2LXMA

Lip5-chmp5
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
163
structure length
163
Chain Sequence
MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of the Human LIP5 Regulatory Protein with Endosomal Sorting Complexes Required for Transport.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Vacuolar protein sorting-associated protein VTA1 homolog
total genus 60
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 2lxmA00
2LUHA 2LXMA 4U7EB 2RKKA 5H7PA 4TXPA 2LXLA 4TXQA 4TXRA
chains in the Genus database with same CATH superfamily
5C2YA 2ZU6B 3TG4A 4A3VA 5G04C 1Q2ZA 1JCQA 4BFRA 3EUVA 3V79K 4IRUA 1OY3D 2OEWA 5T8IA 2A5EA 2R59A 1HS6A 1U3CA 2X6JA 4HRLA 1JPLA 2PNNA 4WNGA 3SFXA 4U0UA 2XS8A 4JHRA 3MA5A 1TN8A 2L6BA 3Q7FA 4MS6A 2I2OA 3LY7A 3RKVA 4X8QA 3AJIA 3ZPJA 3ZYKA 2F8YA 4LNBA 1E90A 2X6FA 3C3OA 5FJYA 2CG2A 1E8ZA 3FUFA 3Q4AB 3ONKA 4XKCA 3TGOA 3IHVA 2IF4A 2VGYA 4MKTA 3L16A 4N39A 1Z5SC 3FTZA 3PZ3A 3CV0A 1P5QA 3DPYA 2XENA 4OYSA 2E0IA 2LNIA 3IEGA 4GCOA 3FUHA 3UI2A 1TYQG 1O5MA 4I9CA 4HLEA 2GGFA 2BEDA 1QBQA 4TXPA 1N4PA 3D9JA 3NZUA 4UQYA 4NACA 2ILRA 4JB8P 4DRXE 2M63A 4Z68A 4ACLA 3Q15A 4EQFA 3PVLA 4YNDA 2PL2A 5AYWD 1BI7B 2PM6A 2WPVA 2J8SD 3UPVA 1DCQA 1NA0A 3ULQA 3G2UA 3QOUA 4PDXA 4F6RD 2ZGDA 4CGVA 4JEUA 4C0EA 3R9AB 3S7BA 3ZGQA 4UUCA 4CYMD 4GTRA 1MZCA 3HXCA 4O1PA 1N54A 2YQ8A 4XEIG 1K1AA 4JZYA 5B1AE 3E30A 3ENEA 3DSUA 4KZCA 2WXIA 2WQ7A 3CSFA 2PQNA 4L7TA 3HDXA 5BT1A 5AQ7A 1SQMA 4UWLA 5EILA 2XZTG 2FEZA 2IFUA 2MYOA 2OOEA 1HXIA 1YCSB 3CHSA 3DXMG 4XI0A 4TRQA 3AG2E 3PREA 4ME2A 3BUAA 3UM0A 1S70B 4M3OA 5G04J 1OWPA 3NBNB 2GROB 2E2EA 1WY6A 3OAWA 2R17C 3CHMA 1NZNA 3L22A 5KJLA 2H6GA 2VQ2A 2BKGA 1TEZA 3MEKA 2VTBB 1MQSA 1N4QA 3OXLA 4I2ZA 2LO6A 2B0OE 3C3RA 2WXQA 4JXTA 3ZRHA 4Q96A 3PE4A 4TV3A 1IHGA 3AG1E 4ANVA 1O1TA 2P9UG 4G1TA 1ELRA 1KPSB 1INZA 2XQ0A 3B7TA 2CHXA 4L23A 2VTBA 4A1SA 3KD7A 2BKKB 3TXNA 1OXJA 3FU5A 3CHRA 3O4ZA 3ZEFA 1FCHA 2LXMA 3CVPA 3ESKA 2WXHA 5A7DB 5A6CA 5FQ6A 2Y0BG 5KBAA 2VSXE 2C2LA 5D66A 3ZHEB 4LUNU 4HOUA 3D9OA 2WMOA 3QDNA 4RSYA 1TN7A 4TUMA 2CFUA 3T8MA 3E37A 3V2XA 3RRNB 4R7LA 3QARA 1W3BA 4DUIA 1MYOA 3TWTA 5ENNA 5BXUA 2IO2C 1LTXA 4J8FA 1N0QA 4K5BA 4HLLA 5AQBA 3U66A 4ATZD 3QAQA 4J8EA 4BEPA 4BX8A 4GA0A 3CK9A 4PS7A 2GRMA 4K5AB 4FHKA 3TWQA 1NA3A 1K3ZD 1JWFA 1DNPA 3BG1B 5CBNA 5JJ6A 3MKRA 3GYZA 3CHOA 3URZA 3MKQA 1IKND 1EDUA 4GTVA 3DEOA 3DSSA 4B94A 4ANUA 4G26A 2V0PA 4QFVA 1FPPA 4WWOA 3LPZA 2AW6A 2KCVA 4XZ4A 4JD2G 3C5RA 5BV0A 4FA6A 4GZ3A 4AV7A 5EX3A 1H2VC 2XGMA 4G11A 3L13A 3G2SA 3E32A 3PE3A 3ZXPA 1E7UA 1GW6A 3ASHA 4U8HA 1RW2A 2F37A 4CDNA 1UOHA 2OVFA 3PRZA 2OEVA 3PH0C 4HRMB 3O48A 5LX8A 2H6FA 2J08A 1HFAA 3FTVA 1N95A 4B0ZA 3FH8A 4YDOA 4AIFA 3PNLB 3EDTB 3WG7E 2VGXA 4ILGA 3UT8A 1SA4A 2RFAA 2QYJA 5JHAA 4YDYA 1UJJA 3SGHA 1ZB1A 3ULYA 1TN6A 3VLEA 5C1DA 3LVRE 4LNGA 4GA1A 4WNEA 3LJ3A 3IKOB 3PUKA 2I1KA 