2LY9A

Solution nmr structure of homeobox 2 domain from human zhx1 repressor, northeast structural genomics consortium (nesg) target hr7907f
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
74
structure length
74
Chain Sequence
b'SHMPDSFGIRAKKTKEQLAELKVSYLKNQFPHDSEIIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc fingers and homeoboxes protein 1
publication title Solution NMR Structure of Homeobox 2 Domain from Human ZHX1 repressor, Northeast Structural Genomics Consortium (NESG) Target HR7907F
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 23
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2012-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ly9A00
3M3YJ 2Y0SN 1MBJA 4M6VA 2QCOA 4M3DA 5F0CA 2FD5A 1X58A 3TW7A 3PO3J 1MBHA 2CJJA 3ZQHA 5K7ZA 1ZTRA 3PM1A 3LSRA 3GTPJ 4CYCB 3IH2A 4A3LJ 5FLMJ 2X48A 3BG5A 5IOYA 3HBLA 4ABZA 3TP3A 3LOCA 1G2HA 1I50J 2FJ1A 2JA5J 2DMTA 5JLWA 3H0GJ 3Q3SA 1VI0A 2KT0A 4FE4A 5IYBJ 1XG1A 3TEDA 1IGNA 4BKXA 4IHXA 3BT9A 4V2GA 2L7MP 2Y31A 3FK6A 2LFBA 1U78A 2AO9A 4JX5A 1BW6A 2M8GX 2X9DA 4A3CJ 2DA6A 1RKTA 4A3JJ 5J1RA 4MFDA 1YRNA 4AYBN 2Y9YA 3TW6A 2K9SA 1EF4A 4FISA 1IRZA 1GT0C 5HODA 1Y1WJ 2EQRA 2R7ZJ 3Q0WA 4A3KJ 1FTZA 1QPIA 1JUPA 3FKIJ 5F04A 2LP0A 4LOCA 3JREA 1Y1VJ 4JP0A 1LFBA 4XRSA 1E3OC 1X2NA 3M4OJ 2WAQN 4MFEA 3HOWJ 3BTLA 1APLC 2E19A 3SJMA 3BR2A 3BQZA 3LNQA 2K9QA 1ETVA 3HGGA 5FLVA 3S1NJ 1AKHB 2K40A 1YRNB 2HOAA 1OCTC 2CUFA 3L1PA 1ENHA 2OPTA 3BR1A 4DYQA 5EF6A 3ZQIA 1ETYA 2DA1A 4DYRA 3CDLA 2O9LA 2JN6A 2JK3A 2M9HA 3S14J 4Y7NJ 1TWCJ 3D1NI 1WH7A 4QIWN 1LE8A 2NOGA 4A3FJ 1ETQA 3FISA 3OSFA 1XS9A 3QQAA 1FIPA 5E3MA 5DTDA 3S2DJ 3BR5A 2CQXA 3JRBA 1ZK8A 2W48A 1WH5A 3GTMJ 