2LXSA

Allosteric communication in the kix domain proceeds through dynamic re-packing of the hydrophobic core
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Allosteric Communication in the KIX Domain Proceeds through Dynamic Repacking of the Hydrophobic Core.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 30
structure length 87
sequence length 87
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02172 KIX KIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.20 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Coactivator CBP, KIX domain 2lxsA00
2LXSA 2LQIA 2LXTA 2LQHA 1KDXA 4D7XA 2K0NA 2AGHB 2KWFA 1SB0A 2GUTA 4I9OA
chains in the Genus database with same CATH superfamily
2E0XA 2I30A 2BXEA 2NQOA 1H9ZA 4FIPB 2VDBA 3JQZA 4G04A 3KJLA 4L9QA 4L8UA 4Z9OA 4ZCGA 4PO0A 1H5WA 5IJEA 3V09A 2QM6A 2BXMA 4L9KA 3VQIA 5DQFA 2V36A 3PLAA 3NVMA 2I2ZA 3UIVA 5BPKA 4BY9C 1HK2A 2BX8A 1VFIA 2QMCA 2EFHA 2ROHA 1KW2A 2XW0A 5IIUA 1IJGA 4N3ZA 2QHBA 2XVQA 1MUSA 1BM0A 3BPJA 3FWCC 2NNWA 4HGMB 3GQUA 3MHHB 4IW1A 5DBYA 1E7CA 4OTUA 2Z8IA 4ZBKA 3NVIA 4GG2A 4M70B 3CX9A 2DYOA 3V03A 2DBUA 2AGHB 2BXQA 4TQ1A 1HK5A 1AO6A 1LOTA 5GIPA 4DM0A 3NVKA 1E7FA 4GDXA 2BXHA 4ZBRA 4IW2A 1FOUA 5IJ5A 3WHRA 3M99C 5HOZA 3GA9L 2BXAA 5B5TA 1KXPD 2AJEA 4F5TA 1JNBA 4ZC6A 1J7EA 1TXUA 2XW1A 1E7BA 1E7AA 2LOQA 2EFEA 5ID7A 2XVVA 3FWBC 5GIOA 1E7HA 2BXCA 4GDKB 3V08A 3KIKA 2LXSA 4E99A 1E7GA 2LXTA 5IFOA 4LUFA 4DHXB 4LB2A 4F5VA 2XVUA 2JUHA 1MIWA 1KDXA 3B9LA 4Z69A 3GQXA 4ZBQA 1J78A 2EFCA 4BKEA 1HK4A 2LQIA 4F5UA 2Z8KA 2DYMA 3A73A 2KWFA 3LU6A 1SB0A 2XVWA 4OT2A 3TDLA 5IIXA 2OZBB 1BKEA 4FK5B 5ID9A 2XMOA 4OR0A 2LQHA 4GDLB 2DBWA 2DBXA 1E78A 3NMUA 1UORA 4LUHA 2BXNA 1NT2B 2BXFA 2BXPA 2BXIA 4W4UB 5GHKA 3B9MA 5GINA 2KBZA 2XSIA 2YDFA 2BXBA 2BXDA 4K2CA 4D7XA 2EFDA 5IJFA 1MUHA 1N5UA 1E7EA 4N0UD 4I9OA 1BJ5A 4ZUXV 2BXOA 3LU7A 4MBEC 4LB9A 4K71A 3MHSB 2OT3A 4JK4A 3H37A 4G03A 5IIHA 2VUEA 4N0FD 2VUFA 3WHSA 4NAWB 3ECPA 4EMXA 3SQJA 3ICXA 3SIUB 3FNMA 4HGKA 1E7IA 2GUTA 4J2VA 4LA0A 5D7GA 4OTTA 4TQ0A 1HK1A 1MIYA 1GNJA 1HA2A 1MIVA 1LNSA 1MA9A 2CKXA 3G9KD 1TF0A 2E0YA 3H3AA 3W1SA 5FUOA 2BXKA 4WA6B 4C31B 3A75A 4F5SA 1GNIA 2DG5A 1O9XA 3SIVB 1MM8A 2BXLA 1VZSA 2K0NA 3LU8A 2Z8JA 4FJCB 3WHQA 4G01A 1HK3A 3JRYA 4S1YA 2BXGA
chains in the Genus database with same CATH topology
2LXSA 2LQIA 2LXTA 2LQHA 1KDXA 4D7XA 2K0NA 2AGHB 2KWFA 1SB0A 2GUTA 4I9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXS A;  2LQI A;  2LXT A;  2LQH A;  1KDX A;  4D7X A;  2K0N A;  2AGH B;  2KWF A;  1SB0 A;  2GUT A;  4I9O A; 