2J49A 5CEAA 4CGWA 1WG0A 5CRUA 3GZ2A 3CSTA 3ZVVA 3JQ0A 4F1SA 2Y3AA 4K5CA 3RU0A 3FUIA 3SF4A 4I9EA 5ITZF 3MV3B 4HXIA 5AQAA 2FBNA 3PDNA 4DX5D 4P29A 5DBKA 4B93B 2PQRA 1HO8A 1TNZA 1LD8A 2XRZA 4HOSA 2IY0C 2Y4UA 4GZDA 5EYLA 2VYIA 2XHEA 2ETBA 3FFLA 3MCXA 5KNGA 3W9GA 4F53A 4KZ0A 2WXFA 3CQGB 1N0RA 3CK8A 2XGSA 1TJCA 2OV8A 1UG3A 3VTYA 1BI8B 3CKCA 4GPKA 2L9BA 1FVFA 4F3VA 3PZ2A 4J0UA 1BLXB 3FHEA 2DZOA 5KJMA 3EIJA 4KVOA 3X2QE 2P9PG 1XNFA 5HKPA 3EHQA 2HR2A 3ZYQA 3FH5A 1Z3XA 3AAAC 1E7VA 3D9PA 1SZAA 3HYMB 2WQ6A 3SO8A 3SZ7A 1PAQA 1ELWA 4JHJA 1EPUA 3KEZA 5A23A 3Q79A 4PS8A 4N5QA 2P58C 5E76A 2FO1E 4GZ5A 4DX1A 4ANXA 4XI9A 3UKRG 4N3AA 1MHQA 2C0LA 5D2MC 1VDYA 3JYSA 4H7XA 3QB2A 3HXDA 5FIOA 3D9IA 2UWJG 1QNFA 1OT8A 4GMJA 2XGOA 3LDZA 2ETAA 3NAWA 5AJDA 1MJ0A 4IN3B 5HQ8A 1L5JA 2J4BA 4CCAA 5BUZA 5IY5E 3ZYMA 1D9SA 1N9AA 3KAEA 1SW6A 5ARGA 3APFA 3ML8A 5ENTD 1H2TC 2KCLA 3DBSA 1ELKA 4FHJA 3KSQA 3KSLA 4GYYA 2V4LA 5LFAA 4AJWA 1X81A 3ASNE 5HS0A 3ISMC 4U7EB 3TG5A 4GYOA 3UT7A 3B95A 5H7PA 2ZGGA 2I1JA 3ZKJA 2KZTB 2I6HA 3IBEA 4UI9K 3JXIA 2WXMA 3ZU7B 4J8DA 3SI5A 3ZHEA 3JCKC 2MOWA 5FQ4A 1LF8A 2F8XK 3S2AA 4EBAA 2HO1A 4AVXA 1S63A 5FZSA 1G3NB 2XEHA 4MLPA 3HVEB 4BT8A 2KBXA 1E8YA 2I9CA 4NIKA 3B7RL 1TR4A 4A3TA 2DYSE 2Y1LE 4BWRA 2WXOA 2RG8A 3Q9NC 2XEEA 3Q47B 2YHCA 3RAUA 3CVQA 2KC7A 4GTOA 5FQ7A 5J90A 2IEJA 2HM8A 3FUEA 5LP0A 3BEEA 1HG2A 1KLXA 4GYWA 2WXGA 5EYPF 1H2UA 4DX2A 3FUNA 2J9QA 2DCPA 4DI4A 3ASFA 3IV0A 1TNYA 4JA9A 3FULA 2RKKA 4DJAA 1AWCB 4BY6A 2RD0A 3I4GA 4HOTA 5CERB 3APDA 4IULA 4PH4B 3G2TA 4WNFA 4ILIA 3JUIA 1MX4A 3R7RA 3RO2A 3S7FA 4J6IA 4O1OA 1D8EA 3D9LA 4AP2A 2RFMA 1X5BA 1N94A 2WVIA 2YINA 2FO7A 4J8YA 4LRZA 1K1BA 5CMYA 4ATGA 2WXPA 4AY6A 3LVQE 3I5PA 4UWHA 3FDHA 3I3NA 5FINA 3UIPC 4A1GA 4L2YA 4WNDA 4U63A 4ABNA 1QQEA 4WWNA 2R02A 2CFZA 1KT1A 5EX0A 4N2QA 5E75A 5DIZA 5CMWA 5ENSD 4EPZA 3DWLG 4B89A 1PC2A 3B13A 3FY4A 3ZN3A 4HOQA 1OCZE 4B8CB 2AVPA 3EJNA 4BETA 3JQ1A 4FC8A 2ZISA 4XKBA 2ZIRA 4RG9A 3UX4A 4GA2A 3L08A 3SBTB 1FVHA 3VTXA 4FADA 3NOCD 4KT6B 4KBQA 2P9KG 2KATA 2NC9A 3ONLA 3SNXA 3MZLB 3UM3A 1WM5A 4ANWA 2EQXA 2JEKA 2PM7A 2WM9A 4GMLA 3V2OA 2Q7FA 4N2SA 4HRNA 3UT4A 3PUJA 2LSVA 2AXZA 5ANRA 3MYVA 2FULA 4DLOA 3V30A 1N11A 1S0PA 4LNUD 3DXKG 1JCSA 2VSYA 1H6PA 5AN8A 3QWWA 4AEZC 3AS5A 4G2VA 4BTBA 2FI7A 2X6HA 1SZ9A 3UQ3A 4QQIA 3T5VA 1A17A 3D9MA 3CHPA 2GRNB 3JUEA 4FULA 2L6JA 4TXRA 1K8KG 4CRWA 4UWFA 3HXEA 1YYHA 3SFYA 4ZHBA 3QC1A 2WB2A 3TWUA 3L54A 3QK0A 3AG4E 5FZRA 4G8KA 3C98A 3TWSA 1RZ4A 4Q94A 4OVVA 1D8DA 2P2CP 1OWMA 4RQIA 1O1SA 2VSNA 1IHBA 1Z6TA 1BPOA 5CRVA 4K0RA 5CECB 4BX9A 1ZU2A 1IXVA 4AOFA 3MGBA 1XGWA 4GTPA 2MHKA 2V5FA 4XE0A 4LERA 1UW4B 3CVUA 3G2VA 4LSZE 5KCMA 3APCA 3T8KA 4KMOA 5EKQD 2L0TB 3UM2A 4KVMA 3Q7AA 3CVLA 3FTYA 5J08A 3SD5A 1TNUA 1BU9A 4Y6WA 5CBOA 4D10C 3FTXA 1UN9A 2R2LA 4FLHA 4HNAD 4HFGA 3K9IA 3D3MA 3VLDA 5BNWA 3Q73A 3ZYLA 4MRUA 3CR3A 2IQCA 2WXJA 