2LXMA

Lip5-chmp5
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
163
structure length
163
Chain Sequence
b'MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associated protein VTA1 homolog
publication title Interactions of the Human LIP5 Regulatory Protein with Endosomal Sorting Complexes Required for Transport.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 60
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 2lxmA00
4TXPA 4TXRA 2RKKA 2LXLA 2LUHA 4U7EB 4TXQA 2LXMA 5H7PA
chains in the Genus database with same CATH superfamily
2I2OA 1JWFA 1OCOE 2FF4A 3HXFA 5FQ6A 3R9AB 4A1GA 4CZ2D 3B7RL 3PE3A 2RD0A 3LY9A 1SA4A 3HHMA 4DX7D 3KAEA 3EU9A 2VGEA 3FY4A 4JHRA 1N0RA 2KXPC 4C0EA 4HI8A 4FC8A 2XRYA 2DIWA 5AQAA 2P9SG 3QJZA 2FO1E 3FUFA 1LTXA 2R59A 2ILRA 3NB2A 2EINE 2XEHA 2AVPA 5ENOD 4J7WA 3EHQA 1NZNA 3CK9A 3MA5A 3FU3A 3CHRA 4UWFA 2V5FA 2PQRA 1N4QA 1KZOA 3DRAA 3JYSA 2C2LA 5BW8C 3UPVA 1PAQA 1MZCA 5A7DB 1TNYA 3LEWA 3WG7E 4I1OB 3Q4AB 2MOWA 1Y6IA 4XKBA 4J8YA 1SA5A 3HG0D 4QFVA 2GRNB 3JUEA 3UQ3A 4TXPA 2DYRE 5ARGA 3UINC 4NRHB 3ASNE 4I9EA 2IOSA 5G04C 4APOA 2EIME 4FP7A 2XENA 5AQ7A 3FTUA 4JZYA 2QZAA 3Q73A 3UM1A 3W9GA 3VLDA 5LCWC 5ANRA 3ASOE 4RG9A 3SBTB 5B3SE 1UG3A 2IO2C 3APFA 3HDXA 5EILA 5FQ7A 3QOUA 4PS7A 4BSXA 4GTQA 5ANLA 1LF8A 2BKKB 2YHEA 3S7JA 4A63B 3HXDA 3G2TA 4YDOA 3ZW3A 2C0LA 4G24A 3IEGA 3DXMG 3FUNA 5ENNA 3ZVVA 1RW2A 2IF4A 5AAOA 2KC7A 3CVXA 2OVFA 4BSZB 4PH4B 2XPZA 3IKOB 4N39A 5CERB 1N4PA 3DSUA 1PY1A 4DI3A 2WXOA 2WQHA 3MCXA 4PUCA 1Y8MA 4YDYA 2MHKA 4ANUA 3TWVA 4LUNU 4Q69A 3AAAC 4HFGA 2YQ8A 4CRWA 3ENEA 1TJFA 3B95A 3D9KA 4IYPA 5ENSD 4CDNA 4AIFA 5CCMA 4DPRA 3UTMA 1OY3D 3E32A 2WXRA 3E34A 4RLYA 2XS8A 1N4SA 2X6HA 2CFZA 3O48A 3Q9UC 4EBAA 4HVBA 3TWSA 3RSEG 4DJAA 3UKUG 1DCQA 2EIKE 4I2ZA 4X8QA 5JJ7A 2ZIRA 3FTSA 1G3NB 2Y3AA 4CT4A 3DWLG 3TWTA 4DK5A 1SVXA 5KNGA 1K3ZD 2L9BA 3ZUVB 1GW6A 3JXJA 3ASDA 2AW6A 4U96D 3S2AA 3L17A 1HG2A 1FCHA 1FT2A 2XGSA 5JJ6A 5BPPA 1S0PA 4CCAA 3PVLA 5LFAA 5CECB 3C3OA 5AQ9A 2LNIA 2AXZA 2CHXA 3VTXA 4Z68A 1H6PA 1XNFA 4UWGA 4U0SA 3LXUX 4JPSA 5FZQA 1NFIE 4YVQC 4U04A 2WXLA 2XGMA 2VSYA 5G55A 2OOEA 5T8IA 2WVIA 4F3VA 1VDYA 4BWRA 2BF0X 2H6IA 1HXIA 1WDYA 3UT7A 4HOUA 4PS8A 3ABLE 3CK8A 4Y6WA 2I6HA 3FH7A 1WM5A 3L9TA 3VTYA 2WXIA 4N3BA 5CEAA 2NSZA 3L13A 3CKBA 3D9HA 4CDRA 3GZ1A 3EDTB 3PZ2A 3QDNA 5G04J 3CR3A 1UJJA 3X2QE 4XX5A 3ZN3A 3PUKA 3AU4A 5JHBA 3FDHA 5HQ8A 1K8KG 1NP7A 5C2YA 2F8YA 4LNGA 4E85A 1HO8A 4BTBA 1V54E 4UWLA 3W9FA 5LCWJ 4BEPA 2F0YA 1IQRA 3FH5A 3ABME 2RFMA 5AYWD 4HBDA 2VTBB 3L82A 3D9PA 3PNLB 1NL4A 4A3TA 1TNBA 3E30A 4TXRA 3UT8A 4NURA 3SQVA 2DZNA 2KZTB 4D10C 4DLQA 1IXVA 3U4TA 2E2EA 4FHKA 4F6RD 2IOLA 3G2WA 4C9BB 5HRYA 4HQDA 2NYJA 4HB5A 4I2WA 3ZU7B 4HOQA 4I6GA 4JHKA 1OCZE 4GYOA 3IBEA 4BY6A 3UM2A 3FTZA 3FTYA 1JCSA 2VSNA 4AY6A 5JMND 1TNZA 3PH0C 4YDWA 4L1BA 3PZDA 4I43A 2VGYA 3QC1A 3PZ3A 3ZGQA 