#chains in the Genus database with same CATH topology
 2E0X A;  2I30 A;  2BXE A;  2NQO A;  1H9Z A;  4FIP B;  2VDB A;  3JQZ A;  4G04 A;  3KJL A;  4L9Q A;  4L8U A;  4Z9O A;  4ZCG A;  4PO0 A;  1H5W A;  5IJE A;  3V09 A;  2QM6 A;  2BXM A;  4L9K A;  3VQI A;  5DQF A;  2V36 A;  3PLA A;  3NVM A;  2I2Z A;  3UIV A;  5BPK A;  4BY9 C;  1HK2 A;  2BX8 A;  1VFI A;  2QMC A;  2EFH A;  2ROH A;  1KW2 A;  2XW0 A;  5IIU A;  1IJG A;  4N3Z A;  2QHB A;  2XVQ A;  1MUS A;  1BM0 A;  3BPJ A;  3FWC C;  2NNW A;  4HGM B;  3GQU A;  3MHH B;  4IW1 A;  5DBY A;  1E7C A;  4OTU A;  2Z8I A;  4ZBK A;  3NVI A;  4GG2 A;  4M70 B;  3CX9 A;  2DYO A;  3V03 A;  2DBU A;  2AGH B;  2BXQ A;  4TQ1 A;  1HK5 A;  1AO6 A;  1LOT A;  5GIP A;  4DM0 A;  3NVK A;  1E7F A;  4GDX A;  2BXH A;  4ZBR A;  4IW2 A;  1FOU A;  5IJ5 A;  3WHR A;  3M99 C;  5HOZ A;  3GA9 L;  2BXA A;  5B5T A;  1KXP D;  2AJE A;  4F5T A;  1JNB A;  4ZC6 A;  1J7E A;  1TXU A;  2XW1 A;  1E7B A;  1E7A A;  2LOQ A;  2EFE A;  5ID7 A;  2XVV A;  3FWB C;  5GIO A;  1E7H A;  2BXC A;  4GDK B;  3V08 A;  3KIK A;  2LXS A;  4E99 A;  1E7G A;  2LXT A;  5IFO A;  4LUF A;  4DHX B;  4LB2 A;  4F5V A;  2XVU A;  2JUH A;  1MIW A;  1KDX A;  3B9L A;  4Z69 A;  3GQX A;  4ZBQ A;  1J78 A;  2EFC A;  4BKE A;  1HK4 A;  2LQI A;  4F5U A;  2Z8K A;  2DYM A;  3A73 A;  2KWF A;  3LU6 A;  1SB0 A;  2XVW A;  4OT2 A;  3TDL A;  5IIX A;  2OZB B;  1BKE A;  4FK5 B;  5ID9 A;  2XMO A;  4OR0 A;  2LQH A;  4GDL B;  2DBW A;  2DBX A;  1E78 A;  3NMU A;  1UOR A;  4LUH A;  2BXN A;  1NT2 B;  2BXF A;  2BXP A;  2BXI A;  4W4U B;  5GHK A;  3B9M A;  5GIN A;  2KBZ A;  2XSI A;  2YDF A;  2BXB A;  2BXD A;  4K2C A;  4D7X A;  2EFD A;  5IJF A;  1MUH A;  1N5U A;  1E7E A;  4N0U D;  4I9O A;  1BJ5 A;  4ZUX V;  2BXO A;  3LU7 A;  4MBE C;  4LB9 A;  4K71 A;  3MHS B;  2OT3 A;  4JK4 A;  3H37 A;  4G03 A;  5IIH A;  2VUE A;  4N0F D;  2VUF A;  3WHS A;  4NAW B;  3ECP A;  4EMX A;  3SQJ A;  3ICX A;  3SIU B;  3FNM A;  4HGK A;  1E7I A;  2GUT A;  4J2V A;  4LA0 A;  5D7G A;  4OTT A;  4TQ0 A;  1HK1 A;  1MIY A;  1GNJ A;  1HA2 A;  1MIV A;  1LNS A;  1MA9 A;  2CKX A;  3G9K D;  1TF0 A;  2E0Y A;  3H3A A;  3W1S A;  5FUO A;  2BXK A;  4WA6 B;  4C31 B;  3A75 A;  4F5S A;  1GNI A;  2DG5 A;  1O9X A;  3SIV B;  1MM8 A;  2BXL A;  1VZS A;  2K0N A;  3LU8 A;  2Z8J A;  4FJC B;  3WHQ A;  4G01 A;  1HK3 A;  3JRY A;  4S1Y A;  2BXG A; 
#chains in the Genus database with same CATH homology
 2LXS A;  2LQI A;  2LXT A;  2LQH A;  1KDX A;  4D7X A;  2K0N A;  2AGH B;  2KWF A;  1SB0 A;  2GUT A;  4I9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...