2ZXWE 4U96D 4V3IA 3NB2A 4I1MA 3ABLE 2DIWA 4UWGA 3VLFA 4UQZA 4UWKA 3ZIMA 3D9KA 4ILHB 4I2WA 4G8LA 4XIFA 3B7SA 3GW4A 3IXEA 4GTMA 4KXKB 1A5EA 4I17A 4YDWA 1JUQA 5AENA 2KCKA 3FH7A 4APFA 3HHMA 2OVBA 4FJZA 2IO3C 1H19A 4JA7A 3B7BA 5ENQD 2CG3A 4UI9J 5LCWJ 2JABA 1TJFA 2GW1A 3AU5A 2J09A 4I6JA 5JMND 4RLYA 4PS3A 3ZUVB 3NF1A 3UTMA 3ASOE 2GRRB 3Q75A 2EIKE 3Q49B 1DCEA 5JJTA 3SY2A 2VGXB 1Y8MA 3KS2A 4F7AA 1NL4A 4HS2A 3DSWA 3FUMA 3UINC 2XCCA 2XZDG 1HX8A 4HI8A 1IQUA 3UKUG 3MJWA 3RSEG 3W9FA 3ZNGA 1AP7A 2KM4A 2LAIA 2H6IA 1N52A 4U0SA 5JHBA 3T5XA 5LCWC 4APOA 5CHEE 4YDEA 3E33A 2DWZA 3UM1A 3CHQA 4Q69A 4BT9A 5M72A 4GTQA 1Z3YA 2Y69E 3LXUX 4I6GA 3AS4A 2XRYA 5FT9A 3L9TA 2QFCA 2HE0A 4JC8A 4F1PA 5FTPA 3HXFA 2QY7A 2R03A 3FWVA 1HF8A 1HZ4A 3LY9A 3GZ1A 3J5PA 2V4HC 4WUYA 1N4RA 2BUGA 3EU9A 3HRAA 3L17A 4UI9C 3RRMB 2OCCE 5AAOA 5KJNA 2GRPB 2NXPA 5T3RA 3CVVA 1FT2A 3NZSA 5EIBE 5CCLA 2CHZA 2BTDA 4BSZB 4C0MA 3SQVA 3JXJA 3AS8A 4BERA 3U3WA 5AQ9A 2UY1A 2X38A 4BESA 2XS1A 3ZFWA 1E8XA 1ZBPA 4BTAA 3IHYA 3OTNA 5CEDB 1FT1A 3TL5A 1KZPA 3LCAA 4N3BA 3L6AA 5ENPD 3Q5MA 4N3CA 3PS6A 1H6OA 4LG6A 3QJZA 4EZJA 4FLBA 4N5CA 4CZ2D 1KT0A 3N71A 3ESLA 1OCOE 4JW1A 3RIBA 3TJPA 4C48B 4GZCA 4OVUA 3QKYA 4L2LA 4XX5A 3ZW3A 4H7YA 5AJLA 1PY1A 2R05A 4EZLA 1DC2A 3EHNA 3CQCB 2HYZA 1EYHA 3NQPA 5FWQA 4JPSA 3FUDA 4OAVB 5BV1A 3P2BA 4DK5A 3LJNA 4ZFHA 1O1RA 3EIQC 4DX6D 4JEHA 2AXUA 3F6QA 3HIZA 3RJVA 4OAUC 2LXLA 4HORA 1NP7A 5LOZA 2CHWA 3LKUA 3PZ1A 1EF1C 3U9WA 4L9PA 1MX2A 2A4ZA 3TWVA 4JL0A 3I4RB 1E8WA 4J7WA 4KYOB 4L1BA 1H0AA 2J07A 3RO3A 4I1AA 3TWXA 2JLBA 3MKQB 1SVXA 5BW8C 4G24A 3DPDA 3LS8A 3BQOA 3FUJA 4EECA 1UJKA 3ASGA 4HB5A 3DSVA 1TNOA 3CLJA 4HQDA 2LUHA 5G05C 2XEVA 4U8YD 3E34A 4J8SA 3CVWA 1TNBA 3UXGA 3D9HA 3EU5A 1QZ2A 1OCRE 3CK7A 1U3DA 4GPMA 1OWOA 2P9LG 4DX7D 3FP3A 3C72A 3FUKA 4JVSA 3ASDA 3PEVB 4NRHB 4UQXA 2A5UA 1IQRA 4AY5A 5CCMA 5KNHD 2DBAA 1NFIE 2X6IA 4GTSA 4FU3A 1S64A 3BG0B 3OXFA 4GMRA 2XPYA 4GZ6A 5B1BE 4HI9A 2WXNA 1JWGA 4EZKA 3R9MA 5G05J 1OUVA 3D9NA 3AU4A 4AXHA 1HH8A 3R7QA 1SA5A 1V54E 1HG5A 3U64A 3TAXA 4RVBA 4LCTA 3UIOC 3CVNA 4WAFA 2C0MA 3J5QB 3Q9UC 2XPZA 4HBDA 2YNQA 1U2VG 4HVBA 3FTSA 2BF0X 2P9IG 4EHMA 2LAHA 1V55E 2GRLA 1MX6A 4DLQA 4O6FA 4CDRA 3PNTB 3EHRA 2P9NG 3PZ4A 3DSXA 4W9RA 2DVWA 2H6HA 5KWDA 2LSUA 4GB9A 5T4YA 3U4TA 2P9SG 3RRUA 4AM9A 5FQ8A 5B3SE 3FU6A 2AWIA 3FU0A 4I43A 2QZAA 5AIJA 3C3QA 3LYAA 2DZNA 3WXXA 4C9BB 2EIJE 4BSXA 5ARFA 3EHMA 4ACKA 4YVOA 2IJGX 3LEWA 2Y4TA 3CEQA 4TXQA 2WQHA 3FEYA 4M7CA 2IOLA 4G23A 1OWNA 4MBGA 3E4BA 2EINE 5HI7A 3CVYA 4EBAG 3P1UA 1BD8A 3OXGA 3V31A 5JA4D 3QNKA 2IONA 4CDMA 1NI1A 4GU5A 3FU3A 3QWVA 2WXKA 2YHEA 3PZDA 4GCNA 4FP7A 2NSZA 1DVPA 1E96B 1IYGA 4GTTA 5ENRD 2X6KA 5JJ7A 2ETCA 4RG6A 3CIAA 4Y6CA 3CVXA 4PUCA 3RK6A 3AG3E 2VGEA 1UN8A 5KJKA 3Q78A 4IYPA 2KZTA 3HVEA 1H6KA 5BXOA 1LD7A 2QYUA 2B6CA 4TUUA 2XPIA 4E6HA 2MRIA 1N4SA 2KXPC 3ULEG 3SHFA 4I6EA 4WWPA 