2VPRA 3LSJA 4FCYA 3DEWA 5EGOA 5M3MJ 5EZGA 5M5XJ 2MSYA 1MBFA 5GPAA 3RZOJ 2NVQJ 2KDZA 1ETKA 2D5VA 1A6IA 1RESA 1RKWA 1JKOC 1JJ8C 2XPUA 9ANTA 1FTTA 3BR3A 1JT6A 4FE7A 1HOMA 3QPLA 2COBA 1U9NA 3OOUA 2GLOA 2GM4A 4C3HJ 1JUSA 2ID3A 5IP7J 1HCRA 5EDNA 4CYCA 4IHVA 2DA7A 2XB0X 1TWFJ 2OF7A 1SFOJ 5IP9J 2JWTA 3JRDA 3GTJJ 5J3LA 1B8IA 4A93J 2DTZA 3IV5A 3RQIA 4XICA 3HOZJ 1OFCX 2IEKA 2RAEA 4A3DJ 5EZHA 2TRTA 5GP9A 3CCYA 1JKQC 5FKLA 2EZHA 1RETA 3S1QJ 1H8AC 1HDPA 2ELKA 2DJNA 1RPWA 2EH3A 1BJZA 2M0CA 2WV1A 2JJ7A 3BG9A 2XPWA 1OCPA 1B8IB 2XGCA 2XGEA 1IC8A 3HOYJ 3O8HA 2L7ZA 4A3BJ 3Q0UA 2O8KA 4EEFG 4JYKA 2XGDA 1B72A 5E3LA 3BTCA 1ETWA 2DA2A 3CMYA 1ZQ3P 2JMWA 2YUSA 2XB5A 4IEJA 4AUXA 3RZDJ 1WI3A 1ZGWA 4J19A 1TC3C 2PMZN 5J1UA 5E3OA 1AKHA 1JUMA 5J1YA 1Z0XA 3GTKJ 2HYJA 3HKZN 1S7EA 1LFUP 4BBSJ 1OJLA 2L7FP 1MSFC 3TP0A 5FKOA 2E1OA 1IUFA 3JR9A 1ZR4A 5F0FA 2EZLA 4BXXJ 5IOZA 4DZJA 5EYRA 1B72B 2NVXJ 1NTCA 3OSGA 1PUFA 2R0QC 2HOSA 2X6OA 1TWHJ 2IAIA 1QRYA 3PO2J 3IH4A 4BBRJ 1HF0A 3MVPA 4XRMA 4M3GA 1K83J 2R93J 3JRGA 2CQQA 4C3JJ 1AHDP 3OIOA 5EEAA 4IHWA 3LSGA 1ITYA 1BL0A 1A5JA 2O7OA 3B6CA 1K61A 2EZKA 2G0EA 2ECBA 1U9OA 1BW5A 1D5YA 3HOVJ 2XRLA 4B4CA 1PUFB 1F43A 2HOTA 2L9RA 2EBIA 2AHQA 3G1LA 2M34A 3NAUA 1H88C 2XSDC 4X1EA 4A3GJ 5EG0A 4A3MJ 4AC0A 2H8RA 4XIDA 4IHYA 4D5CA 1QVTA 3BTIA 3S17J 1P7IA 4A69C 5F0HA 3K2AA 2ME0A 1MBKA 2YU9J 2NS7A 4UUTA 1WGXA 1SANA 2LK2A 2CU7A 2LLKA 1IG7A 1AU7A 4W1UA 5JLXA 2GBYA 3QPSA 3K7AJ 2DMUA 1CQTA 4Y52J 3A01A 2DA4A 2HXIA 3IH3A 2E2HJ 2DMNA 5EG0B 3ZQCA 1I3QJ 5K7HA 2ID6A 2Y9ZA 2FQ4A 4B1RA 4RDUA 5IPAA 1UG2A 4D7NA 2JA7J 5C4JJ 2WB1N 1ETOA 3CQZJ 4I76A 1DU0A 1GVDA 3BR6A 3VPRA 2LTPA 2R5ZA 2CUEA 3I4NJ 4A3EJ 1W0TA 1I6HJ 2LR8A 1W0UA 1XC5A 