3EU5A 4N3CA 3P1UA 2ZU6B 1IYGA 3DSTA 5HI7A 2VGXA 4U0UA 2P9IG 3R7QA 3CHOA 4UWKA 3JQ1A 4GTMA 3FUHA 4FJYA 3TGOA 4F1SA 1LD7A 4JA7A 4HORA 2V8SE 3ZFWA 3DEPA 2WXPA 3ZYMA 4Q94A 2HM8A 4JEUA 3RK6A 5BT1A 1E8YA 3FEYA 3UIOC 4B8CB 2AJAA 3B7SA 2HR2A 3AG2E 1TYQG 3CEQA 3PEVB 3FEXA 4UQZA 2GW1A 1P5QA 5D2MC 2P9NG 2A4ZA 3ZXPA 1PC2A 3HXBA 2FBNA 3ZYLA 2CFUA 4NQ0A 4AXHA 4KZCA 3NBNB 1BD8A 5FIOA 4WWPA 5CBOA 2DBAA 3CSFA 3ZHEA 2LO6A 5DBKA 3MJWA 2J8SD 2P9KG 4GA0A 2WMOA 3D9NA 3CVNA 1NA3A 1X81A 4GZ6A 2IY0C 4AV7A 2XCCA 1MHQA 4UWHA 2L0IA 5B1BE 3TWWA 4I1MA 1SW6A 2XHEA 2I1KA 1E90A 4O1PA 4UI9K 3OXLA 2R2LA 3LJNA 4TXQA 1S63A 5AN8A 3JUIA 4MKTA 2R03A 2JLBA 3LS8A 2GROB 3U64A 1IHBA 5KJLA 1U3DA 2XZTG 2KM4A 2YINA 1WY6A 4G23A 1XGWA 2YNQA 4WUYA 3CVVA 3CIAA 2LSUA 3NOCD 5BXUA 3CLJA 1OT8A 3LVQE 4CGWA 1Z3YA 3TWQA 4DUIA 4EQFA 3QKYA 5KWDA 5LP0A 2PL2A 1AP7A 1TN7A 3L6AA 1MYOA 3UI2A 1E7UA 3C3QA 3LKUA 3J5PA 4GA1A 1KT0A 5ENQD 2ETCA 1KPSB 3S7BA 2J09A 3F6QA 4NIKA 5AARA 3EJNA 1HS6A 3PS6A 2ZGGA 3FUJA 2X38A 4GB9A 3UX4A 4HLEA 2IO3C 3CVQA 3NF1A 1DNPA 1N0QA 3WXXA 3FU5A 4LSZE 3EHMA 4R7LA 2X6FA 2XRZA 3KS2A 2GRQB 3CQGB 3R9MA 3T5VA 4RVBA 1AWCB 3GW4A 3GYZA 4LERA 2NXPA 4BETA 3E33A 1LD8A 4I6EA 5DIZA 5EDSA 2ETBA 2E0IA 2UY1A 4YVOA 4KBQA 4KXKB 2PZIA 4JC8A 1N54A 2R5SA 1YYHA 4XE0A 3FP3A 4UI9C 1KZPA 4B93B 2MRIA 5C1DA 1OCRE 2LXMA 1TN6A 3DSSA 2DCPA 4WNFA 4M7CA 2V4LA 3IXEA 3URZA 3RRNB 3LJ3A 2GRPB 1D9SA 4GZCA 2LAIA 2L6JA 2XQ0A 4BERA 4URKA 1UOHA 3EUVA 3LVRE 3RAUA 3RU0A 2WM9A 4JXTA 2H6FA 5CMWA 3QWVA 2WXHA 4JEHA 5CCLA 5EYLA 4EZKA 1HZ4A 4F1PA 4U0ZA 3LY7A 3BEEA 3GZ2A 3HVEB 2XPIA 3QAQA 3MKQA 4HRMB 5AQBA 4RQIA 4HOSA 1IHGA 2WXFA 3IHYA 3BU8A 3HIZA 5ENTD 3D9JA 3FHEA 4NACA 3OXGA 4DLOA 3UKRG 2DWZA 4A1SA 5FQ4A 5HS0A 2KATA 3CHMA 2CG3A 5T4YA 2ETAA 5FWQA 3BQOA 4EECA 1TNUA 3HXCA 4O60A 1O5MA 4GMLA 5LOZA 1JCQA 4XEIG 4A55A 3KEZA 5IY5E 3PEUB 2R17C 2B6CA 2AWIA 1QBQA 3LPZA 3Q47B 1NI1A 2HO1A 5H7PA 1BPOA 3AJIA 3Q49B 3Q15A 1TJCA 3TWUA 4ACLA 5CHEE 2VYIA 1YMPA 3CHPA 4LNUD 4G2VA 4DX5D 4GCNA 3SGHA 3DPDA 3CV0A 5G05C 4XZ4A 4F53A 3MKRA 4I17A 5ENRD 5EIBE 2J9QA 1HU3A 1U3CA 3PZ1A 4ILIA 2J4DA 3GZSA 1UJKA 3SZ7A 3Q79A 3E37A 3V79K 1EDUA 1O1TA 3DEOA 1E8XA 5FJYA 4H7YA 4J8DA 3TWRA 4XI9A 2H6GA 1HFAA 1L5JA 4K5AB 2PNNA 4H7XA 3QWWA 1KLXA 4XKCA 2DYSE 4BX9A 3SO8A 1SZAA 2H6HA 1Z5SC 4FLBA 2IEJA 5AENA 3ZIMA 4CDMA 4G26A 4G11A 2LSVA 3D9OA 4LEUA 5CBNA 5HKPA 1HX8A 4EBAG 2V0PA 2L6BA 1TR4A 2B0OE 3PZ4A 4ABNA 4UI9J 3FUKA 5B1AE 2Y69E 2IONA 5JHAA 1WG0A 4MLPA 5BV0A 5M72A 5KJKA 4ANWA 3IHVA 2X6KA 2XEEA 5A6CA 3BG1B 3J5QB 3EIQC 4M3OA 3JCKC 2P9PG 1EF1C 1OWMA 1HE8A 4AM9A 5ENPD 4GPMA 4ACKA 4ILHB 3B7TA 4CT0A 1MX2A 1H19A 3TXNA 3IV0A 3CHSA 1BU9A 4GCOA 1DC2A 3MX3A 3UXGA 4YNDA 1RZ4A 3D3MA 1JCRA 3CVWA 4LG6A 4N2SA 4BT8A 3T9KA 4O1OA 4JB8P 3HXEA 2ONDA 2FI7A 2XCBA 4K5CA 4ANVA 3HYMB 3I4RB 1HH8A 3NAWA 1Z3XA 1FVHA 3N71A 4AVXA 4K03A 3DSWA 1EPUA 2WXKA 