2EIME 2AJAA 5ENOD 2WXRA 2L0IA 4NURA 2FF4A 5HRYA 3UUXA 4U0ZA 2J4DA 2XCBA 4U95D 3UMVA 1QYMA 3ABKE 2ONDA 5EN5D 4DI3A 4DPRA 1YMPA 4FJYA 3HG0D 5G55A 4CEMA 2EILE 5FZQA 3DRAA 5EDSA 4A55A 4LEUA 4I1OB 2GRQB 2R5SA 3PEUB 3ABME 1KZOA 1B89A 2DYRE 5AARA 5BPPA 3FEXA 1HU3A 3MV2B 3BU8A 4G25A 3DEPA 3KEAA 3DSTA 5ANLA 3TWRA 2QC9A 3QWPA 3SBSA 2V8SE 2IOSA 3B7UX 4U07A 1HE8A 1WDYA 3TXMA 3T9KA 4GAAA 3ZXSA 3S7JA 5G2NA 1YA0A 1OCCE 3FTUA 4K03A 2V5QC 2X3MA 4U8VD 1WAO1 3CKBA 4NQ0A 2WXLA 3TWWA 2UY1B 1JCRA 3S7DA 3SFZA 4A63B 3G2WA 2AXVA 3HXBA 4U04A 4B8AA 4O60A 5D0OD 2F0YA 1Y6IA 2NYJA 2VSOE 5D0QD 1OWLA 2WMNA 4URKA 3L82A 3NOGD 3CGHA 4JHKA 4YVQC 3MX3A 4CT0A 2VJ8A 3ML9A 2IU1A 4E85A 3FTWA 2PZIA 3LY8A 3GZSA 5EIDA 4CT4A
chains in the Genus database with same CATH topology
2LUHA 2LXMA 4U7EB 2RKKA 5H7PA 4TXPA 2LXLA 4TXQA 4TXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUH A;  2LXM A;  4U7E B;  2RKK A;  5H7P A;  4TXP A;  2LXL A;  4TXQ A;  4TXR A; 
#chains in the Genus database with same CATH topology
 5C2Y A;  2ZU6 B;  3TG4 A;  4A3V A;  5G04 C;  1Q2Z A;  1JCQ A;  4BFR A;  3EUV A;  3V79 K;  4IRU A;  1OY3 D;  2OEW A;  5T8I A;  2A5E A;  2R59 A;  1HS6 A;  1U3C A;  2X6J A;  4HRL A;  1JPL A;  2PNN A;  4WNG A;  3SFX A;  4U0U A;  2XS8 A;  4JHR A;  3MA5 A;  1TN8 A;  2L6B A;  3Q7F A;  4MS6 A;  2I2O A;  3LY7 A;  3RKV A;  4X8Q A;  3AJI A;  3ZPJ A;  3ZYK A;  2F8Y A;  4LNB A;  1E90 A;  2X6F A;  3C3O A;  5FJY A;  2CG2 A;  1E8Z A;  3FUF A;  3Q4A B;  3ONK A;  4XKC A;  3TGO A;  3IHV A;  2IF4 A;  2VGY A;  4MKT A;  3L16 A;  4N39 A;  1Z5S C;  3FTZ A;  3PZ3 A;  3CV0 A;  1P5Q A;  3DPY A;  2XEN A;  4OYS A;  2E0I A;  2LNI A;  3IEG A;  4GCO A;  3FUH A;  3UI2 A;  1TYQ G;  1O5M A;  4I9C A;  4HLE A;  2GGF A;  2BED A;  1QBQ A;  4TXP A;  1N4P A;  3D9J A;  3NZU A;  4UQY A;  4NAC A;  2ILR A;  4JB8 P;  4DRX E;  2M63 A;  4Z68 A;  4ACL A;  3Q15 A;  4EQF A;  3PVL A;  4YND A;  2PL2 A;  5AYW D;  1BI7 B;  2PM6 A;  2WPV A;  2J8S D;  3UPV A;  1DCQ A;  1NA0 A;  3ULQ A;  3G2U A;  3QOU A;  4PDX A;  4F6R D;  2ZGD A;  4CGV A;  4JEU A;  4C0E A;  3R9A B;  3S7B A;  3ZGQ A;  4UUC A;  4CYM D;  4GTR A;  1MZC A;  3HXC A;  4O1P A;  1N54 A;  2YQ8 A;  4XEI G;  1K1A A;  4JZY A;  5B1A E;  3E30 A;  3ENE A;  3DSU A;  4KZC A;  2WXI A;  2WQ7 A;  3CSF A;  2PQN A;  4L7T A;  3HDX A;  5BT1 A;  5AQ7 A;  1SQM A;  4UWL A;  5EIL A;  2XZT G;  2FEZ A;  2IFU A;  2MYO A;  2OOE A;  1HXI A;  1YCS B;  3CHS A;  3DXM G;  4XI0 A;  4TRQ A;  3AG2 E;  3PRE A;  4ME2 A;  3BUA A;  3UM0 A;  1S70 B;  4M3O A;  5G04 J;  1OWP A;  3NBN B;  2GRO B;  2E2E A;  1WY6 A;  3OAW A;  2R17 C;  3CHM A;  1NZN A;  3L22 A;  5KJL A;  2H6G A;  2VQ2 A;  2BKG A;  1TEZ A;  3MEK A;  2VTB B;  1MQS A;  1N4Q A;  3OXL A;  4I2Z A;  2LO6 A;  2B0O E;  3C3R A;  2WXQ A;  4JXT A;  3ZRH A;  4Q96 A;  3PE4 A;  4TV3 A;  1IHG A;  3AG1 E;  4ANV A;  