ISMC 3Q9NC 3UQ3A 2IONA 4BTAA 3ASNE 4WAFA 2ZGGA 4BSZB 3V30A 1N0RA 4Z68A 1JCSA 4I9CA 3TWQA 4TV3A 3PZ3A 3DSXA 2CHWA 1PY1A 3NZSA 4NQ0A 3TWTA 5AJDA 4I17A 1YCSB 2R5SA 4YVOA 4C48B 5FIOA 4GYOA 4ANXA 3LS8A 2AJAA 3CKCA 4HFGA 4XZ4A 2LAIA 3FUMA 3FUHA 4DX1A 5CECB 3PREA 1TYQG 3IHYA 2J09A 3DSVA 2OV8A 5G2NA 5G05C 4TUMA 2RD0A 1TJCA 5FZQA 4GZCA 3Q5MA 1MQSA 1FPPA 4B0ZA 2XS8A 3I5PA 4NACA 1U2VG 3BUAA 1W3BA 1XGWA 3QK0A 1OCRE 1ELRA 1DCQA 1OY3D 3ZVVA 2J4BA 4WNDA 3CK9A 3RK6A 2FI7A 3MKQB 3CVWA 3D9NA 3PZ1A 4FP7A 3CEQA 2WM9A 2GW1A 4U0UA 3SNXA 3CK8A 2PQNA 5CERB 3TWRA 4HNAD 1D8EA 5KNGA 3FHEA 3UXGA 3I4GA 1KT0A 3ULQA 4G26A 3VTYA 3C5RA 4GA1A 5AAOA 2IEJA 3ABKE 4B8AA 4ME2A 3AJIA 3FTYA 1IQRA 1UG3A 1D8DA 2ONDA 1TN6A 5FTPA 1DVPA 3NOGD 2ETBA 2LUHA 4UI9C 4FJZA 2CFUA 4RLYA 1HH8A 4ILGA 4U0SA 4IRUA 4Y6WA 3PH0C 3CVLA 4TXQA 3FUFA 1KLXA 5CCMA 4ACKA 4CRWA 2HE0A 2P9IG 4DX2A 2WXLA 4TUUA
chains in the Genus database with same CATH topology
2LXLA 4U7EB 5H7PA 2LUHA 2RKKA 4TXPA 2LXMA 4TXRA 4TXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXL A;  4U7E B;  5H7P A;  2LUH A;  2RKK A;  4TXP A;  2LXM A;  4TXR A;  4TXQ A; 
#chains in the Genus database with same CATH topology
 1V55 E;  2E0I A;  5ENN A;  2XRY A;  1IXV A;  3QDN A;  4TXP A;  1N4P A;  3SD5 A;  5JHA A;  3FEX A;  2LSU A;  3FU5 A;  4YND A;  3CHS A;  3FWV A;  3PRZ A;  5BXO A;  3AU5 A;  1UN8 A;  2WXQ A;  3ZHE A;  4FHJ A;  4XIF A;  4W9R A;  2WMO A;  5EX3 A;  3JXJ A;  2X38 A;  2VGE A;  3KS2 A;  4BSX A;  4OAV B;  1TNB A;  5A23 A;  2V5F A;  3B7U X;  2VSN A;  3T8K A;  3U4T A;  1S64 A;  4I6G A;  3L54 A;  3RO2 A;  4NUR A;  2OEW A;  5T4Y A;  3O48 A;  1E8Y A;  4U07 A;  4P29 A;  2IU1 A;  4UQY A;  5AAR A;  4F6R D;  5BPP A;  1YYH A;  3AS4 A;  2DZN A;  4K03 A;  1E8X A;  2I1K A;  5ENQ D;  3Q47 B;  5H7P A;  2XEH A;  2PNN A;  3L16 A;  2ZIR A;  4GTT A;  4ILH B;  2NC9 A;  2XGM A;  3L9T A;  2F8X K;  4ZHB A;  4AIF A;  4DI4 A;  4N3A A;  4UWH A;  5EID A;  4A55 A;  1YA0 A;  4DJA A;  2KZT A;  4JB8 P;  1BPO A;  2IO3 C;  4DRX E;  3B95 A;  2P9U G;  3TWW A;  2F8Y