3FTVA 4AOFA 4GTOA 1X5BA 1N94A 3QNKA 3KD7A 2ZISA 3S7DA 4JW1A 4JHJA 2LUHA 4GMJA 4V3IA 3MV3B 3KEAA 4J8EA 2QFCA 4MS6A 4N2QA 3FULA 4GMRA 2OCCE 3C5RA 3R7RA 1TEZA 3Q9NC 4LCTA 5CRVA 4DX2A 2J08A 3PREA 5AJDA 4GTVA 3MV2B 1K1BA 2AXVA 1A17A 5G05J 5BV1A 1OWLA 3U3WA 3RKVA 2GRLA 4XI0A 4MRUA 4CGVA 4FHJA 4OAVB 2Y4UA 3HRAA 2IU1A 4FULA 2P58C 1N9AA 2KZTA 4OYSA 3EHRA 2MYOA 2C0MA 3C98A 1UN8A 4BFRA 4OAUC 2F8XK 5EYPF 1ELKA 1DVPA 3FUEA 4WWNA 4N3AA 1MX4A 4J8SA 4ATZD 2OVBA 4WNGA 1QYMA 4TV3A 4WNEA 4BT9A 2R05A 2KCKA 4L2YA 5CRUA 4TUMA 4ME2A 1E8WA 5ITZF 5FT9A 4EPZA 3Q5MA 3AU5A 3I4GA 5FINA 2OEVA 4L23A 1YA0A 3T8MA 4G8KA 2CHWA 1D8DA 3FUIA 2GRMA 4EHMA 3ML9A 3QK0A 2CHZA 3ULYA 2PQNA 3OXFA 3CSTA 4G25A 3FU0A 3SD5A 3G2VA 3PRZA 1WAO1 3AG4E 4KVOA 4UUCA 3CVPA 1FPPA 3AG3E 4HLLA 5EX3A 2M63A 3P2BA 4N5CA 4HOTA 3ASGA 3ZEFA 3CVLA 2A5UA 4GTTA 2WXNA 4Y6CA 5LX8A 2J4BA 5CMYA 5JA4D 2BUGA 1D8EA 4HRNA 1BLXB 3UM0A 4U8HA 5KCMA 4PDXA 1UW4B 4JL0A 5KNHD 1JPLA 5BUZA 3MGBA 2WMNA 4HRLA 3ABKE 4G1TA 2IJGX 4FLHA 3MKQB 3U9WA 1SQMA 2QY7A 3V31A 1EYHA 3T5XA 4HI9A 4ATGA 4TRQA 4J6IA 2QC9A 3NZUA 3TL5A 2Y0BG 4C0MA 3DBSA 5EIDA 3MZLB 4I9CA 3JXIA 4KVMA 3B13A 2V4HC 4OVVA 5AJLA 4L2LA 3UM3A 3D9IA 2QYJA 3ZPJA 1QQEA 2RKKA 2OV8A 2WPVA 4APFA 3OTNA 2KCVA 4P29A 2P9LG 2WQ7A 5EX0A 2Y1LE 5ARFA 3CKCA 5BXOA 2VJ8A 3SF4A 3ZNGA 4U07A 5J90A 4EZLA 2P9UG 4L9PA 4RG6A 4ZFHA 2OEWA 3CVUA 3ZKJA 4FADA 1OCCE 5D0OD 3ZXSA 1V55E 2I1JA 3FUDA 3ULQA 4WWOA 3UUXA 4EZJA 5T3RA 3G2SA 1OWOA 4JD2G 4IULA 4GZDA 1A5EA 3FWVA 4HS2A 3RJVA 3ONLA 4G8LA 3L22A 4UQYA 1TNOA 4LRZA 3B7UX 3E4BA 3O4ZA 2F37A 4BX8A 3MEKA 3UT4A 3TXMA 3V2OA 1BI7B 5KJNA 3TWXA 3K9IA 3DXKG 1H0AA 4PS3A 4B8AA 3ESKA 4IN3B 4J8FA 1OWPA 1Q2ZA 3SNXA 1E96B 3RRMB 5JJTA 3LY8A 3PUJA 4GTSA 2Q7FA 2WXGA 5FQ8A 3UIPC 4FU3A 2XS1A 4DX1A 2A5EA 3DPYA 5EKQD 1SZ9A 4MBGA 3C72A 2HYZA 4GPKA 3ASFA 3DSVA 4I1AA 2DVWA 4TUUA 3ISMC 3ZYQA 3MYVA 2P2CP 3Q7AA 4GA2A 3CVYA 3APCA 2ZGDA 4WNDA 3C3RA 3LCAA 4GYYA 4XIFA 2Y4TA 3QB2A 2CG2A 2NC9A 4UQXA 3APDA 3AS8A 3FFLA 1ZB1A 3OAWA 4B89A 4U8VD 4F7AA 3SBSA 3ASHA 1QZ2A 3D9MA 2L0TB 3RO2A 4DI4A 5G2NA 5CEDB 2XGOA 4C48B 4N5QA 1S64A 3QARA 2RFAA 4GZ3A 3HVEA 2VQ2A 4CEMA 1FVFA 3VLFA 4GAAA 1ZBPA 3TAXA 2FEZA 4WAFA 3CK7A 5BNWA 3NZSA 3Q78A 2GRRB 1K1AA 2FO7A 4JA9A 3V2XA 1ELRA 1IQUA 4DX6D 3L54A 3AS5A 4KT6B 4ILGA 5E75A 2VSXE 4B94A 1H2VC 4L7TA 1Z6TA 2PM7A 3KSLA 2DZOA 4RSYA 4U63A 2X3MA 1O1SA 2IQCA 3SFYA 2GGFA 3BUAA 1JUQA 5E76A 2VGXB 2WXQA 3QWPA 4E6HA 2J07A 2IFUA 1NA0A 3KSQA 3ESLA 2V5QC 4DRXE 2VSOE 1U2VG 1INZA 2EIJE 3NQPA 3EHNA 4A3VA 3B7BA 2JABA 4U95D 2R02A 1OWNA 5FZRA 4J0UA 3D9LA 1O1RA 1N52A 1YCSB 3SI5A 2EQXA 3TG4A 3SY2A 4BTAA 3T8KA 1W3BA 2WXJA 2UWJG 2PM6A 1HF8A 1UN9A 3CQCB 2HE0A 3AS4A 3FH8A 5FTPA 3LDZA 1OUVA 1HG5A 1QNFA 3I5PA 3PDNA 3G2UA 1H2TC 4B0ZA 3TJPA 3ZYKA 2WXMA 4IRUA 2ZXWE 2FULA 3ML8A 2I9CA 3SFZA 1ELWA 3SFXA 2LAHA 3ZHEB 2EILE 3DSXA 4Q96A 1N11A 