2LXMA

Lip5-chmp5
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
163
structure length
163
Chain Sequence
MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of the Human LIP5 Regulatory Protein with Endosomal Sorting Complexes Required for Transport.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Vacuolar protein sorting-associated protein VTA1 homolog
total genus 60
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 2lxmA00
2RKKA 4TXRA 5H7PA 4TXQA 2LXMA 4U7EB 2LXLA 4TXPA 2LUHA
chains in the Genus database with same CATH superfamily
3DXKG 3ESKA 3AS5A 3QK0A 5AQ9A 2XQ0A 2WQ6A 4LERA 5G55A 3JQ1A 1FVFA 5FT9A 4EZLA 1H6PA 1Y6IA 1OXJA 5CHEE 3FUJA 1U2VG 3LS8A 1ELWA 1WY6A 4CDNA 4YDYA 2RFAA 2WB2A 1NI1A 3EJNA 3CHPA 4HOUA 4GTRA 4IRUA 1OWMA 3GZ2A 4D10C 3UXGA 2XEHA 3ESLA 4A1GA 1EDUA 4URKA 4XX5A 4UQXA 4HNAD 3LXUX 3LDZA 3HDXA 1WG0A 4XI0A 5FJYA 5G04C 4UQZA 2GRQB 4GYOA 1N11A 1BD8A 3Q7AA 3E34A 3G2VA 1FT2A 4A3VA 3QAQA 5KWDA 4CYMD 3VTYA 5EN5D 3EIQC 1FCHA 3R7RA 5AJLA 1HZ4A 2OVBA 3TWUA 5CMWA 1G3NB 2EQXA 3Q49B 3MJWA 3URZA 4UUCA 2XPZA 5AQBA 3EDTB 4XKBA 5CEDB 5ENOD 3CHMA 3TGOA 2A5UA 1TNUA 4FJYA 1Z3XA 1ZU2A 2XZDG 3FH8A 3UT8A 3ZYLA 3MEKA 1JWGA 2WXOA 1TNOA 4HI8A 4EPZA 3SNXA 3HXDA 3PREA 4KBQA 1NA3A 4U04A 3ZYKA 4MRUA 4GA0A 1IQRA 2CHXA 3BQOA 3GZSA 2R59A 3PE3A 2F37A 5B1AE 2AXUA 3NQPA 2XZTG 4TUUA 2J08A 4EZJA 4BETA 2WXIA 5FQ7A 1NZNA 2AXVA 4DK5A 1N4SA 5FIOA 3LVQE 3LKUA 2ONDA 4Q69A 3ONLA 5BPPA 4H7YA 4JA7A 1OWOA 2PQRA 2BEDA 1S64A 4BTAA 5T4YA 4A55A 3FDHA 4JHJA 5BXOA 1D9SA 5HS0A 4GCOA 4Q96A 4Z68A 3NF1A 2EIJE 4J8EA 4L2YA 2DZNA 2Q7FA 1QBQA 2P9LG 2ILRA 3QKYA 4BT8A 3ZUVB 2GRLA 2Y1LE 4L2LA 4U63A 2QFCA 3DPYA 2CHZA 2XENA 1OCZE 4CT4A 4KZCA 2ZGGA 4FA6A 2QYJA 2WXLA 2HO1A 2WXGA 2QYUA 5ITZF 2QY7A 4HBDA 2GRMA 3E4BA 3ZPJA 4NURA 4DRXE 3PNTB 2VGYA 3AU4A 4GTPA 3CIAA 3LEWA 2GRRB 4F1SA 2R5SA 4I6JA 1S0PA 3QARA 4BSZB 3FTSA 4GZDA 4KVOA 3QJZA 1D8DA 1H2UA 3D9OA 3OTNA 4I9CA 3CVVA 5A7DB 4B8CB 3Q75A 5FQ4A 2XHEA 4OYSA 1WM5A 3QDNA 3U9WA 4GZ3A 3JUEA 4C9BB 3PNLB 1E7UA 2PZIA 3FP3A 4HOQA 3C3OA 4FLHA 4JXTA 3FHEA 3AG4E 2JABA 4GMRA 4JW1A 4JB8P 1AP7A 4FHJA 4TXPA 3GYZA 1OY3D 4HI9A 1PY1A 2X6FA 3ISMC 3R7QA 3NZSA 1YYHA 4A63B 3FH7A 3GZ1A 3APCA 4I9EA 5ANLA 4N3BA 3LY8A 3ASDA 5ENSD 1MX2A 5CCLA 4ANUA 4PS3A 3AU5A 1N9AA 5FTPA 1E8YA 5A6CA 5CBOA 4XIFA 4ATGA 4B89A 4TXQA 2IF4A 1DCQA 1QZ2A 3UPVA 2KBXA 5HQ8A 4N3AA 4J0UA 4J6IA 2MYOA 5FZQA 1Y8MA 3L6AA 3P2BA 3KAEA 4TV3A 4U0UA 4GMLA 3PRZA 4EBAA 3ULQA 4RQIA 4HQDA 4WWNA 3DSUA 4UI9J 3TWTA 4C48B 5EILA 2X6JA 4JPSA 2YHEA 1OUVA 3GW4A 3F6QA 2FO7A 3EHMA 2PNNA 3DRAA 3E30A 1HX8A 4PH4B 5BT1A 4L23A 4AOFA 3MA5A 5KJKA 1TNBA 4L7TA 1HG5A 2VGEA 3FU3A 3O4ZA 2UWJG 1YCSB 5CMYA 5J08A 2XRYA 4CEMA 2IO3C 5ENQD 2XPYA 4L9PA 1BU9A 4GTTA 2IEJA 5LX8A 4IYPA 1MHQA 3CSTA 4DX1A 1SZAA 2HYZA 4G11A 3APDA 3C3RA 4J8DA 3SHFA 2XEVA 1DCEA 3SFYA 3MCXA 4NQ0A 