3S16J 4RBOA 2E2JJ 5FKMA 3JRAA 3JRCA 2LY9A 2ME6A 1TWAJ 4MIMA 1T33A 2YS9A 1NK2P 3SDGA 1IJWC 4QTRA 3A01B 1UMQA 2DA3A 4JX4A 1MH4A 2FX0A 3LSPA 3HDDA 4DW6A 2VUMJ 1WCMJ 1HDDC 1NK3P 4MLOA 1R9TJ 4JX6A 3GBGA 2M2EA 2R5ZB 4HNVA 5F1JA 3G1OA 1JJ6C 3HGYA 2ECCA 1MBEA 2NVYJ 4UUSA 1FJLA 3ZQGA 5FJ8J 1VF9A 4C2MJ 1GV2A 4C3IJ 1F36A 3FK7A 4BY7J 5E3NA 5C3EJ 3DCFA 4D7MA 2NVTJ 3S1MJ 2DMPA 1ZR2A 4V2FA 1UHSA 2MG4A 3ZQFA 2R5YA 5IYDJ 1RR7A 2CRGA 1DU6A 1U8BA 5M5YJ 4FTHA 2K9NA 3Q0VA 1FEXA 2P81A 3I4MJ 4UUSB 2DN0A 3WHBA 4XRSG 3HEFA 3GTLJ 5FKKA 2VKEA 1MNMC 2HQ5A 1MSEC 1JT0A 1T56A 2Y2ZA 4BY1J 1QVUA 3HB9A 3JRFA 1WPKA 2JA6J 3JRHA 3W6VA 3B6AA 2LD5A 2R5YB 1MBGA 4I6ZA 1X2MA 1MH3A 2HI3A 2VKVA 4NDLA 2JA8J 4QSHA 2EZIA 3GTOJ 3O8GA 3ZOBA 3S2HJ 5M3FJ 2H1KA 3BG3A 3F0CA 2XPVA 5DS9A 4A3IJ 5IP6A 4G12A 2DA5A 2N8GA 3NARA 1Z77A 4L5EA 4W97A 2E2IJ 3GTGJ 3S15J 2TCTA 3MKLA 3MN2A 1IDZA 2VI6A 5IYCJ 1JGGA 1BA5A 1GV5A 3RKQA 3UKGA 2LVSA 1GUUA 2Y30A 4MO7A 2HXOA 2I10A 3G1MA 1Q1VA 5C44J 3HOXJ 2IBDA 1P7JA 1TWGJ 4DZPA 2QF7A 2MW8A 3BQYA 5M5WJ 4M3BA 3BR0A 4GFBA 1GDTA 2R92J 1JTYA 3SFIA 3A03A 2HDDA 1ORKA 5C4XJ 2ZB9A 5F27A 1IDYA 1JKPC 3BTJA 1H89C 5K7FA 5GPCA 1ETXA 1FIAA 3WHCA 4B3AA 3JRIA 3H3VK 2LKXA 1IV6A 3E7LA 1ZKGA 5BNGA 1VFCA 5FKNA 4D5FA 2NS8A 2DMQA 3ZQLA 1LE8B 1POGA 1HLVA 3S1RJ 3GTQJ 1JTXA 3HOUJ 1JKRC 5F08A 4S0HB 4XK4A 3A02A 4M3FA 2B63J 2L0KA 5EGOB 4DYCA 4X6AJ 1VNDA 3C2BA 4M3EA 1O4XA 3HM5A 3FIWA 2MGQA
chains in the Genus database with same CATH superfamily