5A23A 3ZRHA 1E8ZA 3ULEG 4QQIA 4I6JA 1H6OA 3JQ0A 3BG0B 2XEVA 3S7FA 3RIBA 3UMVA 5KBAA 3ONKA 1N95A 4LNBA 5D66A 3RO3A 1H6KA 3NOGD 4BESA 2JEKA 2KBXA 1MQSA 1DCEA 3L08A 3EIJA 1JWGA 1S70B 3LYAA 2X6IA 5D0QD 4AY5A 1ZU2A 4K5BA 4JVSA 2RG8A 1N4RA 3L16A 4ZHBA 1IKND 1H2UA 2BTDA 5KJMA 3RRUA 4U7EB 1TN8A 2VTBA 4ANXA 3AG1E 2WB2A 3Q7FA 3PE4A 4AP2A 3Q75A 4GYWA 4KZ0A 2X6JA 1FT1A 5AIJA 5FZSA 4OVUA 4AEZC 4YDEA 2AXUA 3CHQA 1MJ0A 3FUMA 1E7VA 3U66A 2BEDA 2BKGA 5J08A 2XZDG 1BI8B 4KYOB 1MX6A 4GTPA 2QYUA 4FA6A 4AJWA 4W9RA 3TG5A 3SHFA 3VLEA 2J49A 4KMOA 3CGHA 4HNAD 3FTXA 2UY1B 3V30A 4U8YD 1OXJA 2YHCA 2WQ6A 4GU5A 4FJZA 5EN5D 3FTWA 3I3NA 4GZ5A 1B89A 2XPYA 4K0RA 3FU6A 4O6FA 1KT1A 4GTRA 2KCLA 2LXLA 3PNTB 4HXIA 4CYMD
chains in the Genus database with same CATH topology
4TXPA 4TXRA 2RKKA 2LXLA 2LUHA 4U7EB 4TXQA 2LXMA 5H7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TXP A;  4TXR A;  2RKK A;  2LXL A;  2LUH A;  4U7E B;  4TXQ A;  2LXM A;  5H7P A; 
#chains in the Genus database with same CATH topology
 2I2O A;  1JWF A;  1OCO E;  2FF4 A;  3HXF A;  5FQ6 A;  3R9A B;  4A1G A;  4CZ2 D;  3B7R L;  3PE3 A;  2RD0 A;  3LY9 A;  1SA4 A;  3HHM A;  4DX7 D;  3KAE A;  3EU9 A;  2VGE A;  3FY4 A;  4JHR A;  1N0R A;  2KXP C;  4C0E A;  4HI8 A;  4FC8 A;  2XRY A;  2DIW A;  5AQA A;  2P9S G;  3QJZ A;  2FO1 E;  3FUF A;  1LTX A;  2R59 A;  2ILR A;  3NB2 A;  2EIN E;  2XEH A;  2AVP A;  5ENO D;  4J7W A;  3EHQ A;  1NZN A;  3CK9 A;  3MA5 A;  3FU3 A;  3CHR A;  4UWF A;  2V5F A;  2PQR A;  1N4Q A;  1KZO A;  3DRA A;  3JYS A;  2C2L A;  5BW8 C;  3UPV A;  1PAQ A;  1MZC A;  5A7D B;  1TNY A;  3LEW A;  3WG7 E;  4I1O B;  3Q4A B;  2MOW A;  1Y6I A;  4XKB A;  4J8Y A;  1SA5 A;  3HG0 D;  4QFV A;  2GRN B;  3JUE A;  3UQ3 A;  4TXP A;  2DYR E;  5ARG A;  3UIN C;  4NRH B;  3ASN E;  4I9E A;  2IOS A;  5G04 C;  4APO A;  2EIM E;  4FP7 A;  2XEN A;  5AQ7 A;  3FTU A;  4JZY A;  2QZA A;  3Q73 A;  3UM1 A;  3W9G A;  3VLD A;  5LCW C;  5ANR A;  3ASO E;  4RG9 A;  3SBT B;  5B3S E;  1UG3 A;  2IO2 C;  3APF A;  3HDX A;  5EIL A;  5FQ7 A;  3QOU A;  4PS7 A;  4BSX A;  4GTQ A;  5ANL A;  1LF8 A;  2BKK B;  2YHE A;  3S7J A;  4A63 B;  3HXD A;  3G2T A;  4YDO A;  3ZW3 A;  2C0L A;  4G24 A;  3IEG A;  3DXM G;  3FUN A;  5ENN A;  3ZVV A;  1RW2 A;  2IF4 A;  5AAO A;  2KC7 A;  3CVX A;  2OVF A;  4BSZ B;  4PH4 B;  2XPZ A;  3IKO B;  4N39 A;  5CER B;  1N4P A;  3DSU A;  1PY1 A;  4DI3 A;  2WXO A;  2WQH A;  3MCX A;  4PUC A;  1Y8M A;  4YDY A;  2MHK A;  4ANU A;  3TWV A;  4LUN U;  4Q69 A;  3AAA C;  4HFG A;  2YQ8 A;  4CRW A;  3ENE A;  1TJF A;  3B95 A;  3D9K A;  4IYP A;  5ENS D;  4CDN A;  4AIF A;  5CCM A;  4DPR A;  3UTM A;  1OY3 D;  3E32 A;  2WXR A;  3E34 A;  4RLY A;  2XS8 A;  1N4S A;  2X6H A;  2CFZ A;  3O48 A;  3Q9U C;  4EBA A;  4HVB A;  3TWS A;  3RSE G;  4DJA A;  3UKU G;  1DCQ A;  2EIK E;  4I2Z A;  4X8Q A;  5JJ7 A;  2ZIR A;  