1H2TC 3ASOE 5FWQA 3SO8A 2R02A 2LAHA 3MKRA 1MQSA 3WXXA 2DYSE 3FUEA 3LY7A 4X8QA 3PEUB 2GRNB 2L9BA 3O48A 4EECA 3T8KA 2F0YA 2AWIA 5B3SE 4HOSA 3FTZA 3B95A 1A5EA 3QNKA 3CR3A 3OXGA 1KLXA 3RO2A 1E90A 1TN8A 3QOUA 4CZ2D 4TXRA 1XGWA 2LAIA 5ENPD 1HO8A 3B7RL 3IKOB 2X38A 1HE8A 3LVRE 2F8XK 5CCMA 4N5CA 3VTXA 4BY6A 2GRPB 3FUIA 4IN3B 2RG8A 4KXKB 4DX7D 2CHWA 4MKTA 2CFUA 3FFLA 3ZNGA 3ZXSA 4TRQA 4QFVA 3ZKJA 4BTBA 3FTVA 3UIOC 4GZ5A 2CG3A 2XGSA 5KBAA 2DVWA 3NAWA 2VSYA 4JC8A 4DI4A 3Q5MA 3ABKE 3LY9A 2J9QA 1LF8A 4MBGA 5KCMA 5EIBE 3UINC 2A5EA 3CKCA 3EU9A 3ZN3A 4XI9A 4DX2A 1RZ4A 3IHVA 4U7EB 1N94A 3KD7A 3ASNE 3BUAA 1SVXA 5CRVA 4LNUD 3DSXA 4HORA 2QC9A 4FP7A 3SFZA 4WAFA 4YDWA 3CK9A 4U0ZA 4N2QA 3DBSA 1OCCE 3CQCB 2NC9A 5BV0A 3HXEA 2YINA 2ETBA 3APFA 4PUCA 3MYVA 3UT4A 5HRYA 3Q79A 4FULA 2J4BA 3B7SA 1FPPA 3KS2A 1KT1A 1TJFA 4PDXA 5IY5E 1LD8A 3OXFA 3G2WA 2J09A 5A23A 2BTDA 3FUFA 5KJMA 4LSZE 2KCKA 5T8IA 4BEPA 5CEAA 4GAAA 5CECB 3ASHA 3UI2A 2YQ8A 1N52A 4UI9C 5ENRD 1KZPA 4A1SA 1HXIA 2V8SE 5BW8C 5C1DA 2E2EA 2YHCA 4I1OB 3CLJA 1V54E 4EBAG 3TWSA 3QWPA 4JEHA 2IY0C 2KXPC 4U07A 1HS6A 2L6BA 4O6FA 1N0RA 4JA9A 3TWRA 2WXFA 2WXHA 3L22A 2R17C 4CCAA 2UY1A 3HIZA 4DUIA 3V31A 3UTMA 2P9UG 3FWVA 1MZCA 4J7WA 1HF8A 1EYHA 2AW6A 3VLDA 2P9NG 3VLEA 3TJPA 4MLPA 3ENEA 2B6CA 3NOGD 1SZ9A 2V4LA 4I1MA 2ETCA 4UI9K 3ZW3A 4O60A 3D9JA 4APOA 4AY6A 2LNIA 4N3CA 4GPMA 1O1RA 4JHKA 3QWVA 4GA1A 4BT9A 3CVWA 4A3TA 1U3DA 2L0IA 2DIWA 5JHBA 3U66A 4OVVA 2LUHA 2R2LA 4ILGA 1H6KA 3DSWA 5LCWC 2HE0A 3UM1A 3UIPC 4RG6A 2L0TB 4RSYA 3TXNA 3ML8A 1IHGA 4WNEA 2VQ2A 3L9TA 5KNHD 3PZ3A 1NA0A 1NL4A 3E37A 1TJCA 3CK8A 4CDRA 3ZXPA 5JJTA 5EIDA 3ZYMA 5E75A 2KATA 4EZKA 1IKND 2LXMA 4AJWA 3FUMA 3CGHA 4TUMA 4IULA 3ONKA 5J90A 2ZXWE 2J07A 4J8SA 3IXEA 1JCRA 2VJ8A 4CGVA 4JD2G 1KZOA 3SZ7A 3D9NA 4XE0A 4GTSA 2V5FA 2OEWA 4C0EA 3DEPA 3Q15A 5AARA 3CVUA 3S7BA 5CERB 4UWHA 4FHKA 2OVFA 3EHQA 3ZHEA 3T9KA 5ENNA 2QZAA 3ZRHA 2X6HA 3D9MA 1FT1A 4B0ZA 2KZTB 1K8KG 4LNBA 4BESA 1W3BA 2LO6A 2EINE 5LP0A 1LD7A 4F7AA 4F3VA 3PZ2A 4DLOA 3AS8A 4JVSA 4UQYA 3PS6A 5EKQD 4HFGA 4I43A 2ETAA 4JL0A 3MGBA 5C2YA 4J8YA 3KSLA 2I1KA 1H19A 2X6KA 1V55E 2DBAA 4UWFA 4UWLA 3LYAA 4B93B 3MZLB 2WQHA 2V5QC 4K0RA 3CVPA 3ZEFA 5AAOA 4RLYA 3Q4AB 4ME2A 1RW2A 1TNYA 4XZ4A 2KC7A 3PZDA 1SW6A 3DPDA 2AVPA 1JCQA 3CHRA 2EIME 3CVYA 3SD5A 4WNFA 3UKRG 4E6HA 4KZ0A 3Q78A 3W9FA 4DX5D 2I2OA 2RFMA 4EQFA 2JLBA 3RAUA 2PM6A 1TN7A 5EYPF 4O1OA 1MX4A 3OAWA 4WNGA 1JPLA 1OWNA 1Z6TA 4DI3A 4G8KA 3AG3E 1OCRE 4G2VA 4GTOA 2J8SD 1B89A 1Z5SC 5ARFA 4B8AA 1O5MA 5ANRA 4AM9A 3EIJA 3SBTB 3IHYA 3HHMA 3FUHA 2VGXB 3QWWA 4UWGA 3TG4A 4R7LA 4Y6WA 3CQGB 4HRLA 3RRUA 3EHRA 4U95D 1N4QA 4ZFHA 3PEVB 2BUGA 3FUKA 1E96B 2ZU6B 4GZ6A 3NBNB 1NFIE 4ABNA 5LOZA 5HKPA 2WQ7A 3S7DA 4OVUA 5AIJA 3OXLA 3FUNA 4FC8A 2X3MA 3BEEA 1QQEA 3SFXA 2H6HA 2IQCA 1KT0A 4HVBA 4LEUA 3TAXA 4FJZA 3HG0D 1ZBPA 4I2ZA 3SBSA 2AJAA 2FEZA 3W9GA 