1O1T A;  2P9U G;  4G1T A;  1ELR A;  1KPS B;  1INZ A;  2XQ0 A;  3B7T A;  2CHX A;  4L23 A;  2VTB A;  4A1S A;  3KD7 A;  2BKK B;  3TXN A;  1OXJ A;  3FU5 A;  3CHR A;  3O4Z A;  3ZEF A;  1FCH A;  2LXM A;  3CVP A;  3ESK A;  2WXH A;  5A7D B;  5A6C A;  5FQ6 A;  2Y0B G;  5KBA A;  2VSX E;  2C2L A;  5D66 A;  3ZHE B;  4LUN U;  4HOU A;  3D9O A;  2WMO A;  3QDN A;  4RSY A;  1TN7 A;  4TUM A;  2CFU A;  3T8M A;  3E37 A;  3V2X A;  3RRN B;  4R7L A;  3QAR A;  1W3B A;  4DUI A;  1MYO A;  3TWT A;  5ENN A;  5BXU A;  2IO2 C;  1LTX A;  4J8F A;  1N0Q A;  4K5B A;  4HLL A;  5AQB A;  3U66 A;  4ATZ D;  3QAQ A;  4J8E A;  4BEP A;  4BX8 A;  4GA0 A;  3CK9 A;  4PS7 A;  2GRM A;  4K5A B;  4FHK A;  3TWQ A;  1NA3 A;  1K3Z D;  1JWF A;  1DNP A;  3BG1 B;  5CBN A;  5JJ6 A;  3MKR A;  3GYZ A;  3CHO A;  3URZ A;  3MKQ A;  1IKN D;  1EDU A;  4GTV A;  3DEO A;  3DSS A;  4B94 A;  4ANU A;  4G26 A;  2V0P A;  4QFV A;  1FPP A;  4WWO A;  3LPZ A;  2AW6 A;  2KCV A;  4XZ4 A;  4JD2 G;  3C5R A;  5BV0 A;  4FA6 A;  4GZ3 A;  4AV7 A;  5EX3 A;  1H2V C;  2XGM A;  4G11 A;  3L13 A;  3G2S A;  3E32 A;  3PE3 A;  3ZXP A;  1E7U A;  1GW6 A;  3ASH A;  4U8H A;  1RW2 A;  2F37 A;  4CDN A;  1UOH A;  2OVF A;  3PRZ A;  2OEV A;  3PH0 C;  4HRM B;  3O48 A;  5LX8 A;  2H6F A;  2J08 A;  1HFA A;  3FTV A;  1N95 A;  4B0Z A;  3FH8 A;  4YDO A;  4AIF A;  3PNL B;  3EDT B;  3WG7 E;  2VGX A;  4ILG A;  3UT8 A;  1SA4 A;  2RFA A;  2QYJ A;  5JHA A;  4YDY A;  1UJJ A;  3SGH A;  1ZB1 A;  3ULY A;  1TN6 A;  3VLE A;  5C1D A;  3LVR E;  4LNG A;  4GA1 A;  4WNE A;  3LJ3 A;  3IKO B;  3PUK A;  2I1K A;  2J49 A;  5CEA A;  4CGW A;  1WG0 A;  5CRU A;  3GZ2 A;  3CST A;  3ZVV A;  3JQ0 A;  4F1S A;  2Y3A A;  4K5C A;  3RU0 A;  3FUI A;  3SF4 A;  4I9E A;  5ITZ F;  3MV3 B;  4HXI A;  5AQA A;  2FBN A;  3PDN A;  4DX5 D;  4P29 A;  5DBK A;  4B93 B;  2PQR A;  1HO8 A;  1TNZ A;  1LD8 A;  2XRZ A;  4HOS A;  2IY0 C;  2Y4U A;  4GZD A;  5EYL A;  2VYI A;  2XHE A;  2ETB A;  3FFL A;  3MCX A;  5KNG A;  3W9G A;  4F53 A;  4KZ0 A;  2WXF A;  3CQG B;  1N0R A;  3CK8 A;  2XGS A;  1TJC A;  2OV8 A;  1UG3 A;  3VTY A;  1BI8 B;  3CKC A;  4GPK A;  2L9B A;  1FVF A;  4F3V A;  3PZ2 A;  4J0U A;  1BLX B;  3FHE A;  2DZO A;  5KJM A;  3EIJ A;  4KVO A;  3X2Q E;  2P9P G;  1XNF A;  5HKP A;  3EHQ A;  2HR2 A;  3ZYQ A;  3FH5 A;  1Z3X A;  3AAA C;  1E7V A;  3D9P A;  1SZA A;  3HYM B;  2WQ6 A;  3SO8 A;  3SZ7 A;  1PAQ A;  1ELW A;  4JHJ A;  1EPU A;  3KEZ A;  5A23 A;  3Q79 A;  4PS8 A;  4N5Q A;  2P58 C;  5E76 A;  2FO1 E;  4GZ5 A;  4DX1 A;  4ANX A;  4XI9 A;  3UKR G;  4N3A A;  1MHQ A;  2C0L A;  5D2M C;  1VDY A;  3JYS A;  4H7X A;  3QB2 A;  3HXD A;  5FIO A;  3D9I A;  2UWJ G;  1QNF A;  1OT8 A;  4GMJ A;  2XGO A;  3LDZ A;  2ETA A;  3NAW A;  5AJD A;  1MJ0 A;  4IN3 B;  5HQ8 A;  1L5J A;  2J4B A;  4CCA A;  5BUZ A;  5IY5 E;  3ZYM A;  1D9S A;  1N9A A;  3KAE A;  1SW6 A;  5ARG A;  