3FTS A;  1G3N B;  2Y3A A;  4CT4 A;  3DWL G;  3TWT A;  4DK5 A;  1SVX A;  5KNG A;  1K3Z D;  2L9B A;  3ZUV B;  1GW6 A;  3JXJ A;  3ASD A;  2AW6 A;  4U96 D;  3S2A A;  3L17 A;  1HG2 A;  1FCH A;  1FT2 A;  2XGS A;  5JJ6 A;  5BPP A;  1S0P A;  4CCA A;  3PVL A;  5LFA A;  5CEC B;  3C3O A;  5AQ9 A;  2LNI A;  2AXZ A;  2CHX A;  3VTX A;  4Z68 A;  1H6P A;  1XNF A;  4UWG A;  4U0S A;  3LXU X;  4JPS A;  5FZQ A;  1NFI E;  4YVQ C;  4U04 A;  2WXL A;  2XGM A;  2VSY A;  5G55 A;  2OOE A;  5T8I A;  2WVI A;  4F3V A;  1VDY A;  4BWR A;  2BF0 X;  2H6I A;  1HXI A;  1WDY A;  3UT7 A;  4HOU A;  4PS8 A;  3ABL E;  3CK8 A;  4Y6W A;  2I6H A;  3FH7 A;  1WM5 A;  3L9T A;  3VTY A;  2WXI A;  4N3B A;  5CEA A;  2NSZ A;  3L13 A;  3CKB A;  3D9H A;  4CDR A;  3GZ1 A;  3EDT B;  3PZ2 A;  3QDN A;  5G04 J;  3CR3 A;  1UJJ A;  3X2Q E;  4XX5 A;  3ZN3 A;  3PUK A;  3AU4 A;  5JHB A;  3FDH A;  5HQ8 A;  1K8K G;  1NP7 A;  5C2Y A;  2F8Y A;  4LNG A;  4E85 A;  1HO8 A;  4BTB A;  1V54 E;  4UWL A;  3W9F A;  5LCW J;  4BEP A;  2F0Y A;  1IQR A;  3FH5 A;  3ABM E;  2RFM A;  5AYW D;  4HBD A;  2VTB B;  3L82 A;  3D9P A;  3PNL B;  1NL4 A;  4A3T A;  1TNB A;  3E30 A;  4TXR A;  3UT8 A;  4NUR A;  3SQV A;  2DZN A;  2KZT B;  4D10 C;  4DLQ A;  1IXV A;  3U4T A;  2E2E A;  4FHK A;  4F6R D;  2IOL A;  3G2W A;  4C9B B;  5HRY A;  4HQD A;  2NYJ A;  4HB5 A;  4I2W A;  3ZU7 B;  4HOQ A;  4I6G A;  4JHK A;  1OCZ E;  4GYO A;  3IBE A;  4BY6 A;  3UM2 A;  3FTZ A;  3FTY A;  1JCS A;  2VSN A;  4AY6 A;  5JMN D;  1TNZ A;  3PH0 C;  4YDW A;  4L1B A;  3PZD A;  4I43 A;  2VGY A;  3QC1 A;  3PZ3 A;  3ZGQ A;  3EU5 A;  4N3C A;  3P1U A;  2ZU6 B;  1IYG A;  3DST A;  5HI7 A;  2VGX A;  4U0U A;  2P9I G;  3R7Q A;  3CHO A;  4UWK A;  3JQ1 A;  4GTM A;  3FUH A;  4FJY A;  3TGO A;  4F1S A;  1LD7 A;  4JA7 A;  4HOR A;  2V8S E;  3ZFW A;  3DEP A;  2WXP A;  3ZYM A;  4Q94 A;  2HM8 A;  4JEU A;  3RK6 A;  5BT1 A;  1E8Y A;  3FEY A;  3UIO C;  4B8C B;  2AJA A;  3B7S A;  2HR2 A;  3AG2 E;  1TYQ G;  3CEQ A;  3PEV B;  3FEX A;  4UQZ A;  2GW1 A;  1P5Q A;  5D2M C;  2P9N G;  2A4Z A;  3ZXP A;  1PC2 A;  3HXB A;  2FBN A;  3ZYL A;  2CFU A;  4NQ0 A;  4AXH A;  4KZC A;  3NBN B;  1BD8 A;  5FIO A;  4WWP A;  5CBO A;  2DBA A;  3CSF A;  3ZHE A;  2LO6 A;  5DBK A;  3MJW A;  2J8S D;  2P9K G;  4GA0 A;  2WMO A;  3D9N A;  3CVN A;  1NA3 A;  1X81 A;  4GZ6 A;  2IY0 C;  4AV7 A;  2XCC A;  1MHQ A;  4UWH A;  2L0I A;  5B1B E;  3TWW A;  4I1M A;  1SW6 A;  2XHE A;  2I1K A;  1E90 A;  4O1P A;  4UI9 K;  3OXL A;  2R2L A;  3LJN A;  4TXQ A;  1S63 A;  5AN8 A;  3JUI A;  4MKT A;  2R03 A;  2JLB A;  3LS8 A;  2GRO B;  3U64 A;  1IHB A;  5KJL A;  1U3D A;  2XZT G;  2KM4 A;  2YIN A;  1WY6 A;  4G23 A;  1XGW A;  2YNQ A;  4WUY A;  3CVV A;  3CIA A;  2LSU A;  3NOC D;  5BXU A;  3CLJ A;  1OT8 A;  3LVQ E;  4CGW A;  1Z3Y A;  3TWQ A;  4DUI A;  4EQF A;  3QKY A;  5KWD A;  5LP0 A;  2PL2 A;  