4GTMA 4V3IA 3E33A 4L1BA 4XKCA 2F8YA 3R9AB 3AG2E 5DIZA 4C0MA 1MYOA 4AV7A 3DSVA 3DSTA 3BU8A 1LTXA 1PAQA 4F6RD 1K1BA 2UY1B 1E8ZA 3MKQB 4W9RA 1K3ZD 3BG1B 4GMJA 3TWVA 1X81A 4I2WA 3HYMB 5BV1A 2WXRA 4K03A 2DWZA 4DJAA 3HVEB 3JQ0A 5BUZA 2XCBA 4AY5A 4WWOA 4EHMA 2PQNA 2P58C 4H7XA 3RU0A 1O1TA 2H6GA 2R05A 2EIKE 4G24A 2CFZA 3KSQA 3RO3A 3ZFWA 2NXPA 2C2LA 5EX0A 2C0MA 3L17A 3AAAC 4YVQC 4F53A 2VSOE 2DYRE 3G2SA 5FZSA 2P9PG 3FTXA 5CRUA 4P29A 3UQ3A 3L13A 2RKKA 3KEZA 5T3RA 3NOCD 4GPKA 1DVPA 2MRIA 1ELKA 1HU3A 5FINA 1UN9A 4KVMA 3UT7A 3FTUA 2LSVA 4PS8A 1HFAA 4N2SA 1YMPA 2XGOA 3SI5A 5LCWJ 3MV3B 4BSXA 4ANWA 3I4RB 1U3CA 1H6OA 3CVLA 2DCPA 2CG2A 1Z3YA 2PL2A 1P5QA 2XEEA 3V2XA 3SGHA 1IYGA 4UWKA 3Q7FA 3UX4A 5AN8A 1SA5A 3JCKC 4PS7A 4NACA 1FVHA 2WXJA 4KT6B 3Q9NC 3L08A 2H6IA 2WXPA 3CK7A 3PVLA 2WPVA 3NB2A 2BF0X 3FEYA 3ZGQA 3IEGA 4BX8A 1BI8B 4G26A 1YA0A 3RRNB 2HR2A 1N54A 2IONA 2WXQA 4ANXA 1MJ0A 3VLFA 1ELRA 2KZTA 3D9PA 4OAUC 4G1TA 5AQAA 4DLQA 3EUVA 4KMOA 4LG6A 3B7UX 3IBEA 3EU5A 4YDEA 5BXUA 2VSXE 2IJGX 4APFA 1O1SA 4NIKA 3B7BA 4FU3A 5JA4D 1SA4A 2IOSA 2I1JA 4O1PA 1VDYA 3ABME 2ZGDA 3RRMB 2KCLA 5KNGA 3WG7E 2FF4A 1OT8A 2HM8A 5JHAA 1E7VA 2WVIA 1N95A 4YNDA 2VSNA 4GZCA 2XCCA 4HB5A 1HG2A 3AG1E 3S7JA 3UUXA 1EPUA 4HS2A 3ABLE 3X2QE 3PH0C 3R9MA 4HRMB 4AVXA 1N0QA 3TWQA 3D9IA 5JMND 2OV8A 3FTYA 3EHNA 2OEVA 1OWPA 3JXIA 2J49A 1MX6A 1TN6A 4WNDA 5CBNA 1IHBA 3TG5A 4HLEA 4GTVA 5E76A 3UM3A 2J4DA 2LSUA 5D0QD 3HRAA 2M63A 2EILE 3T5VA 3ZVVA 2AXZA 2KM4A 3I5PA 4DPRA 3SQVA 2VYIA 3LPZA 3LJ3A 4GCNA 3CHOA 4LUNU 3TWXA 4JZYA 1JCSA 4RVBA 3LJNA 3I3NA 2WXNA 3C3QA 3ML9A 4K5CA 1QNFA 2MOWA 1TEZA 5KJLA 3HXCA 3Q9UC 4BX9A 3B13A 2VGXA 3S7FA 4N5QA 2WM9A 3SF4A 3PE4A 1SQMA 3CVQA 1UN8A 3D3MA 4N39A 2WMOA 4I6EA 2DZOA 5B1BE 4I6GA 1KPSB 1IQUA 1GW6A 2H6FA 1UW4B 2VTBA 3UKUG 3ASFA 5D0OD 2XPIA 3U64A 2FI7A 3DWLG 5M72A 3JYSA 3C5RA 5BNWA 5DBKA 4GA2A 2XGMA 3P1UA 3FTWA 2P9SG 3L16A 3Q73A 1L5JA 3JUIA 2WMNA 4Q94A 2IO2C 1HH8A 2C0LA 3CEQA 3CHSA 5KJNA 3LCAA 4U8YD 4G25A 1Q2ZA 5FZRA 3J5QB 2B0OE 3MKQA 1WAO1 3AS4A 2V0PA 3Q47B 5HI7A 3T8MA 2GROB 4ATZD 1BLXB 3UM0A 2FULA 2R03A 3CKBA 2XS8A 4KYOB 3C98A 3HVEA 3UMVA 2BKKB 4B94A 2NSZA 3MX3A 4ILIA 3FY4A 3DSSA 4LRZA 5G05J 2Y4TA 5G2NA 2Y4UA 5EDSA 4K5BA 2GGFA 3ZYQA 3HXFA 1XNFA 1K1AA 3L54A 3RKVA 1UOHA 4K5AB 5G05C 3SY2A 3KEAA 2V4HC 5H7PA 3DEOA 2BKGA 4NRHB 4WUYA 2WXMA 3RJVA 2ZISA 3TL5A 4ACLA 4F1PA 1OWLA 4GTQA 3G2UA 4U0SA 4I17A 3ULEG 3U3WA 3D9LA 2XS1A 4AEZC 1X5BA 3V79K 3MV2B 1PC2A 5D2MC 4J8FA 1E8XA 3G2TA 2OOEA 2I6HA 2I9CA 4I1AA 3FU6A 3CVNA 3JXJA 2NYJA 5LFAA 3D9KA 1E8WA 4RG9A 3S2AA 2KCVA 4M7CA 1AWCB 4WWPA 4GU5A 4FADA 4GB9A 2PM7A 4BERA 2A4ZA 3B7TA 3FU5A 3D9HA 3CV0A 3FEXA 1D8EA 3ZU7B 4DX6D 4AP2A 3ZIMA 4AIFA 3U4TA 2IU1A 1EF1C 3NZUA 2FBNA 5G04J 3FULA 5ARGA 1N4RA 5AENA 3FUDA 1QYMA 3ASGA 2XRZA 1TNZA 5D66A 2IOLA 4LNGA 2L6JA 4ILHB 4CRWA 3AJIA 3J5PA 3HXBA 4JEUA 2P9KG 2Y3AA 