A;  2DVW A;  1TNY A;  5KJN A;  1HXI A;  2CHX A;  3G2U A;  4GMJ A;  2XZT G;  4GZD A;  3FUI A;  4RG9 A;  2IO2 C;  4HXI A;  4AY6 A;  5D2M C;  3CVN A;  3BU8 A;  3E37 A;  3TG4 A;  3CQC B;  4GB9 A;  5KJK A;  1OCC E;  2XS1 A;  4RSY A;  3CLJ A;  3GW4 A;  4I9E A;  2R2L A;  3J5Q B;  2VTB B;  1N95 A;  2VSO E;  3ULE G;  2WQ7 A;  3CR3 A;  1FT2 A;  5T3R A;  3KEZ A;  3T9K A;  2QYU A;  2IFU A;  4GTM A;  4GTV A;  1NP7 A;  3V2O A;  5ARF A;  3RRN B;  3U64 A;  3DEP A;  3HDX A;  3ZGQ A;  3JQ1 A;  4AM9 A;  1HF8 A;  2QYJ A;  4HB5 A;  5ENO D;  4JZY A;  3Q75 A;  4Q69 A;  1SW6 A;  4KZ0 A;  2MRI A;  1BU9 A;  1O1T A;  3EDT B;  2PZI A;  3EU5 A;  1U3C A;  4GAA A;  3UT4 A;  4XEI G;  3DSW A;  4HLE A;  1UJJ A;  2LAH A;  2XPZ A;  5D0Q D;  3KD7 A;  3HVE B;  1G3N B;  4I43 A;  5FT9 A;  4DPR A;  3PEU B;  3APD A;  5E76 A;  4DX7 D;  3ABL E;  4FAD A;  4A3T A;  1LD7 A;  5G05 J;  3FU3 A;  4HI9 A;  1TR4 A;  4OVV A;  1UJK A;  1S63 A;  2J4D A;  2NXP A;  3KEA A;  1DNP A;  4I1A A;  2LNI A;  3PE3 A;  3I3N A;  2DYR E;  2P9L G;  3P2B A;  4O6F A;  3ZKJ A;  3MZL B;  2ZXW E;  5ENP D;  4AV7 A;  3V2X A;  5AQ7 A;  4DX6 D;  2V0P A;  2DYS E;  2KCL A;  4AOF A;  4JHJ A;  4GTQ A;  4EHM A;  3MA5 A;  4LER A;  1EPU A;  1OWO A;  5IY5 E;  4CGW A;  3NQP A;  1IKN D;  4EEC A;  4MS6 A;  2NSZ A;  2IQC A;  2ZIS A;  4RQI A;  4TXR A;  4JHK A;  4N2Q A;  3SF4 A;  4G2V A;  1OT8 A;  4IUL A;  5CMW A;  1KPS B;  3G2S A;  3RSE G;  1TN7 A;  2LXL A;  5G55 A;  3AG2 E;  3UUX A;  2VYI A;  1QBQ A;  3K9I A;  4GTO A;  4GZ6 A;  4PS7 A;  3SY2 A;  3GZ2 A;  5FQ6 A;  1OCO E;  4LRZ A;  1ZB1 A;  1WG0 A;  3FH8 A;  1JWG A;  5HKP A;  4CDR A;  2UY1 B;  1SQM A;  4U96 D;  4YDO A;  2BKG A;  1L5J A;  4YDW A;  2Y4U A;  2V4H C;  1FCH A;  2CG3 A;  5EYP F;  2OCC E;  3HG0 D;  3HVE A;  4L9P A;  1ZU2 A;  2WXR A;  3SGH A;  3ZUV B;  4OAU C;  3ASH A;  2GRR B;  3ESK A;  5CBO A;  3OTN A;  3JCK C;  3SI5 A;  3DWL G;  2XRZ A;  4E6H A;  2Q7F A;  2X3M A;  3F6Q A;  4GU5 A;  1INZ A;  3NBN B;  3BQO A;  3AG1 E;  3QWP A;  4FJY A;  3ULY A;  4UI9 J;  1IHG A;  4FLH A;  3W9F