1R5ID 2Y0SN 2XHKA 1DPUA 1J0RA 2GZWA 1JHFA 3I5UA 3PNVA 4WWCA 3ZQHA 3L2RA 5K7ZA 4XKCA 2A69F 1ZTRA 3PM1A 5F64A 2BY1A 2ZFWA 2M7AA 4A3LJ 1O7LA 1ZELA 2O0YA 1U0JA 3HBLA 4ABZA 3TP3A 3LOCA 3IKTA 1FT9A 1G2HA 3WG9A 1WJCA 3DLLF 2FJ1A 2MFZA 2DI3A 1LDJA 3E0JB 4XKBA 1V54H 1YW7A 1VI0A 2L01A 3OYLA 4UVBA 1IGNA 2JA2A 4ZC3A 2ZCWA 5LHHA 2QQ8A 3WU1B 4IHXA 1FNNA 1U5TB 2UXXA 4IZZA 1KONA 4I09A 3LSKA 3CF2A 1U78A 3VFZA 3WTVC 2Y0SA 1YTYA 2KZVA 2KFDA 2KIQA 1Z05A 2DA6A 4A3JJ 5J1RA 2OZ6A 2K9SA 4I0AA 4FISA 3L7WA 1USTA 1IRZA 2LREA 1KQ8A 2EQRA 2R7ZJ 3Q0WA 2L5QA 4HLXA 1FTZA 3CJRB 3HC7A 2BW3B 1XMAA 3GFMA 1QNTA 4ZYDA 1EH7A 1LFBA 2ZXWH 4PJNA 3AKZA 2QBYA 3T1BA 1E3OC 4OOIA 4B48A 4AIKA 3QODA 1D0ZA 3HUGA 4BHBA 2K3FA 3SEQA 3HTUA 1S29A 3CC7I 3FMRA 4UB8C 1W7PA 4R79A 3SZPA 2IW5A 2OPTA 3SEZA 3BR1A 1R58A 4J01A 2XGXA 1FOXA 4IX7A 3ZQIA 1ETYA 4DYRA 5DUIA 1T0FC 2M9HA 1MMAA 4JOMA 4IQJA 4ENNA 3KYDB 4NC6A 1TWCJ 4G6QA 4UB6C 4EM2A 1OR7A 4CO8A 4A3FJ 1BOBA 3FISA 5HLTA 2DQLA 3A2KA 1XS9A 1W5SA 3GFLA 1Y39A 2GXBA 3AG2H 2DOEA 2F5VA 3GWZA 1DP7P 1FPQA 1WSUA 2W48A 3CDHA 4KN4X 3RPUD 4XLHA 2CG4A 1TP4A 2A6TA 2IPQX 3DEWA 5D6EA 5M3MJ 1UZCA 2KIFA 1ETKA 1MIJA 2HOEA 3EUAA 5B66C 1ZREA 2EV6A 4HYEA 3V8LA 1R6RA 3MEXA 1JJ8C 3A1YA 4LITA 3TMOA 1FTTA 2CV1A 2VE8A 2EFWA 1YIOA 2YR2A 1HOMA 3QPLA 3W2VA 2M45A 3OIPA 4AU7A 2IJLA 2GLOA 4CSWA 4OIOF 1MJ9A 1HCRA 5CYVA 3GVAA 1YYVA 2W4SA 4Q4ZF 2VC0A 1PVEA 2FU4A 2XB0X 4FETA 1SFOJ 2UWMA 3RDIA 2BEOA 3JRDA 2JSPA 4KIGA 3D5LA 1OISA 3K69A 4A93J 5ICCA 3ZMTA 2GIVA 2OUMA 4KT6A 1R4NB 4XONA 1J75A 1S7AA 3D0SA 1P6RA 2X1CA 2YX7A 3CCYA 3MZHA 4L9VA 1V5FA 3T5XA 2K27A 2IA0A 2EIKH 2EZHA 1XGMA 3S1QJ 3J80K 3CLOA 2ISYA 1HDPA 2ELKA 4MQ9F 1ZRFA 1TT0A 1IUYA 4BEHB 4NQWB 1UCRA 3K4CA 2HVRA 1OCPA 3OYFA 2VB6A 1B8IB 1HXDA 2L9NA 3LA2A 5FFXA 4ZZLA 2X51A 3O8HA 2WTEA 2YU3A 4CCJA 4UY8I 2NRAC 2XF6A 2Q0OA 4GO1A 3I58A 3T0YA 2ETHA 1DP3A 3BTCA 3DQVC 3GLLA 2XB5A 1SD6A 4IEJA 3RZDJ 1HKTA 3OYEA 1FZPB 