1JWFA 3RK6A 5EX3A 5FQ6A 3QC1A 2E0IA 2MHKA 4OAVB 1TYQG 1JUQA 4ZHBA 1N4PA 4HLLA 4Y6CA 3ZHEB 4HOTA 3V30A 4E85A 3CVXA 4CT0A 4FLBA 1UG3A 4U8VD 3E32A 1BPOA 4BWRA 4HXIA 2LXLA 1OCOE 3CHQA 1UJKA 2ZIRA 1TR4A 3TXMA 3FU0A 3TWWA 4ANVA 1H0AA 3V2OA 3ULYA 1IXVA 3PZ4A 4GYYA 5FQ8A 1S70B 4G23A 3UM2A 1A17A 4YDOA 3T5XA 4MS6A 4QQIA 1S63A 4JHRA 3FH5A 2YNQA 2OCCE 4XEIG 3L82A 1WDYA 2GW1A 2FO1E 1NP7A 3PUKA 2IFUA 3RIBA 4ACKA 5AYWD 2X6IA 2RD0A 3I4GA 4CDMA 3CSFA 5ENTD 3PDNA 3PZ1A 2Y69E 3K9IA 5JJ6A 4GYWA 3N71A 1BI7B 3QB2A 1DC2A 4AXHA 5EYLA 4CGWA 1ZB1A 2JEKA 4G8LA 4U8HA 3PUJA 4HRNA 1DNPA 2P9IG 1UJJA 3RSEG 1H2VC 1INZA 2Y0BG 4YVOA 3C72A 5JJ7A 5AQ7A 2VTBB 4LCTA 3BG0B 3IV0A 5AJDA 4M3OA 4U96D 2P2CP 4BFRA 3DXMG 2WXKA
chains in the Genus database with same CATH topology
2RKKA 4TXRA 5H7PA 4TXQA 2LXMA 4U7EB 2LXLA 4TXPA 2LUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RKK A;  4TXR A;  5H7P A;  4TXQ A;  2LXM A;  4U7E B;  2LXL A;  4TXP A;  2LUH A; 
#chains in the Genus database with same CATH topology
 3DXK G;  3ESK A;  3AS5 A;  3QK0 A;  5AQ9 A;  2XQ0 A;  2WQ6 A;  4LER A;  5G55 A;  3JQ1 A;  1FVF A;  5FT9 A;  4EZL A;  1H6P A;  1Y6I A;  1OXJ A;  5CHE E;  3FUJ A;  1U2V G;  3LS8 A;  1ELW A;  1WY6 A;  4CDN A;  4YDY A;  2RFA A;  2WB2 A;  1NI1 A;  3EJN A;  3CHP A;  4HOU A;  4GTR A;  4IRU A;  1OWM A;  3GZ2 A;  4D10 C;  3UXG A;  2XEH A;  3ESL A;  4A1G A;  1EDU A;  4URK A;  4XX5 A;  4UQX A;  4HNA D;  3LXU X;  3LDZ A;  3HDX A;  1WG0 A;  4XI0 A;  5FJY A;  5G04 C;  4UQZ A;  2GRQ B;  4GYO A;  1N11 A;  1BD8 A;  3Q7A A;  3E34 A;  3G2V A;  1FT2 A;  4A3V A;  3QAQ A;  5KWD A;  4CYM D;  3VTY A;  5EN5 D;  3EIQ C;  1FCH A;  3R7R A;  5AJL A;  1HZ4 A;  2OVB A;  3TWU A;  5CMW A;  1G3N B;  2EQX A;  3Q49 B;  3MJW A;  3URZ A;  4UUC A;  2XPZ A;  5AQB A;  3EDT B;  4XKB A;  5CED B;  5ENO D;  3CHM A;  3TGO A;  2A5U A;  1TNU A;  4FJY A;  1Z3X A;  1ZU2 A;  2XZD G;  3FH8 A;  3UT8 A;  3ZYL A;  3MEK A;  1JWG A;  2WXO A;  1TNO A;  4HI8 A;  4EPZ A;  3SNX A;  3HXD A;  3PRE A;  4KBQ A;  1NA3 A;  4U04 A;  3ZYK A;  4MRU A;  4GA0 A;  1IQR A;  2CHX A;  3BQO A;  3GZS A;  2R59 A;  3PE3 A;  2F37 A;  5B1A E;  2AXU A;  3NQP A;  2XZT G;  4TUU A;  2J08 A;  4EZJ A;  4BET A;  2WXI A;  5FQ7 A;  1NZN A;  2AXV A;  4DK5 A;  1N4S A;  5FIO A;  3LVQ E;  3LKU A;  2OND A;  4Q69 A;  3ONL A;  5BPP A;  4H7Y A;  4JA7 A;  1OWO A;  2PQR A;  2BED A;  1S64 A;  4BTA A;  5T4Y A;  4A55 A;  3FDH A;  4JHJ A;  5BXO A;  1D9S A;  5HS0 A;  4GCO A;  4Q96 A;  4Z68 A;  3NF1 A;  2EIJ E;  4J8E A;  4L2Y A;  2DZN A;  2Q7F A;  1QBQ A;  2P9L G;  2ILR A;  3QKY A;  4BT8 A;  3ZUV B;  2GRL A;  2Y1L E;  4L2L A;  4U63 A;  2QFC A;  3DPY A;  2CHZ A;  2XEN A;  1OCZ E;  4CT4 A;  4KZC A;  2ZGG A;  4FA6 A;  2QYJ A;  2WXL A;  2HO1 A;  2WXG A;  2QYU A;  5ITZ F;  2QY7 A;  4HBD A;  2GRM A;  3E4B A;  3ZPJ A;  4NUR A;  4DRX E;  