A;  1H2U A;  4TRQ A;  5FIN A;  3PE4 A;  3DSU A;  4MLP A;  1K1A A;  3IEG A;  4XI9 A;  4J6I A;  2B0O E;  3VLE A;  3CK7 A;  1OUV A;  4LCT A;  2CHZ A;  4L23 A;  1RZ4 A;  4KZC A;  3ASD A;  3ZYQ A;  4FA6 A;  2ETA A;  4OYS A;  3C3O A;  3CHO A;  2FBN A;  1HE8 A;  2PL2 A;  2RFA A;  3WG7 E;  4B94 A;  3LY8 A;  2I9C A;  4NIK A;  1ZBP A;  3ASO E;  2YQ8 A;  1MYO A;  4BER A;  4C0E A;  1QZ2 A;  2C2L A;  4F53 A;  5AN8 A;  2MYO A;  3FDH A;  2PM6 A;  4A3V A;  4GZ3 A;  3B7R L;  2WXG A;  2WXO A;  2UWJ G;  3CHQ A;  3LXU X;  2MOW A;  3AAA C;  3Q7A A;  2QC9 A;  4AXH A;  3G2T A;  3C3R A;  4PH4 B;  5CBN A;  1WDY A;  3UM1 A;  1OWP A;  5ANL A;  3ONL A;  1DC2 A;  3CV0 A;  4PS8 A;  4I2W A;  4ANV A;  2EIK E;  1NFI E;  2KZT B;  3SZ7 A;  2KCK A;  4EBA G;  2DWZ A;  5JJ6 A;  4I6E A;  4AY5 A;  3Q78 A;  4XX5 A;  2H6H A;  3FFL A;  1ELW A;  2Y1L E;  2YHC A;  2F37 A;  4EPZ A;  4IN3 B;  4UUC A;  2P9N G;  2ILR A;  2L6J A;  5CRV A;  2RKK A;  3MEK A;  1NI1 A;  1O5M A;  3PZD A;  5EIB E;  2GRP B;  4ZFH A;  4HRN A;  1X5B A;  2BKK B;  1JCQ A;  3HXD A;  3SFX A;  5ENR D;  1E90 A;  3R7Q A;  2GRO B;  3DXM G;  4CEM A;  3S7F A;  1KZP A;  1AP7 A;  3IKO B;  4HLL A;  3L13 A;  3L17 A;  2LXM A;  2XZD G;  5DBK A;  1U3D A;  5D0O D;  4JVS A;  3L82 A;  3HXF A;  3ZHE B;  1SZA A;  3FUK A;  4JW1 A;  4G23 A;  2OEV A;  3HXB A;  3ZXS A;  3ZIM A;  4UWK A;  2AW6 A;  3QNK A;  4U8Y D;  4HBD A;  4BWR A;  2X6F A;  1EF1 C;  1TNU A;  1MJ0 A;  2GRQ B;  3MV3 B;  2EIL E;  2R02 A;  3TWX A;  4J8S A;  5LCW C;  1N4S A;  3SBT B;  4APF A;  3UIN C;  4GCO A;  4LUN U;  3MKQ A;  2WVI A;  4N39 A;  2WXM A;  4CDN A;  4N5C A;  2MHK A;  1DCE A;  2ZGD A;  4ATZ D;  3B13 A;  4L2Y A;  3MKR A;  4GPM A;  1NL4 A;  4AJW A;  4U63 A;  1TN8 A;  3ABM E;  2WXK A;  2KBX A;  4OVU A;  2GGF A;  1TNZ A;  4KYO B;  3FY4 A;  3RIB A;  4BEP A;  4ANU A;  3T5X A;  2FO1 E;  4L2L A;  2GRL A;  5CMY A;  3SFZ A;  2XCB A;  4CYM D;  2I1J A;  5ENS D;  2A4Z A;  3ZXP A;  3MGB A;  2JLB A;  1N4Q A;  4JA7 A;  4GZ5 A;  4HOR A;  1E8Z A;  2X6J A;  3ZU7 B;  1N52 A;  5G04 C;  