1AP7 A;  1TN7 A;  3L6A A;  1MYO A;  3UI2 A;  1E7U A;  3C3Q A;  3LKU A;  3J5P A;  4GA1 A;  1KT0 A;  5ENQ D;  2ETC A;  1KPS B;  3S7B A;  2J09 A;  3F6Q A;  4NIK A;  5AAR A;  3EJN A;  1HS6 A;  3PS6 A;  2ZGG A;  3FUJ A;  2X38 A;  4GB9 A;  3UX4 A;  4HLE A;  2IO3 C;  3CVQ A;  3NF1 A;  1DNP A;  1N0Q A;  3WXX A;  3FU5 A;  4LSZ E;  3EHM A;  4R7L A;  2X6F A;  2XRZ A;  3KS2 A;  2GRQ B;  3CQG B;  3R9M A;  3T5V A;  4RVB A;  1AWC B;  3GW4 A;  3GYZ A;  4LER A;  2NXP A;  4BET A;  3E33 A;  1LD8 A;  4I6E A;  5DIZ A;  5EDS A;  2ETB A;  2E0I A;  2UY1 A;  4YVO A;  4KBQ A;  4KXK B;  2PZI A;  4JC8 A;  1N54 A;  2R5S A;  1YYH A;  4XE0 A;  3FP3 A;  4UI9 C;  1KZP A;  4B93 B;  2MRI A;  5C1D A;  1OCR E;  2LXM A;  1TN6 A;  3DSS A;  2DCP A;  4WNF A;  4M7C A;  2V4L A;  3IXE A;  3URZ A;  3RRN B;  3LJ3 A;  2GRP B;  1D9S A;  4GZC A;  2LAI A;  2L6J A;  2XQ0 A;  4BER A;  4URK A;  1UOH A;  3EUV A;  3LVR E;  3RAU A;  3RU0 A;  2WM9 A;  4JXT A;  2H6F A;  5CMW A;  3QWV A;  2WXH A;  4JEH A;  5CCL A;  5EYL A;  4EZK A;  1HZ4 A;  4F1P A;  4U0Z A;  3LY7 A;  3BEE A;  3GZ2 A;  3HVE B;  2XPI A;  3QAQ A;  3MKQ A;  4HRM B;  5AQB A;  4RQI A;  4HOS A;  1IHG A;  2WXF A;  3IHY A;  3BU8 A;  3HIZ A;  5ENT D;  3D9J A;  3FHE A;  4NAC A;  3OXG A;  4DLO A;  3UKR G;  2DWZ A;  4A1S A;  5FQ4 A;  5HS0 A;  2KAT A;  3CHM A;  2CG3 A;  5T4Y A;  2ETA A;  5FWQ A;  3BQO A;  4EEC A;  1TNU A;  3HXC A;  4O60 A;  1O5M A;  4GML A;  5LOZ A;  1JCQ A;  4XEI G;  4A55 A;  3KEZ A;  5IY5 E;  3PEU B;  2R17 C;  2B6C A;  2AWI A;  1QBQ A;  3LPZ A;  3Q47 B;  1NI1 A;  2HO1 A;  5H7P A;  1BPO A;  3AJI A;  3Q49 B;  3Q15 A;  1TJC A;  3TWU A;  4ACL A;  5CHE E;  2VYI A;  1YMP A;  3CHP A;  4LNU D;  4G2V A;  4DX5 D;  4GCN A;  3SGH A;  3DPD A;  3CV0 A;  5G05 C;  4XZ4 A;  4F53 A;  3MKR A;  4I17 A;  5ENR D;  5EIB E;  2J9Q A;  1HU3 A;  1U3C A;  3PZ1 A;  4ILI A;  2J4D A;  3GZS A;  1UJK A;  3SZ7 A;  3Q79 A;  3E37 A;  3V79 K;  1EDU A;  1O1T A;  3DEO A;  1E8X A;  5FJY A;  4H7Y A;  4J8D A;  3TWR A;  4XI9 A;  2H6G A;  1HFA A;  1L5J A;  4K5A B;  2PNN A;  4H7X A;  3QWW A;  1KLX A;  4XKC A;  2DYS E;  4BX9 A;  3SO8 A;  1SZA A;  2H6H A;  1Z5S C;  4FLB A;  2IEJ A;  5AEN A;  3ZIM A;  4CDM A;  4G26 A;  4G11 A;  2LSV A;  3D9O A;  4LEU A;  5CBN A;  5HKP A;  1HX8 A;  4EBA G;  2V0P A;  2L6B A;  1TR4 A;  2B0O E;  3PZ4 A;  4ABN A;  4UI9 J;  3FUK A;  5B1A E;  2Y69 E;  2ION A;  5JHA A;  1WG0 A;  4MLP A;  5BV0 A;  5M72 A;  5KJK A;  4ANW A;  3IHV A;  2X6K A;  2XEE A;  5A6C A;  3BG1 B;  3J5Q B;  3EIQ C;  4M3O A;  3JCK C;  2P9P G;  1EF1 C;  1OWM A;  1HE8 A;  4AM9 A;  5ENP D;  4GPM A;  4ACK A;  4ILH B;  3B7T A;  4CT0 A;  1MX2 A;  1H19 A;  3TXN A;  3IV0 A;  3CHS A;  1BU9 A;  4GCO A;  1DC2 A;  3MX3 A;  3UXG A;  4YND A;  1RZ4 A;  3D3M A;  1JCR A;  3CVW A;  4LG6 A;  4N2S A;  4BT8 A;  3T9K A;  4O1O A;  4JB8 P;  3HXE A;  