3PNT B;  2VGY A;  3AU4 A;  4GTP A;  3CIA A;  3LEW A;  2GRR B;  4F1S A;  2R5S A;  4I6J A;  1S0P A;  3QAR A;  4BSZ B;  3FTS A;  4GZD A;  4KVO A;  3QJZ A;  1D8D A;  1H2U A;  3D9O A;  3OTN A;  4I9C A;  3CVV A;  5A7D B;  4B8C B;  3Q75 A;  5FQ4 A;  2XHE A;  4OYS A;  1WM5 A;  3QDN A;  3U9W A;  4GZ3 A;  3JUE A;  4C9B B;  3PNL B;  1E7U A;  2PZI A;  3FP3 A;  4HOQ A;  3C3O A;  4FLH A;  4JXT A;  3FHE A;  3AG4 E;  2JAB A;  4GMR A;  4JW1 A;  4JB8 P;  1AP7 A;  4FHJ A;  4TXP A;  3GYZ A;  1OY3 D;  4HI9 A;  1PY1 A;  2X6F A;  3ISM C;  3R7Q A;  3NZS A;  1YYH A;  4A63 B;  3FH7 A;  3GZ1 A;  3APC A;  4I9E A;  5ANL A;  4N3B A;  3LY8 A;  3ASD A;  5ENS D;  1MX2 A;  5CCL A;  4ANU A;  4PS3 A;  3AU5 A;  1N9A A;  5FTP A;  1E8Y A;  5A6C A;  5CBO A;  4XIF A;  4ATG A;  4B89 A;  4TXQ A;  2IF4 A;  1DCQ A;  1QZ2 A;  3UPV A;  2KBX A;  5HQ8 A;  4N3A A;  4J0U A;  4J6I A;  2MYO A;  5FZQ A;  1Y8M A;  3L6A A;  3P2B A;  3KAE A;  4TV3 A;  4U0U A;  4GML A;  3PRZ A;  4EBA A;  3ULQ A;  4RQI A;  4HQD A;  4WWN A;  3DSU A;  4UI9 J;  3TWT A;  4C48 B;  5EIL A;  2X6J A;  4JPS A;  2YHE A;  1OUV A;  3GW4 A;  3F6Q A;  2FO7 A;  3EHM A;  2PNN A;  3DRA A;  3E30 A;  1HX8 A;  4PH4 B;  5BT1 A;  4L23 A;  4AOF A;  3MA5 A;  5KJK A;  1TNB A;  4L7T A;  1HG5 A;  2VGE A;  3FU3 A;  3O4Z A;  2UWJ G;  1YCS B;  5CMY A;  5J08 A;  2XRY A;  4CEM A;  2IO3 C;  5ENQ D;  2XPY A;  4L9P A;  1BU9 A;  4GTT A;  2IEJ A;  5LX8 A;  4IYP A;  1MHQ A;  3CST A;  4DX1 A;  1SZA A;  2HYZ A;  4G11 A;  3APD A;  3C3R A;  4J8D A;  3SHF A;  2XEV A;  1DCE A;  3SFY A;  3MCX A;  4NQ0 A;  1H2T C;  3ASO E;  5FWQ A;  3SO8 A;  2R02 A;  2LAH A;  3MKR A;  1MQS A;  3WXX A;  2DYS E;  3FUE A;  3LY7 A;  4X8Q A;  3PEU B;  2GRN B;  2L9B A;  3O48 A;  4EEC A;  3T8K A;  2F0Y A;  2AWI A;  5B3S E;  4HOS A;  3FTZ A;  3B95 A;  1A5E A;  3QNK A;  3CR3 A;  3OXG A;  1KLX A;  3RO2 A;  1E90 A;  1TN8 A;  3QOU A;  4CZ2 D;  4TXR A;  1XGW A;  2LAI A;  5ENP D;  1HO8 A;  3B7R L;  3IKO B;  2X38 A;  1HE8 A;  3LVR E;  2F8X K;  5CCM A;  4N5C A;  3VTX A;  4BY6 A;  2GRP B;  3FUI A;  4IN3 B;  2RG8 A;  4KXK B;  4DX7 D;  2CHW A;  4MKT A;  2CFU A;  3FFL A;  3ZNG A;  3ZXS A;  4TRQ A;  4QFV A;  3ZKJ A;  4BTB A;  3FTV A;  3UIO C;  4GZ5 A;  2CG3 A;  2XGS A;  5KBA A;  2DVW A;  3NAW A;  2VSY A;  4JC8 A;  4DI4 A;  3Q5M A;  3ABK E;  3LY9 A;  2J9Q A;  1LF8 A;  4MBG A;  5KCM A;  5EIB E;  3UIN C;  2A5E A;  3CKC A;  3EU9 A;  3ZN3 A;  4XI9 A;  4DX2 A;  1RZ4 A;  3IHV A;  4U7E B;  1N94 A;  3KD7 A;  3ASN E;  3BUA A;  1SVX A;  5CRV A;  4LNU D;  3DSX A;  4HOR A;  2QC9 A;  4FP7 A;  3SFZ A;  4WAF A;  4YDW A;  3CK9 A;  4U0Z A;  4N2Q A;  3DBS A;  1OCC E;  3CQC B;  2NC9 A;  5BV0 A;  3HXE A;  2YIN A;  2ETB A;  3APF A;  4PUC A;  3MYV A;  3UT4 A;  5HRY A;  3Q79 A;  4FUL A;  2J4B A;  3B7S A;  1FPP A;  3KS2 A;  1KT1 A;  1TJF A;  4PDX A;  5IY5 E;  1LD8 A;  