2V4L A;  3AS8 A;  3L22 A;  4N5Q A;  4A1S A;  3C98 A;  4EZK A;  3ML8 A;  4NRH B;  3E32 A;  3FU0 A;  2CG2 A;  2EQX A;  1NA0 A;  1SZ9 A;  4WUY A;  2WB2 A;  5AQ9 A;  1LTX A;  1P5Q A;  3E33 A;  1MX6 A;  4I1O B;  2HYZ A;  2XQ0 A;  1HG5 A;  3Q9U C;  1YMP A;  3CVP A;  4DK5 A;  3PEV B;  2WXI A;  4FU3 A;  3TG5 A;  3LEW A;  1UN9 A;  2H6F A;  4GA2 A;  4ILI A;  5HQ8 A;  3D9J A;  2WXP A;  4H7X A;  4C9B B;  1Z3Y A;  2F0Y A;  5HRY A;  2P2C P;  3T5V A;  5CEA A;  4GTR A;  5C2Y A;  3LJN A;  1MHQ A;  4K5C A;  2OVF A;  5EKQ D;  2L0I A;  1WY6 A;  2VGX A;  2IOS A;  4GMR A;  1N0Q A;  2RG8 A;  3AS5 A;  5D66 A;  1FT1 A;  2GRN B;  3ZN3 A;  3CVU A;  2E2E A;  1E7U A;  4L1B A;  3R7R A;  4M7C A;  3EHR A;  4J8D A;  4B89 A;  4B8C B;  5CED B;  2EIJ E;  3CHR A;  4V3I A;  5AQA A;  5ANR A;  4Q96 A;  3FTU A;  2QY7 A;  3URZ A;  1KT1 A;  3UIP C;  2A5U A;  1E8W A;  5JJT A;  1SA5 A;  1VDY A;  3E34 A;  3D9I A;  3AG3 E;  1TJF A;  1XNF A;  1E96 B;  4N3C A;  5JMN D;  3FUN A;  4JEU A;  1QYM A;  2A5E A;  3TWV A;  3HHM A;  1OWL A;  4QFV A;  3FUJ A;  2C0L A;  3RU0 A;  4G8L A;  2DCP A;  3DXK G;  4QQI A;  4L7T A;  3IV0 A;  4FUL A;  3JYS A;  3JUE A;  2AXZ A;  3KSQ A;  3PNL B;  5JHB A;  1IQU A;  5FJY A;  2FEZ A;  2PQR A;  2XPI A;  4HOS A;  5J08 A;  5J90 A;  3UX4 A;  3MX3 A;  3GZS A;  1MX4 A;  4U95 D;  3C72 A;  4XE0 A;  4FC8 A;  3OXG A;  1K8K G;  1V54 E;  2I2O A;  4UI9 K;  5AQB A;  3UKU G;  3Q7F A;  5CHE E;  4BTB A;  2RFM A;  1LD8 A;  2AXU A;  3EU9 A;  4HRM B;  4HQD A;  4GTS A;  2LSV A;  2XGO A;  4F1P A;  5HS0 A;  3D9O A;  3GYZ A;  4XI0 A;  1BI7 B;  5C1D A;  3N71 A;  2VQ2 A;  1UW4 B;  3LPZ A;  3ZYM A;  1BD8 A;  2WXH A;  4KVM A;  3R9M A;  1B89 A;  4HRL A;  4HI8 A;  3HXE A;  3SFY A;  3FUD A;  3V79 K;  2YNQ A;  3BEE A;  3UT8 A;  3LVQ E;  3PZ4 A;  5EDS A;  4DUI A;  3RO3 A;  2CFZ A;  5EYL A;  2OVB A;  3LYA A;  3ZNG A;  3ZYK A;  1UOH A;  2R17 C;  1A5E A;  1WM5 A;  3UTM A;  3RRU A;  3W9G A;  1FVF A;  3CVV A;  1FVH A;  3ZW3 A;  4UWG A;  1PC2 A;  3UPV A;  2X6K A;  3CSF A;  3I4R B;  3EUV A;  3D9M A;  1Q2Z