3APF A;  3ML8 A;  5ENT D;  1H2T C;  2KCL A;  3DBS A;  1ELK A;  4FHJ A;  3KSQ A;  3KSL A;  4GYY A;  2V4L A;  5LFA A;  4AJW A;  1X81 A;  3ASN E;  5HS0 A;  3ISM C;  4U7E B;  3TG5 A;  4GYO A;  3UT7 A;  3B95 A;  5H7P A;  2ZGG A;  2I1J A;  3ZKJ A;  2KZT B;  2I6H A;  3IBE A;  4UI9 K;  3JXI A;  2WXM A;  3ZU7 B;  4J8D A;  3SI5 A;  3ZHE A;  3JCK C;  2MOW A;  5FQ4 A;  1LF8 A;  2F8X K;  3S2A A;  4EBA A;  2HO1 A;  4AVX A;  1S63 A;  5FZS A;  1G3N B;  2XEH A;  4MLP A;  3HVE B;  4BT8 A;  2KBX A;  1E8Y A;  2I9C A;  4NIK A;  3B7R L;  1TR4 A;  4A3T A;  2DYS E;  2Y1L E;  4BWR A;  2WXO A;  2RG8 A;  3Q9N C;  2XEE A;  3Q47 B;  2YHC A;  3RAU A;  3CVQ A;  2KC7 A;  4GTO A;  5FQ7 A;  5J90 A;  2IEJ A;  2HM8 A;  3FUE A;  5LP0 A;  3BEE A;  1HG2 A;  1KLX A;  4GYW A;  2WXG A;  5EYP F;  1H2U A;  4DX2 A;  3FUN A;  2J9Q A;  2DCP A;  4DI4 A;  3ASF A;  3IV0 A;  1TNY A;  4JA9 A;  3FUL A;  2RKK A;  4DJA A;  1AWC B;  4BY6 A;  2RD0 A;  3I4G A;  4HOT A;  5CER B;  3APD A;  4IUL A;  4PH4 B;  3G2T A;  4WNF A;  4ILI A;  3JUI A;  1MX4 A;  3R7R A;  3RO2 A;  3S7F A;  4J6I A;  4O1O A;  1D8E A;  3D9L A;  4AP2 A;  2RFM A;  1X5B A;  1N94 A;  2WVI A;  2YIN A;  2FO7 A;  4J8Y A;  4LRZ A;  1K1B A;  5CMY A;  4ATG A;  2WXP A;  4AY6 A;  3LVQ E;  3I5P A;  4UWH A;  3FDH A;  3I3N A;  5FIN A;  3UIP C;  4A1G A;  4L2Y A;  4WND A;  4U63 A;  4ABN A;  1QQE A;  4WWN A;  2R02 A;  2CFZ A;  1KT1 A;  5EX0 A;  4N2Q A;  5E75 A;  5DIZ A;  5CMW A;  5ENS D;  4EPZ A;  3DWL G;  4B89 A;  1PC2 A;  3B13 A;  3FY4 A;  3ZN3 A;  4HOQ A;  1OCZ E;  4B8C B;  2AVP A;  3EJN A;  4BET A;  3JQ1 A;  4FC8 A;  2ZIS A;  4XKB A;  2ZIR A;  4RG9 A;  3UX4 A;  4GA2 A;  3L08 A;  3SBT B;  1FVH A;  3VTX A;  4FAD A;  3NOC D;  4KT6 B;  4KBQ A;  2P9K G;  2KAT A;  2NC9 A;  3ONL A;  3SNX A;  3MZL B;  3UM3 A;  1WM5 A;  4ANW A;  2EQX A;  2JEK A;  2PM7 A;  2WM9 A;  4GML A;  3V2O A;  2Q7F A;  4N2S A;  4HRN A;  3UT4 A;  3PUJ A;  2LSV A;  2AXZ A;  5ANR A;  3MYV A;  2FUL A;  4DLO A;  3V30 A;  1N11 A;  1S0P A;  4LNU D;  3DXK G;  1JCS A;  2VSY A;  1H6P A;  5AN8 A;  3QWW A;  4AEZ C;  3AS5 A;  4G2V A;  4BTB A;  2FI7 A;  2X6H A;  1SZ9 A;  3UQ3 A;  4QQI A;  3T5V A;  1A17 A;  3D9M A;  3CHP A;  2GRN B;  3JUE A;  4FUL A;  2L6J A;  4TXR A;  1K8K G;  4CRW A;  4UWF A;  3HXE A;  1YYH A;  3SFY A;  4ZHB A;  3QC1 A;  2WB2 A;  3TWU A;  3L54 A;  3QK0 A;  3AG4 E;  5FZR A;  4G8K A;  3C98 A;  3TWS A;  1RZ4 A;  4Q94 A;  4OVV A;  1D8D A;  2P2C P;  1OWM A;  4RQI A;  1O1S A;  2VSN A;  1IHB A;  1Z6T A;  1BPO A;  5CRV A;  4K0R A;  5CEC B;  4BX9 A;  1ZU2 A;  1IXV A;  4AOF A;  3MGB A;  1XGW A;  4GTP A;  2MHK A;  2V5F A;  4XE0 A;  4LER A;  1UW4 B;  3CVU A;  3G2V A;  4LSZ E;  5KCM A;  3APC A;  3T8K A;  4KMO A;  5EKQ D;  2L0T B;  3UM2 A;  4KVM A;  3Q7A A;  3CVL A;  3FTY A;  5J08 A;  3SD5 A;  1TNU A;  1BU9 A;  4Y6W A;  5CBO A;  4D10 C;  