3OXF A;  3G2W A;  2J09 A;  5A23 A;  2BTD A;  3FUF A;  5KJM A;  4LSZ E;  2KCK A;  5T8I A;  4BEP A;  5CEA A;  4GAA A;  5CEC B;  3ASH A;  3UI2 A;  2YQ8 A;  1N52 A;  4UI9 C;  5ENR D;  1KZP A;  4A1S A;  1HXI A;  2V8S E;  5BW8 C;  5C1D A;  2E2E A;  2YHC A;  4I1O B;  3CLJ A;  1V54 E;  4EBA G;  3TWS A;  3QWP A;  4JEH A;  2IY0 C;  2KXP C;  4U07 A;  1HS6 A;  2L6B A;  4O6F A;  1N0R A;  4JA9 A;  3TWR A;  2WXF A;  2WXH A;  3L22 A;  2R17 C;  4CCA A;  2UY1 A;  3HIZ A;  4DUI A;  3V31 A;  3UTM A;  2P9U G;  3FWV A;  1MZC A;  4J7W A;  1HF8 A;  1EYH A;  2AW6 A;  3VLD A;  2P9N G;  3VLE A;  3TJP A;  4MLP A;  3ENE A;  2B6C A;  3NOG D;  1SZ9 A;  2V4L A;  4I1M A;  2ETC A;  4UI9 K;  3ZW3 A;  4O60 A;  3D9J A;  4APO A;  4AY6 A;  2LNI A;  4N3C A;  4GPM A;  1O1R A;  4JHK A;  3QWV A;  4GA1 A;  4BT9 A;  3CVW A;  4A3T A;  1U3D A;  2L0I A;  2DIW A;  5JHB A;  3U66 A;  4OVV A;  2LUH A;  2R2L A;  4ILG A;  1H6K A;  3DSW A;  5LCW C;  2HE0 A;  3UM1 A;  3UIP C;  4RG6 A;  2L0T B;  4RSY A;  3TXN A;  3ML8 A;  1IHG A;  4WNE A;  2VQ2 A;  3L9T A;  5KNH D;  3PZ3 A;  1NA0 A;  1NL4 A;  3E37 A;  1TJC A;  3CK8 A;  4CDR A;  3ZXP A;  5JJT A;  5EID A;  3ZYM A;  5E75 A;  2KAT A;  4EZK A;  1IKN D;  2LXM A;  4AJW A;  3FUM A;  3CGH A;  4TUM A;  4IUL A;  3ONK A;  5J90 A;  2ZXW E;  2J07 A;  4J8S A;  3IXE A;  1JCR A;  2VJ8 A;  4CGV A;  4JD2 G;  1KZO A;  3SZ7 A;  3D9N A;  4XE0 A;  4GTS A;  2V5F A;  2OEW A;  4C0E A;  3DEP A;  3Q15 A;  5AAR A;  3CVU A;  3S7B A;  5CER B;  4UWH A;  4FHK A;  2OVF A;  3EHQ A;  3ZHE A;  3T9K A;  5ENN A;  2QZA A;  3ZRH A;  2X6H A;  3D9M A;  1FT1 A;  4B0Z A;  2KZT B;  1K8K G;  4LNB A;  4BES A;  1W3B A;  2LO6 A;  2EIN E;  5LP0 A;  1LD7 A;  4F7A A;  4F3V A;  3PZ2 A;  4DLO A;  3AS8 A;  4JVS A;  4UQY A;  3PS6 A;  5EKQ D;  4HFG A;  4I43 A;  2ETA A;  4JL0 A;  3MGB A;  5C2Y A;  4J8Y A;  3KSL A;  2I1K A;  1H19 A;  2X6K A;  1V55 E;  2DBA A;  4UWF A;  4UWL A;  3LYA A;  4B93 B;  3MZL B;  2WQH A;  2V5Q C;  4K0R A;  3CVP A;  3ZEF A;  5AAO A;  4RLY A;  3Q4A B;  4ME2 A;  1RW2 A;  1TNY A;  4XZ4 A;  2KC7 A;  3PZD A;  1SW6 A;  3DPD A;  2AVP A;  1JCQ A;  3CHR A;  2EIM E;  3CVY A;  3SD5 A;  4WNF A;  3UKR G;  4E6H A;  4KZ0 A;  3Q78 A;  3W9F A;  4DX5 D;  2I2O A;  2RFM A;  4EQF A;  2JLB A;  3RAU A;  2PM6 A;  1TN7 A;  5EYP F;  4O1O A;  1MX4 A;  3OAW A;  4WNG A;  1JPL A;  1OWN A;  1Z6T A;  4DI3 A;  4G8K A;  3AG3 E;  1OCR E;  4G2V A;  4GTO A;  2J8S D;  1B89 A;  1Z5S C;  5ARF A;  4B8A A;  1O5M A;  5ANR A;  4AM9 A;  3EIJ A;  3SBT B;  3IHY A;  3HHM A;  3FUH A;  2VGX B;  3QWW A;  4UWG A;  3TG4 A;  4R7L A;  4Y6W A;  3CQG B;  4HRL A;  3RRU A;  3EHR A;  4U95 D;  1N4Q A;  4ZFH A;  3PEV B;  2BUG A;  3FUK A;  1E96 B;  2ZU6 B;  4GZ6 A;  3NBN B;  1NFI E;  4ABN A;  5LOZ A;  5HKP A;  2WQ7 A;  3S7D A;  4OVU A;  5AIJ A;  3OXL A;  3FUN A;  4FC8 A;  2X3M A;  3BEE