A;  3VLF A;  4R7L A;  4N2S A;  5KBA A;  4PDX A;  3UIO C;  2AVP A;  4I1M A;  2WXF A;  5FQ8 A;  2LO6 A;  4DLO A;  2VSX E;  3EIJ A;  2YIN A;  4GYY A;  5BV0 A;  1NA3 A;  5BNW A;  4HOU A;  4CGV A;  1GW6 A;  3Q49 B;  4JXT A;  2XGS A;  5LCW J;  3LCA A;  4U8H A;  2VSY A;  1EDU A;  2XEV A;  5AYW D;  4N3B A;  4E85 A;  2EIM E;  3FP3 A;  3G2W A;  4EZJ A;  1HU3 A;  5G04 J;  3S7B A;  2P58 C;  3CIA A;  3FTW A;  2IJG X;  3Q73 A;  3D9P A;  3LY7 A;  1EYH A;  3SO8 A;  4CT0 A;  3OAW A;  4FLB A;  4DI3 A;  4JPS A;  4BT8 A;  4PS3 A;  1Z5S C;  4BET A;  4X8Q A;  1HFA A;  1HS6 A;  3UI2 A;  4F1S A;  2P9P G;  3LJ3 A;  3TGO A;  2WMN A;  3B7S A;  1Y8M A;  3FEY A;  1A17 A;  4EZL A;  1H19 A;  3SBS A;  3CQG B;  4BT9 A;  3QOU A;  3Q15 A;  3LY9 A;  3QC1 A;  3ZEF A;  3L08 A;  4APO A;  3TXN A;  4J8F A;  1Z3X A;  1H6P A;  5KNH D;  4U04 A;  4U0Z A;  2L9B A;  4XKB A;  3PVL A;  3QAQ A;  1X81 A;  3RKV A;  4JD2 G;  3EHQ A;  3FUE A;  1HX8 A;  3HYM B;  1HZ4 A;  3D9K A;  4J8Y A;  4K5B A;  3QKY A;  3KSL A;  4KBQ A;  3ML9 A;  3UKR G;  2FUL A;  3Q4A B;  1MX2 A;  3ESL A;  2H6G A;  4IYP A;  5DIZ A;  1TNO A;  1S0P A;  3ASG A;  3JUI A;  4WWN A;  2DBA A;  4GCN A;  3UT7 A;  2R03 A;  5LP0 A;  3Q79 A;  5KWD A;  1PAQ A;  1RW2 A;  2HO1 A;  1N94 A;  1OWM A;  3PDN A;  2XHE A;  4C0M A;  4J8E A;  4ABN A;  3B7T A;  4MKT A;  5FWQ A;  3FH5 A;  3CVQ A;  4LNU D;  4MBG A;  4KMO A;  2KAT A;  2IOL A;  3E4B A;  5FQ7 A;  3ENE A;  3G2V A;  4WWP A;  4G25 A;  3SQV A;  2GRM A;  3IHV A;  5ARG A;  4U7E B;  3APF A;  3T8M A;  2HM8 A;  1ELK A;  2Y3A A;  5A7D B;  2Y69 E;  4Q94 A;  2VJ8 A;  4BX8 A;  1O1R A;  2L0T B;  4J0U A;  3L6A A;  3FTV A;  5ENT D;  4UWL A;  3UM0 A;  4B93 B;  1LF8 A;  3CST A;  3TJP A;  3WXX A;  4LNB A;  2PM7 A;  4ATG A;  3FU6 A;  5T8I A;  2J07 A;  2BTD A;  3PUK A;  4U8V D;  1SA4 A;  3AU4 A;  3V31 A;  5LFA A;  5JA4 D;  4D10 C;  3J5P A;  2V5Q C;  3TL5 A;  3LKU A;  4GML A;  4M3O A;  1N11 A;  3E30 A;  2QFC A;  3P1U A;  4AEZ C;  2J49 A;  1JCR A;  4GA0 A;  4BX9 A;  1O1S A;  3FUL A;  5FQ4 A;  3U66 A;  3D3M A;  3DPY