3FTX A;  1UN9 A;  2R2L A;  4FLH A;  4HNA D;  4HFG A;  3K9I A;  3D3M A;  3VLD A;  5BNW A;  3Q73 A;  3ZYL A;  4MRU A;  3CR3 A;  2IQC A;  2WXJ A;  2ZXW E;  4U96 D;  4V3I A;  3NB2 A;  4I1M A;  3ABL E;  2DIW A;  4UWG A;  3VLF A;  4UQZ A;  4UWK A;  3ZIM A;  3D9K A;  4ILH B;  4I2W A;  4G8L A;  4XIF A;  3B7S A;  3GW4 A;  3IXE A;  4GTM A;  4KXK B;  1A5E A;  4I17 A;  4YDW A;  1JUQ A;  5AEN A;  2KCK A;  3FH7 A;  4APF A;  3HHM A;  2OVB A;  4FJZ A;  2IO3 C;  1H19 A;  4JA7 A;  3B7B A;  5ENQ D;  2CG3 A;  4UI9 J;  5LCW J;  2JAB A;  1TJF A;  2GW1 A;  3AU5 A;  2J09 A;  4I6J A;  5JMN D;  4RLY A;  4PS3 A;  3ZUV B;  3NF1 A;  3UTM A;  3ASO E;  2GRR B;  3Q75 A;  2EIK E;  3Q49 B;  1DCE A;  5JJT A;  3SY2 A;  2VGX B;  1Y8M A;  3KS2 A;  4F7A A;  1NL4 A;  4HS2 A;  3DSW A;  3FUM A;  3UIN C;  2XCC A;  2XZD G;  1HX8 A;  4HI8 A;  1IQU A;  3UKU G;  3MJW A;  3RSE G;  3W9F A;  3ZNG A;  1AP7 A;  2KM4 A;  2LAI A;  2H6I A;  1N52 A;  4U0S A;  5JHB A;  3T5X A;  5LCW C;  4APO A;  5CHE E;  4YDE A;  3E33 A;  2DWZ A;  3UM1 A;  3CHQ A;  4Q69 A;  4BT9 A;  5M72 A;  4GTQ A;  1Z3Y A;  2Y69 E;  3LXU X;  4I6G A;  3AS4 A;  2XRY A;  5FT9 A;  3L9T A;  2QFC A;  2HE0 A;  4JC8 A;  4F1P A;  5FTP A;  3HXF A;  2QY7 A;  2R03 A;  3FWV A;  1HF8 A;  1HZ4 A;  3LY9 A;  3GZ1 A;  3J5P A;  2V4H C;  4WUY A;  1N4R A;  2BUG A;  3EU9 A;  3HRA A;  3L17 A;  4UI9 C;  3RRM B;  2OCC E;  5AAO A;  5KJN A;  2GRP B;  2NXP A;  5T3R A;  3CVV A;  1FT2 A;  3NZS A;  5EIB E;  5CCL A;  2CHZ A;  2BTD A;  4BSZ B;  4C0M A;  3SQV A;  3JXJ A;  3AS8 A;  4BER A;  3U3W A;  5AQ9 A;  2UY1 A;  2X38 A;  4BES A;  2XS1 A;  3ZFW A;  1E8X A;  1ZBP A;  4BTA A;  3IHY A;  3OTN A;  5CED B;  1FT1 A;  3TL5 A;  1KZP A;  3LCA A;  4N3B A;  3L6A A;  5ENP D;  3Q5M A;  4N3C A;  3PS6 A;  1H6O A;  4LG6 A;  3QJZ A;  4EZJ A;  4FLB A;  4N5C A;  4CZ2 D;  1KT0 A;  3N71 A;  3ESL A;  1OCO E;  4JW1 A;  3RIB A;  3TJP A;  4C48 B;  4GZC A;  4OVU A;  3QKY A;  4L2L A;  4XX5 A;  3ZW3 A;  4H7Y A;  5AJL A;  1PY1 A;  2R05 A;  4EZL A;  1DC2 A;  3EHN A;  3CQC B;  2HYZ A;  1EYH A;  3NQP A;  5FWQ A;  4JPS A;  3FUD A;  4OAV B;  5BV1 A;  3P2B A;  4DK5 A;  3LJN A;  4ZFH A;  1O1R A;  3EIQ C;  4DX6 D;  4JEH A;  2AXU A;  3F6Q A;  3HIZ A;  3RJV A;  4OAU C;  2LXL A;  4HOR A;  1NP7 A;  5LOZ A;  2CHW A;  3LKU A;  3PZ1 A;  1EF1 C;  3U9W A;  4L9P A;  1MX2 A;  2A4Z A;  3TWV A;  4JL0 A;  3I4R B;  1E8W A;  4J7W A;  4KYO B;  4L1B A;  1H0A A;  2J07 A;  3RO3 A;  4I1A A;  3TWX A;  2JLB A;  3MKQ B;  1SVX A;  5BW8 C;  4G24 A;  3DPD A;  3LS8 A;  3BQO A;  3FUJ A;  4EEC A;  1UJK A;  3ASG A;  4HB5 A;  3DSV A;  1TNO A;  3CLJ A;  4HQD A;  2LUH A;  5G05 C;  2XEV A;  4U8Y D;  3E34 A;  4J8S A;  3CVW A;  1TNB A;  3UXG A;  3D9H A;  3EU5 A;  1QZ2 A;  1OCR E;  3CK7 A;  1U3D A;  4GPM A;  1OWO A;  2P9L G;  4DX7 D;  3FP3 A;  3C72 A;  3FUK A;  4JVS A;  3ASD