2OND A;  2FI7 A;  2XCB A;  4K5C A;  4ANV A;  3HYM B;  3I4R B;  1HH8 A;  3NAW A;  1Z3X A;  1FVH A;  3N71 A;  4AVX A;  4K03 A;  3DSW A;  1EPU A;  2WXK A;  3FTV A;  4AOF A;  4GTO A;  1X5B A;  1N94 A;  3QNK A;  3KD7 A;  2ZIS A;  3S7D A;  4JW1 A;  4JHJ A;  2LUH A;  4GMJ A;  4V3I A;  3MV3 B;  3KEA A;  4J8E A;  2QFC A;  4MS6 A;  4N2Q A;  3FUL A;  4GMR A;  2OCC E;  3C5R A;  3R7R A;  1TEZ A;  3Q9N C;  4LCT A;  5CRV A;  4DX2 A;  2J08 A;  3PRE A;  5AJD A;  4GTV A;  3MV2 B;  1K1B A;  2AXV A;  1A17 A;  5G05 J;  5BV1 A;  1OWL A;  3U3W A;  3RKV A;  2GRL A;  4XI0 A;  4MRU A;  4CGV A;  4FHJ A;  4OAV B;  2Y4U A;  3HRA A;  2IU1 A;  4FUL A;  2P58 C;  1N9A A;  2KZT A;  4OYS A;  3EHR A;  2MYO A;  2C0M A;  3C98 A;  1UN8 A;  4BFR A;  4OAU C;  2F8X K;  5EYP F;  1ELK A;  1DVP A;  3FUE A;  4WWN A;  4N3A A;  1MX4 A;  4J8S A;  4ATZ D;  2OVB A;  4WNG A;  1QYM A;  4TV3 A;  4WNE A;  4BT9 A;  2R05 A;  2KCK A;  4L2Y A;  5CRU A;  4TUM A;  4ME2 A;  1E8W A;  5ITZ F;  5FT9 A;  4EPZ A;  3Q5M A;  3AU5 A;  3I4G A;  5FIN A;  2OEV A;  4L23 A;  1YA0 A;  3T8M A;  4G8K A;  2CHW A;  1D8D A;  3FUI A;  2GRM A;  4EHM A;  3ML9 A;  3QK0 A;  2CHZ A;  3ULY A;  2PQN A;  3OXF A;  3CST A;  4G25 A;  3FU0 A;  3SD5 A;  3G2V A;  3PRZ A;  1WAO 1;  3AG4 E;  4KVO A;  4UUC A;  3CVP A;  1FPP A;  3AG3 E;  4HLL A;  5EX3 A;  2M63 A;  3P2B A;  4N5C A;  4HOT A;  3ASG A;  3ZEF A;  3CVL A;  2A5U A;  4GTT A;  2WXN A;  4Y6C A;  5LX8 A;  2J4B A;  5CMY A;  5JA4 D;  2BUG A;  1D8E A;  4HRN A;  1BLX B;  3UM0 A;  4U8H A;  5KCM A;  4PDX A;  1UW4 B;  4JL0 A;  5KNH D;  1JPL A;  5BUZ A;  3MGB A;  2WMN A;  4HRL A;  3ABK E;  4G1T A;  2IJG X;  4FLH A;  3MKQ B;  3U9W A;  1SQM A;  2QY7 A;  3V31 A;  1EYH A;  3T5X A;  4HI9 A;  4ATG A;  4TRQ A;  4J6I A;  2QC9 A;  3NZU A;  3TL5 A;  2Y0B G;  4C0M A;  3DBS A;  5EID A;  3MZL B;  4I9C A;  3JXI A;  4KVM A;  3B13 A;  2V4H C;  4OVV A;  5AJL A;  4L2L A;  3UM3 A;  3D9I A;  2QYJ A;  3ZPJ A;  1QQE A;  2RKK A;  2OV8 A;  2WPV A;  4APF A;  3OTN A;  2KCV A;  4P29 A;  2P9L G;  2WQ7 A;  5EX0 A;  2Y1L E;  5ARF A;  3CKC A;  5BXO A;  2VJ8 A;  3SF4 A;  3ZNG A;  4U07 A;  5J90 A;  4EZL A;  2P9U G;  4L9P A;  4RG6 A;  4ZFH A;  2OEW A;  3CVU A;  3ZKJ A;  4FAD A;  1OCC E;  5D0O D;  3ZXS A;  1V55 E;  2I1J A;  3FUD A;  3ULQ A;  4WWO A;  3UUX A;  4EZJ A;  5T3R A;  3G2S A;  1OWO A;  4JD2 G;  4IUL A;  4GZD A;  1A5E A;  3FWV A;  4HS2 A;  3RJV A;  3ONL A;  4G8L A;  3L22 A;  4UQY A;  1TNO A;  4LRZ A;  3B7U X;  3E4B A;  3O4Z A;  2F37 A;  4BX8 A;  3MEK A;  3UT4 A;  3TXM A;  3V2O A;  1BI7 B;  5KJN A;  3TWX A;  3K9I A;  3DXK G;  1H0A A;  4PS3 A;  4B8A A;  3ESK A;  4IN3 B;  4J8F A;  1OWP A;  1Q2Z A;  3SNX A;  1E96 B;  3RRM B;  5JJT A;  3LY8 A;  3PUJ A;  4GTS A;  2Q7F A;  2WXG A;  5FQ8 A;  3UIP C;  4FU3 A;  2XS1 A;  4DX1 A;  2A5E A;  3DPY A;  5EKQ D;  1SZ9 A;  4MBG