A;  4I6J A;  4UWF A;  4UQZ A;  2Y4T A;  5KJM A;  4YDE A;  1MZC A;  4I2Z A;  4G24 A;  4PUC A;  3EIQ C;  2WQH A;  3HIZ A;  4LSZ E;  1S70 B;  3D9H A;  4A63 B;  5AJL A;  1OXJ A;  3AG4 E;  4JEH A;  2FF4 A;  2V8S E;  1K3Z D;  5LX8 A;  5EN5 D;  3EJN A;  2BED A;  3ONK A;  5AIJ A;  2L6B A;  2X6H A;  2BF0 X;  3BG0 B;  2P9S G;  4KXK B;  5EIL A;  4F3V A;  3DEO A;  4LEU A;  1JPL A;  1BLX B;  3OXF A;  1HG2 A;  3ASF A;  2C0M A;  5A6C A;  2EIN E;  4GYW A;  3CGH A;  4Y6C A;  3DBS A;  3HXC A;  4WNG A;  5BT1 A;  3DPD A;  4O1P A;  3U9W A;  3S7J A;  2I6H A;  3MV2 B;  2QZA A;  4JA9 A;  1H0A A;  4WWO A;  5CRU A;  4WNF A;  2KCV A;  5CCL A;  3VLD A;  4YDY A;  4G8K A;  2WPV A;  1HO8 A;  3O4Z A;  2J08 A;  2R05 A;  3GZ1 A;  4HOT A;  2FO7 A;  4WNE A;  4BES A;  2ETC A;  3EHM A;  4FHK A;  3ZPJ A;  1H2V C;  3C3Q A;  4RG6 A;  3TWS A;  1AWC B;  2XEE A;  3S7D A;  2XEN A;  2DZO A;  4XKC A;  1D9S A;  4YVQ C;  1WAO 1;  5BXU A;  4KVO A;  3JQ0 A;  4BY6 A;  5BV1 A;  2HR2 A;  2UY1 A;  5EX0 A;  3RAU A;  3DSS A;  4G11 A;  3ZRH A;  2R59 A;  2IF4 A;  3QWV A;  5BUZ A;  3FTX A;  1OWN A;  2XCC A;  1QNF A;  3ZYL A;  3IXE A;  3QAR A;  1IYG A;  4JC8 A;  2P9K G;  3NAW A;  3FTZ A;  1H6O A;  4F7A A;  4GTP A;  2VTB A;  2VGX B;  1QQE A;  3EHN A;  3LVR E;  5KJL A;  3B7B A;  4AVX A;  2VGY A;  3TXM A;  5BW8 C;  4EQF A;  2Y0B G;  3PS6 A;  3MCX A;  4O1O A;  3X2Q E;  4CCA A;  3U3W A;  1KZO A;  4J7W A;  4LNG A;  5KCM A;  2IY0 C;  3JXI A;  1TEZ A;  2AWI A;  3QB2 A;  3RRM B;  3R9A B;  3NB2 A;  4URK A;  2KM4 A;  3NOC D;  1N54 A;  4HS2 A;  1JUQ A;  3SHF A;  3D9L A;  3APC A;  4CDM A;  1IHB A;  2NYJ A;  3TAX A;  2ZU6 B;  3VTX A;  5AEN A;  2KC7 A;  3LDZ A;  3QJZ A;  4EBA A;  1Z6T A;  2WXJ A;  3DRA A;  2H6I A;  5B1A E;  5B1B E;  3NF1 A;  3TWU A;  3CKB A;  3QWW A;  4ACL A;  3PUJ A;  4HOQ A;  4LG6 A;  1OCZ E;  2OOE A;  3IBE A;  4O60 A;  3UM3 A;  2JEK A;  2M63 A;  2DIW A;  2J8S D;  3CHP A;  2KXP C;  1E7V A;  1Y6I A;  4AP2 A;  4RVB A;  2AXV A;  4A1G A;  4CT4 A;  4KT6 B;  3MJW A;  1N9A A;  3S2A A;  5E75 A;  4G1T A;  