A;  3PEV B;  4NRH B;  4UQX A;  2A5U A;  1IQR A;  4AY5 A;  5CCM A;  5KNH D;  2DBA A;  1NFI E;  2X6I A;  4GTS A;  4FU3 A;  1S64 A;  3BG0 B;  3OXF A;  4GMR A;  2XPY A;  4GZ6 A;  5B1B E;  4HI9 A;  2WXN A;  1JWG A;  4EZK A;  3R9M A;  5G05 J;  1OUV A;  3D9N A;  3AU4 A;  4AXH A;  1HH8 A;  3R7Q A;  1SA5 A;  1V54 E;  1HG5 A;  3U64 A;  3TAX A;  4RVB A;  4LCT A;  3UIO C;  3CVN A;  4WAF A;  2C0M A;  3J5Q B;  3Q9U C;  2XPZ A;  4HBD A;  2YNQ A;  1U2V G;  4HVB A;  3FTS A;  2BF0 X;  2P9I G;  4EHM A;  2LAH A;  1V55 E;  2GRL A;  1MX6 A;  4DLQ A;  4O6F A;  4CDR A;  3PNT B;  3EHR A;  2P9N G;  3PZ4 A;  3DSX A;  4W9R A;  2DVW A;  2H6H A;  5KWD A;  2LSU A;  4GB9 A;  5T4Y A;  3U4T A;  2P9S G;  3RRU A;  4AM9 A;  5FQ8 A;  5B3S E;  3FU6 A;  2AWI A;  3FU0 A;  4I43 A;  2QZA A;  5AIJ A;  3C3Q A;  3LYA A;  2DZN A;  3WXX A;  4C9B B;  2EIJ E;  4BSX A;  5ARF A;  3EHM A;  4ACK A;  4YVO A;  2IJG X;  3LEW A;  2Y4T A;  3CEQ A;  4TXQ A;  2WQH A;  3FEY A;  4M7C A;  2IOL A;  4G23 A;  1OWN A;  4MBG A;  3E4B A;  2EIN E;  5HI7 A;  3CVY A;  4EBA G;  3P1U A;  1BD8 A;  3OXG A;  3V31 A;  5JA4 D;  3QNK A;  2ION A;  4CDM A;  1NI1 A;  4GU5 A;  3FU3 A;  3QWV A;  2WXK A;  2YHE A;  3PZD A;  4GCN A;  4FP7 A;  2NSZ A;  1DVP A;  1E96 B;  1IYG A;  4GTT A;  5ENR D;  2X6K A;  5JJ7 A;  2ETC A;  4RG6 A;  3CIA A;  4Y6C A;  3CVX A;  4PUC A;  3RK6 A;  3AG3 E;  2VGE A;  1UN8 A;  5KJK A;  3Q78 A;  4IYP A;  2KZT A;  3HVE A;  1H6K A;  5BXO A;  1LD7 A;  2QYU A;  2B6C A;  4TUU A;  2XPI A;  4E6H A;  2MRI A;  1N4S A;  2KXP C;  3ULE G;  3SHF A;  4I6E A;  4WWP A;  2EIM E;  2AJA A;  5ENO D;  2WXR A;  2L0I A;  4NUR A;  2FF4 A;  5HRY A;  3UUX A;  4U0Z A;  2J4D A;  2XCB A;  4U95 D;  3UMV A;  1QYM A;  3ABK E;  2OND A;  5EN5 D;  4DI3 A;  4DPR A;  1YMP A;  4FJY A;  3HG0 D;  5G55 A;  4CEM A;  2EIL E;  5FZQ A;  3DRA A;  5EDS A;  4A55 A;  4LEU A;  4I1O B;  2GRQ B;  2R5S A;  3PEU B;  3ABM E;  1KZO A;  1B89 A;  2DYR E;  5AAR A;  5BPP A;  3FEX A;  1HU3 A;  3MV2 B;  3BU8 A;  4G25 A;  3DEP A;  3KEA A;  3DST A;  5ANL A;  3TWR A;  2QC9 A;  3QWP A;  3SBS A;  2V8S E;  2IOS A;  3B7U X;  4U07 A;  1HE8 A;  1WDY A;  3TXM A;  3T9K A;  4GAA A;  3ZXS A;  3S7J A;  5G2N A;  1YA0 A;  1OCC E;  3FTU A;  4K03 A;  2V5Q C;  2X3M A;  4U8V D;  1WAO 1;  3CKB A;  4NQ0 A;  2WXL A;  3TWW A;  2UY1 B;  1JCR A;  3S7D A;  3SFZ A;  4A63 B;  3G2W A;  2AXV A;  3HXB A;  4U04 A;  4B8A A;  4O60 A;  5D0O D;  2F0Y A;  1Y6I A;  2NYJ A;  2VSO E;  5D0Q D;  1OWL A;  2WMN A;  4URK A;  3L82 A;  3NOG D;  3CGH A;  4JHK A;  4YVQ C;  3MX3 A;  4CT0 A;  2VJ8 A;  3ML9 A;  2IU1 A;  4E85 A;  3FTW A;  2PZI A;  3LY8 A;  3GZS A;  5EID A;  4CT4 A; 
#chains in the Genus database with same CATH homology
 2LUH A;  2LXM A;  4U7E B;  2RKK A;  5H7P A;  4TXP A;  2LXL A;  4TXQ A;  4TXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...