A;  3C72 A;  2HYZ A;  4GPK A;  3ASF A;  3DSV A;  4I1A A;  2DVW A;  4TUU A;  3ISM C;  3ZYQ A;  3MYV A;  2P2C P;  3Q7A A;  4GA2 A;  3CVY A;  3APC A;  2ZGD A;  4WND A;  3C3R A;  3LCA A;  4GYY A;  4XIF A;  2Y4T A;  3QB2 A;  2CG2 A;  2NC9 A;  4UQX A;  3APD A;  3AS8 A;  3FFL A;  1ZB1 A;  3OAW A;  4B89 A;  4U8V D;  4F7A A;  3SBS A;  3ASH A;  1QZ2 A;  3D9M A;  2L0T B;  3RO2 A;  4DI4 A;  5G2N A;  5CED B;  2XGO A;  4C48 B;  4N5Q A;  1S64 A;  3QAR A;  2RFA A;  4GZ3 A;  3HVE A;  2VQ2 A;  4CEM A;  1FVF A;  3VLF A;  4GAA A;  1ZBP A;  3TAX A;  2FEZ A;  4WAF A;  3CK7 A;  5BNW A;  3NZS A;  3Q78 A;  2GRR B;  1K1A A;  2FO7 A;  4JA9 A;  3V2X A;  1ELR A;  1IQU A;  4DX6 D;  3L54 A;  3AS5 A;  4KT6 B;  4ILG A;  5E75 A;  2VSX E;  4B94 A;  1H2V C;  4L7T A;  1Z6T A;  2PM7 A;  3KSL A;  2DZO A;  4RSY A;  4U63 A;  2X3M A;  1O1S A;  2IQC A;  3SFY A;  2GGF A;  3BUA A;  1JUQ A;  5E76 A;  2VGX B;  2WXQ A;  3QWP A;  4E6H A;  2J07 A;  2IFU A;  1NA0 A;  3KSQ A;  3ESL A;  2V5Q C;  4DRX E;  2VSO E;  1U2V G;  1INZ A;  2EIJ E;  3NQP A;  3EHN A;  4A3V A;  3B7B A;  2JAB A;  4U95 D;  2R02 A;  1OWN A;  5FZR A;  4J0U A;  3D9L A;  1O1R A;  1N52 A;  1YCS B;  3SI5 A;  2EQX A;  3TG4 A;  3SY2 A;  4BTA A;  3T8K A;  1W3B A;  2WXJ A;  2UWJ G;  2PM6 A;  1HF8 A;  1UN9 A;  3CQC B;  2HE0 A;  3AS4 A;  3FH8 A;  5FTP A;  3LDZ A;  1OUV A;  1HG5 A;  1QNF A;  3I5P A;  3PDN A;  3G2U A;  1H2T C;  4B0Z A;  3TJP A;  3ZYK A;  2WXM A;  4IRU A;  2ZXW E;  2FUL A;  3ML8 A;  2I9C A;  3SFZ A;  1ELW A;  3SFX A;  2LAH A;  3ZHE B;  2EIL E;  3DSX A;  4Q96 A;  1N11 A;  5A23 A;  3ZRH A;  1E8Z A;  3ULE G;  4QQI A;  4I6J A;  1H6O A;  3JQ0 A;  3BG0 B;  2XEV A;  3S7F A;  3RIB A;  3UMV A;  5KBA A;  3ONK A;  1N95 A;  4LNB A;  5D66 A;  3RO3 A;  1H6K A;  3NOG D;  4BES A;  2JEK A;  2KBX A;  1MQS A;  1DCE A;  3L08 A;  3EIJ A;  1JWG A;  1S70 B;  3LYA A;  2X6I A;  5D0Q D;  4AY5 A;  1ZU2 A;  4K5B A;  4JVS A;  2RG8 A;  1N4R A;  3L16 A;  4ZHB A;  1IKN D;  1H2U A;  2BTD A;  5KJM A;  3RRU A;  4U7E B;  1TN8 A;  2VTB A;  4ANX A;  3AG1 E;  2WB2 A;  3Q7F A;  3PE4 A;  4AP2 A;  3Q75 A;  4GYW A;  4KZ0 A;  2X6J A;  1FT1 A;  5AIJ A;  5FZS A;  4OVU A;  4AEZ C;  4YDE A;  2AXU A;  3CHQ A;  1MJ0 A;  3FUM A;  1E7V A;  3U66 A;  2BED A;  2BKG A;  5J08 A;  2XZD G;  1BI8 B;  4KYO B;  1MX6 A;  4GTP A;  2QYU A;  4FA6 A;  4AJW A;  4W9R A;  3TG5 A;  3SHF A;  3VLE A;  2J49 A;  4KMO A;  3CGH A;  4HNA D;  3FTX A;  2UY1 B;  3V30 A;  4U8Y D;  1OXJ A;  2YHC A;  2WQ6 A;  4GU5 A;  4FJZ A;  5EN5 D;  3FTW A;  3I3N A;  4GZ5 A;  1B89 A;  2XPY A;  4K0R A;  3FU6 A;  4O6F A;  1KT1 A;  4GTR A;  2KCL A;  2LXL A;  3PNT B;  4HXI A;  4CYM D; 
#chains in the Genus database with same CATH homology
 4TXP A;  4TXR A;  2RKK A;  2LXL A;  2LUH A;  4U7E B;  4TXQ A;  2LXM A;  5H7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...