A;  1QQE A;  3SFX A;  2H6H A;  2IQC A;  1KT0 A;  4HVB A;  4LEU A;  3TAX A;  4FJZ A;  3HG0 D;  1ZBP A;  4I2Z A;  3SBS A;  2AJA A;  2FEZ A;  3W9G A;  4GTM A;  4V3I A;  3E33 A;  4L1B A;  4XKC A;  2F8Y A;  3R9A B;  3AG2 E;  5DIZ A;  4C0M A;  1MYO A;  4AV7 A;  3DSV A;  3DST A;  3BU8 A;  1LTX A;  1PAQ A;  4F6R D;  1K1B A;  2UY1 B;  1E8Z A;  3MKQ B;  4W9R A;  1K3Z D;  3BG1 B;  4GMJ A;  3TWV A;  1X81 A;  4I2W A;  3HYM B;  5BV1 A;  2WXR A;  4K03 A;  2DWZ A;  4DJA A;  3HVE B;  3JQ0 A;  5BUZ A;  2XCB A;  4AY5 A;  4WWO A;  4EHM A;  2PQN A;  2P58 C;  4H7X A;  3RU0 A;  1O1T A;  2H6G A;  2R05 A;  2EIK E;  4G24 A;  2CFZ A;  3KSQ A;  3RO3 A;  3ZFW A;  2NXP A;  2C2L A;  5EX0 A;  2C0M A;  3L17 A;  3AAA C;  4YVQ C;  4F53 A;  2VSO E;  2DYR E;  3G2S A;  5FZS A;  2P9P G;  3FTX A;  5CRU A;  4P29 A;  3UQ3 A;  3L13 A;  2RKK A;  3KEZ A;  5T3R A;  3NOC D;  4GPK A;  1DVP A;  2MRI A;  1ELK A;  1HU3 A;  5FIN A;  1UN9 A;  4KVM A;  3UT7 A;  3FTU A;  2LSV A;  4PS8 A;  1HFA A;  4N2S A;  1YMP A;  2XGO A;  3SI5 A;  5LCW J;  3MV3 B;  4BSX A;  4ANW A;  3I4R B;  1U3C A;  1H6O A;  3CVL A;  2DCP A;  2CG2 A;  1Z3Y A;  2PL2 A;  1P5Q A;  2XEE A;  3V2X A;  3SGH A;  1IYG A;  4UWK A;  3Q7F A;  3UX4 A;  5AN8 A;  1SA5 A;  3JCK C;  4PS7 A;  4NAC A;  1FVH A;  2WXJ A;  4KT6 B;  3Q9N C;  3L08 A;  2H6I A;  2WXP A;  3CK7 A;  3PVL A;  2WPV A;  3NB2 A;  2BF0 X;  3FEY A;  3ZGQ A;  3IEG A;  4BX8 A;  1BI8 B;  4G26 A;  1YA0 A;  3RRN B;  2HR2 A;  1N54 A;  2ION A;  2WXQ A;  4ANX A;  1MJ0 A;  3VLF A;  1ELR A;  2KZT A;  3D9P A;  4OAU C;  4G1T A;  5AQA A;  4DLQ A;  3EUV A;  4KMO A;  4LG6 A;  3B7U X;  3IBE A;  3EU5 A;  4YDE A;  5BXU A;  2VSX E;  2IJG X;  4APF A;  1O1S A;  4NIK A;  3B7B A;  4FU3 A;  5JA4 D;  1SA4 A;  2IOS A;  2I1J A;  4O1P A;  1VDY A;  3ABM E;  2ZGD A;  3RRM B;  2KCL A;  5KNG A;  3WG7 E;  2FF4 A;  1OT8 A;  2HM8 A;  5JHA A;  1E7V A;  2WVI A;  1N95 A;  4YND A;  2VSN A;  4GZC A;  2XCC A;  4HB5 A;  1HG2 A;  3AG1 E;  3S7J A;  3UUX A;  1EPU A;  4HS2 A;  3ABL E;  3X2Q E;  3PH0 C;  3R9M A;  4HRM B;  4AVX A;  1N0Q A;  3TWQ A;  3D9I A;  5JMN D;  2OV8 A;  3FTY A;  3EHN A;  2OEV A;  1OWP A;  3JXI A;  2J49 A;  1MX6 A;  1TN6 A;  4WND A;  5CBN A;  1IHB A;  3TG5 A;  4HLE A;  4GTV A;  5E76 A;  3UM3 A;  2J4D A;  2LSU A;  5D0Q D;  3HRA A;  2M63 A;  2EIL E;  3T5V A;  3ZVV A;  2AXZ A;  2KM4 A;  3I5P A;  4DPR A;  3SQV A;  2VYI A;  3LPZ A;  3LJ3 A;  4GCN A;  3CHO A;  4LUN U;  3TWX A;  4JZY A;  1JCS A;  4RVB A;  3LJN A;  3I3N A;  2WXN A;  3C3Q A;  3ML9 A;  4K5C A;  1QNF A;  2MOW A;  1TEZ A;  5KJL A;  3HXC A;  3Q9U C;  4BX9 A;  3B13 A;  2VGX A;  3S7F A;  4N5Q A;  2WM9 A;  3SF4 A;  3PE4 A;  1SQM A;  3CVQ A;  1UN8 A;  3D3M A;  4N39 A;  2WMO A;  4I6E A;  2DZO A;  5B1B E;  4I6G A;  1KPS B;  1IQU A;  1GW6 A;  2H6F A;  1UW4 B;  2VTB A;  3UKU G;  3ASF A;  5D0O D;  2XPI