5HI7 A;  3FH7 A;  4H7Y A;  3CHM A;  1JWF A;  3BG1 B;  1H2T C;  3KAE A;  5LOZ A;  3MYV A;  5JJ7 A;  4HVB A;  1K1B A;  2B6C A;  3RJV A;  2JAB A;  2XPY A;  2YHE A;  5ITZ F;  5M72 A;  2X6I A;  3CVX A;  3DST A;  3ZFW A;  2WQ6 A;  2WXN A;  1N4R A;  5FZS A;  5FZR A;  3CVY A;  4K0R A;  1SVX A;  3OXL A;  3UMV A;  4ANW A;  1BI8 B;  4DX5 D;  3PNT B;  3HRA A;  4K5A B;  5B3S E;  4JL0 A;  4GPK A;  2BUG A;  3PZ2 A;  4UQX A;  4BFR A;  2J9Q A;  3UM2 A;  4DLQ A;  3FTS A;  3NZU A;  4CZ2 D;  4MRU A;  1NZN A;  4JHR A;  1H6K A;  3ISM C;  3Q9N C;  3UQ3 A;  2ION A;  4BTA A;  3ASN E;  4WAF A;  2ZGG A;  4BSZ B;  3V30 A;  1N0R A;  4Z68 A;  1JCS A;  4I9C A;  3TWQ A;  4TV3 A;  3PZ3 A;  3DSX A;  2CHW A;  1PY1 A;  3NZS A;  4NQ0 A;  3TWT A;  5AJD A;  4I17 A;  1YCS B;  2R5S A;  4YVO A;  4C48 B;  5FIO A;  4GYO A;  4ANX A;  3LS8 A;  2AJA A;  3CKC A;  4HFG A;  4XZ4 A;  2LAI A;  3FUM A;  3FUH A;  4DX1 A;  5CEC B;  3PRE A;  1TYQ G;  3IHY A;  2J09 A;  3DSV A;  2OV8 A;  5G2N A;  5G05 C;  4TUM A;  2RD0 A;  1TJC A;  5FZQ A;  4GZC A;  3Q5M A;  1MQS A;  1FPP A;  4B0Z A;  2XS8 A;  3I5P A;  4NAC A;  1U2V G;  3BUA A;  1W3B A;  1XGW A;  3QK0 A;  1OCR E;  1ELR A;  1DCQ A;  1OY3 D;  3ZVV A;  2J4B A;  4WND A;  3CK9 A;  3RK6 A;  2FI7 A;  3MKQ B;  3CVW A;  3D9N A;  3PZ1 A;  4FP7 A;  3CEQ A;  2WM9 A;  2GW1 A;  4U0U A;  3SNX A;  3CK8 A;  2PQN A;  5CER B;  3TWR A;  4HNA D;  1D8E A;  5KNG A;  3FHE A;  3UXG A;  3I4G A;  1KT0 A;  3ULQ A;  4G26 A;  3VTY A;  3C5R A;  4GA1 A;  5AAO A;  2IEJ A;  3ABK E;  4B8A A;  4ME2 A;  3AJI A;  3FTY A;  1IQR A;  1UG3 A;  1D8D A;  2OND A;  1TN6 A;  5FTP A;  1DVP A;  3NOG D;  2ETB A;  2LUH A;  4UI9 C;  4FJZ A;  2CFU A;  4RLY A;  1HH8 A;  4ILG A;  4U0S A;  4IRU A;  4Y6W A;  3PH0 C;  3CVL A;  4TXQ A;  3FUF A;  1KLX A;  5CCM A;  4ACK A;  4CRW A;  2HE0 A;  2P9I G;  4DX2 A;  2WXL A;  4TUU A; 
#chains in the Genus database with same CATH homology
 2LXL A;  4U7E B;  5H7P A;  2LUH A;  2RKK A;  4TXP A;  2LXM A;  4TXR A;  4TXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...