4ESBA 4J19A 2R7WA 4PGGA 4I0BA 5J1UA 2VKHA 5CLSA 2GA2A 4G94A 1TNSA 4M72A 3S8PA 4CA0A 2P7VB 5J6XA 2HYJA 3S3NA 1S7EA 4A6DA 1LFUP 4BBSJ 1OJLA 3REOA 1MSFC 2L9SA 4S05A 4L5JA 3WTUC 1SVMA 4ASNA 4XOTA 5H2FC 2EZLA 1IN5A 2CUZA 3EUHA 4BXXJ 2Q8KA 1K6YA 1UHMA 4BE1A 2R0QC 3ZGKA 1DPRA 4IRIA 1IZ1A 1TWHJ 3PJRA 2Q2EB 2E71A 4KA4A 4XRMA 4PFOA 2LY1A 2ZJRF 2FE3A 2I8DA 5DUKA 3JRGA 1VQKI 1AHDP 1HSTA 1EA3A 3AG4H 1T08B 4HV5A 5EEAA 3R4KA 1ITYA 1A5JA 2R7FA 3GFIA 2RQPA 4YFKF 2X1DA 4KN7X 3WTTC 4MHGA 2P5VA 1DQUA 2K9LA 4K2EA 2FRHA 3TGNA 1MNEA 4IL6C 3SYTA 2NNNA 1OCRH 2L9RA 2X85A 1L0OC 1F43A 5ICGA 3KLOA 2KKOA 1W4MA 1T98A 3GZ5A 4ANJA 4P96A 2V9KA 3U2RA 3OYCA 2CWEA 4RGSA 5E20A 4BACA 2RDPA 1EKEA 4A3GJ 2WAQA 5EG0A 4Y17A 4A3MJ 1YS6A 2EFNA 4AC0A 2E7XA 4XIDA 2CW7A 5AIPA 2KIMA 4IHYA 2JRTA 3BTIA 5D5UB 1ZHFA 5F0HA 3M1CA 3KYLA 2PJRB 1TW2A 2VJJA 2HFHA 1KU9A 1D1CA 3TDZC 2A6EF 1B59A 2BZTA 1D0XA 3QOEA 4GDFA 3OV8A 1ZLKA 4AIDA 1U2WA 1KQ0A 2HXIA 2E2HJ 1I27A 3OL4A 3JAMK 3ZQCA 1BI0A 2BYVE 1YX3A 5IPAA 1D8KA 4D7NA 3HHGA 2WB1N 2WAFA 1N25A 2OZUA 1DU0A 3VPRA 2LTPA 2CUEA 4RB1A 4A3EJ 4EGYA 2HQNA 1I6HJ 2E1NA 5FRMA 1W0UA 1MMNA 4LG0A 1XSVA 2E2JJ 3DTIA 4ZDOA 2ME6A 3HYIA 1TWAJ 1T33A 2ZSIB 4QTRA 3A01B 1UMQA 1HC8A 2KQRA 1QGPA 4EQQA 1MH4A 4JQFA 1G3WA 3LSPA 1RUNA 3HSFA 3CP8A 1BJAA 1QZZA 2KJCA 3B02A 4WX9A 1MW7A 2FEZA 2J5PA 5HLIA 2OTLI 5H6RA 5DCFA 3CCQI 3EUKL 3NQOA 2R5ZB 1H9TA 2L4MA 4PJMA 3KZZA 2DT5A 2IGOA 3B73A 4UUSA 4PCQA 1FJLA 2WB1A 2R3SA 3HRMA 1HBXG 1Z9CA 3W3CA 3FXOA 3FK7A 2QYOA 4OU0A 1RRJA 2NVTJ 1SMYF 3R0JA 1SAUA 4MTDA 1ZR2A 2LH9A 1BI1A 3OYGA 4MNUA 3OL3A 1Q1HA 1UHSA 3R6SA 3M7GA 1MDMB 1J9IA 1O57A 1ZYRF 3LQRA 3ZQFA 4EJVA 1LVAA 1UFMA 2OJED 3LAJA 1S7OA 3WTWC 2K9NA 1DGRM 