A;  3U64 A;  2FI7 A;  3DWL G;  5M72 A;  3JYS A;  3C5R A;  5BNW A;  5DBK A;  4GA2 A;  2XGM A;  3P1U A;  3FTW A;  2P9S G;  3L16 A;  3Q73 A;  1L5J A;  3JUI A;  2WMN A;  4Q94 A;  2IO2 C;  1HH8 A;  2C0L A;  3CEQ A;  3CHS A;  5KJN A;  3LCA A;  4U8Y D;  4G25 A;  1Q2Z A;  5FZR A;  3J5Q B;  2B0O E;  3MKQ A;  1WAO 1;  3AS4 A;  2V0P A;  3Q47 B;  5HI7 A;  3T8M A;  2GRO B;  4ATZ D;  1BLX B;  3UM0 A;  2FUL A;  2R03 A;  3CKB A;  2XS8 A;  4KYO B;  3C98 A;  3HVE A;  3UMV A;  2BKK B;  4B94 A;  2NSZ A;  3MX3 A;  4ILI A;  3FY4 A;  3DSS A;  4LRZ A;  5G05 J;  2Y4T A;  5G2N A;  2Y4U A;  5EDS A;  4K5B A;  2GGF A;  3ZYQ A;  3HXF A;  1XNF A;  1K1A A;  3L54 A;  3RKV A;  1UOH A;  4K5A B;  5G05 C;  3SY2 A;  3KEA A;  2V4H C;  5H7P A;  3DEO A;  2BKG A;  4NRH B;  4WUY A;  2WXM A;  3RJV A;  2ZIS A;  3TL5 A;  4ACL A;  4F1P A;  1OWL A;  4GTQ A;  3G2U A;  4U0S A;  4I17 A;  3ULE G;  3U3W A;  3D9L A;  2XS1 A;  4AEZ C;  1X5B A;  3V79 K;  3MV2 B;  1PC2 A;  5D2M C;  4J8F A;  1E8X A;  3G2T A;  2OOE A;  2I6H A;  2I9C A;  4I1A A;  3FU6 A;  3CVN A;  3JXJ A;  2NYJ A;  5LFA A;  3D9K A;  1E8W A;  4RG9 A;  3S2A A;  2KCV A;  4M7C A;  1AWC B;  4WWP A;  4GU5 A;  4FAD A;  4GB9 A;  2PM7 A;  4BER A;  2A4Z A;  3B7T A;  3FU5 A;  3D9H A;  3CV0 A;  3FEX A;  1D8E A;  3ZU7 B;  4DX6 D;  4AP2 A;  3ZIM A;  4AIF A;  3U4T A;  2IU1 A;  1EF1 C;  3NZU A;  2FBN A;  5G04 J;  3FUL A;  5ARG A;  1N4R A;  5AEN A;  3FUD A;  1QYM A;  3ASG A;  2XRZ A;  1TNZ A;  5D66 A;  2IOL A;  4LNG A;  2L6J A;  4ILH B;  4CRW A;  3AJI A;  3J5P A;  3HXB A;  4JEU A;  2P9K G;  2Y3A A;  1JWF A;  3RK6 A;  5EX3 A;  5FQ6 A;  3QC1 A;  2E0I A;  2MHK A;  4OAV B;  1TYQ G;  1JUQ A;  4ZHB A;  1N4P A;  4HLL A;  4Y6C A;  3ZHE B;  4HOT A;  3V30 A;  4E85 A;  3CVX A;  4CT0 A;  4FLB A;  1UG3 A;  4U8V D;  3E32 A;  1BPO A;  4BWR A;  4HXI A;  2LXL A;  1OCO E;  3CHQ A;  1UJK A;  2ZIR A;  1TR4 A;  3TXM A;  3FU0 A;  3TWW A;  4ANV A;  1H0A A;  3V2O A;  3ULY A;  1IXV A;  3PZ4 A;  4GYY A;  5FQ8 A;  1S70 B;  4G23 A;  3UM2 A;  1A17 A;  4YDO A;  3T5X A;  4MS6 A;  4QQI A;  1S63 A;  4JHR A;  3FH5 A;  2YNQ A;  2OCC E;  4XEI G;  3L82 A;  1WDY A;  2GW1 A;  2FO1 E;  1NP7 A;  3PUK A;  2IFU A;  3RIB A;  4ACK A;  5AYW D;  2X6I A;  2RD0 A;  3I4G A;  4CDM A;  3CSF A;  5ENT D;  3PDN A;  3PZ1 A;  2Y69 E;  3K9I A;  5JJ6 A;  4GYW A;  3N71 A;  1BI7 B;  3QB2 A;  1DC2 A;  4AXH A;  5EYL A;  4CGW A;  1ZB1 A;  2JEK A;  4G8L A;  4U8H A;  3PUJ A;  4HRN A;  1DNP A;  2P9I G;  1UJJ A;  3RSE G;  1H2V C;  1INZ A;  2Y0B G;  4YVO A;  3C72 A;  5JJ7 A;  5AQ7 A;  2VTB B;  4LCT A;  3BG0 B;  3IV0 A;  5AJD A;  4M3O A;  4U96 D;  2P2C P;  4BFR A;  3DXM G;  2WXK A; 
#chains in the Genus database with same CATH homology
 2RKK A;  4TXR A;  5H7P A;  4TXQ A;  2LXM A;  4U7E B;  2LXL A;  4TXP A;  2LUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...