3I4MJ 1T6SA 1R4MB 2FNPA 1MJBA 4OAZA 5J4YA 1W7PD 2VKEA 4EM1A 4U0YA 3OYDA 5EEGA 3OYJA 4PJJA 5LD2C 2DLLA 1JT0A 3MQ0A 4OMZA 2P0WA 2F4OB 2E34A 4CCOA 4N9IA 1T56A 1RIOH 1AA7A 2DAOA 3HB9A 4M9ZA 2BY2A 4B09A 2PMZA 4B43A 2K7LA 1IN4A 4YFXF 2JSCA 2ZJ2A 1CF7B 1YW8A 4E7IA 4NDLA 5ICFA 3V7SA 3DPUA 2EZIA 3CCRI 1WZ2A 4FX0A 3W6KB 5M3FJ 2H1KA 1ON2A 1A6QA 2XPVA 2L3DA 5DS9A 3NWTA 4G12A 3BWGA 1WWXA 5L3GA 2E2IJ 5KAFC 3GTGJ 3CP2A 4F92B 1E2XA 3OS0A 2VKDA 3MN2A 2K4BA 3DKXA 3MCZA 3CDIA 2DO7A 5D8KB 3KZIC 4JBAA 3KCCA 1KQ9A 2M8EA 5E1WA 3RKXA 2I10A 4E7LA 5HDGA 3C1DA 1Q1VA 2BVLA 3I56I 1P7JA 4DZPA 1I5ZA 3IKVA 1VQPI 2PEXA 2WADA 3BQYA 1XSDA 3HPGA 3TOAA 3KP4A 4HNTA 3I59B 4JK1X 5D5WB 3J7YJ 1XDSA 2CYYA 2QZ8A 2M3AA 3BTJA 3VSLA 4EMSA 5K7FA 2YX4A 4IQ4A 4A12A 3RKWA 5GPCA 1ETXA 1R23A 3DF8A 1KA8A 2BY3A 4XQFA 1FIAA 3CESA 5A2QK 3JRIA 1ZGAA 2LKXA 1VTNC 1P4WA 4OWRB 4UVCA 2IA2A 2K85A 1B9NA 1KU7A 1H9GA 3S1RJ 1MD0A 1P92A 2VBYA 3HOUJ 3F21A 1V4RA 4EJOA 5E1ZB 3KP6A 2PJPA 1E17A 3P7NA 5CQGA 2X0LA 3Q9VA 4M3FA 3F8BA 3FXJA 5LGTA 1ZG3A 4WF2A 1VNDA 1DGWY 2ZFUA 1KZHA 3WE2A 3GW2A 4BJ6C 3TDUC 2RNGA 2F6CA 1BC8C 5BS6A 2KMUA 4UUVA 3M3YJ 5E17F 4BQOA 4M6VA 5D5XB 1G3YA 1CGPA 3SHFA 3ABKH 3PO3J 2E1CA 1U5TA 2BE5F 1G3TA 2H27A 2F4IA 3KPHA 2HDCA 5LEKA 3IH2A 4CYCB 5FLMJ 5IOYA 1X3WB 2K4JA 4BQQA 1EV7A 2XC7A 3O6BB 2HPIA 2JA5J 3G73A 1LEAA 1SD7A 2ICWG 1E3PA 3H0GJ 3F6OA 2KT0A 2IGKA 4BHPA 3WGHA 3L2CA 2VPLA 3QU6A 1B1BA 2MABA 4FX4A 4Q47A 2BW3A 1GVJA 3ROUA 5J8CA 1SFKA 4KIBA 4P9FA 5LLQA 2X6WA 1YOVB 2LFBA 1S5LC 4KJZA 1K6OA 4HV6A 3L2UA 2KPMA 2F5FA 1BW6A 2MC4A 3HIFA 4MQVA 4N4NB 5D4RA 1RKTA 1ZGJA 4II2A 3ERED 2Y9YA 1YITI 2Z16A 2XIGA 4BHCA 2D1HA 2HKOA 4M73A 5E79C 2HZTA 4IXAA 5HODA 1Y1WJ 4LLGF 2MH2A 5L3DA 3ZR8X 1VQ9I 3PSFA 3FXQA 2H6BA 3DWLE 4LOCA 5B3SH 1Y8QB 3OOPA 5IT3A 2F48A 4XRSA 4KMUX 4PSXA 3OS1A 1SAXA 1N75A 2Q1ZB 2HNHA 1XCVA 5ILSA 3M4OJ 3F8FA 4MFEA 5DCMB 3BTLA 1TZLA 1XGNA 3BJ6A 3BR2A 1Z7UA 2BBYA 1AKHB 2NVUB 2BXZA 1FOWA 3ZN0A 1OCTC 3NRVA 4I02A 3X2QH 3L1PA 3ZCOA 3SZGA 5EF6A 3K9TA 2PMHA 3I0TA 4DJAA 3CDLA 2O9LA 2JK3A 2L9VA 4G8XA 1QU3A 5D5VB 4M6XA 2NOGA 4KYWA 4BUPA 4D1QA 1FIPA 2EPFA 5JVGF 2KDOA 1F9NA 3CD6I 4BGDA 4U0VA 1VQOI 3E6BA 4QWQA 3VODA 1IN6A 5EZGA 1RC9A 5M5XJ 1LEBA 1Y6IA 3QOPA 2MSYA 2W25A 1MBFA 3RZOJ 4P1WA 1UB9A 2KDZA 1OYYA 4RGUA 3FM5A 2X6YA 3DFGA 3FZVA 1RESA 4LD5A 2AQFA 3H5RA 3SDBA 1W5CC 2RREA 4FE7A 1WQ2A 3BCBA 5J8FA 2UV1A 2XAQA 1OKRA 3FBIB 1PP8F 3BPVA 3I53A 3HJEA 1JUSA 4C3HJ 5EDNA 2UUZA 4IHVA 2HTJA 3OWTA 4BL0B 2OF7A 4YIFA 1XDUA 5IP9J 3F8CA 1VQNI 3DKYA 3K4BA 4NQWA 5ILUA 1B8IA 5JI6A 3IV5A 3RQIA 1MMGA 3M1EA 1OFCX 4UV8A 4N4OB 2Z33A 3HOZJ 3K70D 3KETA 2HKXA 4A3DJ 3J7ZI 2TRTA 3ZMSA 5HVQC 4RM3A 3BP8A 4UV9A 5GP9A 4CDGA 1T0FA 3VDXA 5LHIA 4LK0F 1HKQA 2BOLA 1RETA 3H9QA 1OPCA 3WU0A 3DPLC 2CS3A 2RV8A 2CFOA 4HF1A 2A68F 4HBLA 2Y48A 2DJNA 2RNJA 1RPWA 2EH3A 1FLIA 1BJZA 2DOFA 2H1LA 2JPCA 2LMDA 2WV1A 3DTKA 4CUGA 5HS9A 2IVMA 5CJ9A 2XGEA 5K1YA 4HOBA 4XMYA 4FASD 2P8TA 2L7ZA 1R5GA 4A3BJ 1AWCA 3WGIA 3CMEI 1PUEE 5AONA 1S3JA 2O03A 2O6GE 3C2HA 4A2UA 3HL2A 2M1BA 3WTSC 1IW7F 1WI3A 5HNHA 1R49A 1Y0UA 4IPAA 3ONQA 3WE3A 2MD0A 3V7RA 4P9UA 3CCJI 4S04A 1JUMA 3LAPA 5J1YA 3FXLA 3HSEA 3JCUC 4CICA 3GTKJ 3HKZN 3S32A 2L02A 1X4PA 3RYRA 4HX8A 5FLXZ 2DFHA 2L7FP 1QZEA 1WKMA 2RKHA 1FX7A 2OD5A 1X1DA 2E1OA 5KHDA 2A5WA 3BG6A 1R1UA 1OMIA 4Y33A 1A04A 4DZJA 1YLFA 5EYRA 1B72B 2NVXJ 3K4NA 3V7CA 3AG3H 1YI2I 1F1ZA 4KT5C 2JUCA 2X6OA 1XMKA 2OA4A 2VL8A 3PNYA 4P5OA 2EA4A 4DGWB 3J81Z 3GX4X 3MKWB 4PSWA 5IY5H 2VBXA 3IH4A 4ZZDA 4HW0A 3QWLA 4M3GA 1N77A 4C3JJ 3SZTA 2VLAA 3OIOA 2VXDA 2E36A 4EJWA 1BIAA 4IHWA 3HOSA 3FHZA 2AXTC 2O5RA 3LSGA 3GXOA 1BL0A 1FYMA 4EJUA 2X6XA 2O7OA 1YJNI 1WFXA 4XBFA 2TDXA 2PJRA 2EV0A 1MJAA 3HKZA 2EIMH 5DEQA 4B4CA 1IO2A 1I3AA 1OCOH 1PUFB 1KU2A 5HLHA 2HOTA 2JPBA 2QSGX 2M34A 3DKWA 3NAUA 3GCMA 4RLFA 5CPRB 1XN7A 2VONA 4G7OF 2F5EA 2OQGA 3DPTA 1Z1DA 2DYSH 2QKMB 2PLYA 2VOPA 4IO9F 1ZG1A 4RLQA 4HQEA 3QU3A 2YU9J 4I7HA 2NS7A 3GMEA 1WGXA 4HX7A 4UUTA 1TBXA 1P2FA 2LLKA 3H36A 2CUJA 4W1UA 5F1RA 2GBYA 3QPSA 2Z3YA 3BROA 1CQTA 3ZMDA 4Y52J 2D2WA 3A01A 2EIJH 3KP3A 2DXIA 3IH3A 2KL4A 2E5NA 5K7HA 2KP6A 4B3XA 3F8MA 4B1RA 2JRMA 3HHHA 3JTHA 1XCBA 3CCVI 4OIPF 4M9XA 5L3FA 3ABUA 1XGSA 3CQZJ 4LGWA 4A5MA 3BR6A 4PK4A 2R5ZA 1W0TA 3FHNA 1BN5A 3HZJA 2A05A 1XC5A 3S16J 3LFUA 1HA8A 5TISC 2E60A 3JRAA 4DIQA 2CO5A 4MIMA 2YS9A 4YIIA 1NK2P 1IJWC 3OYHA 2WY7Q 3TQNA 5FROA 3E5UA 3UR3C 5JVTA 2PX9A 3H5NA 4CH7A 3HDDA 1WJAA 2K5CA 2VUMJ 4NNJA 1HDDC 4ZYEA 4IF4A 1NK3P 3BZKA 5KVRA 4XLEA 2GA1A 3NEUA 2RGVA 2M2EA 2ELJA 3ABLH 5D8LB 3S3MA 4EJTA 2VC1A 1JJ6C 3RYPA 3HGYA 1MBEA 2NVYJ 2QENA 2VE9A 4C2MJ 1X1AA 3MKZA 2E5ZA 2VQLA 1GV2A 1F36A 3L00A 4LLNA 1K78B 2CQNA 2GXAA 4O3MA 1X4OA 3S1MJ 2DMPA 4WCGA 5JHUA 4BNCA 3A0HC 3OR2C 1LDDA 2FUG2 2MG4A 2FBKA 4ZYAA 3DEUA 2M4GA 1YG2A 3LL7A 2A5YB 4EATA 4E70A 3KEOA 3LWFA 3W2WA 1CF7A 1G59A 4BQAA 2EK5A 3G4SI 4AIJA 2ZNYA 4E7HA 3N05A 1STZA 2DN0A 4C30A 1VQ7I 1IXCA 2DODA 3T8TA 3DBLB 1MSEC 2JZYA 2FBHA 3OR1C 1IRFA 1OLTA 1JHHA 3ERMA 2XRNA 2R7OA 5GAHJ 2IGNA 5IT9Z 5TGTA 1XGOA 2LD5A 1NG7A 2R5YB 1MBGA 1V5GA 2RVCA 1MH3A 2IGMA 1FSHA 1MZBA 2HI3A 2VKVA 4LMYA 2JA8J 2LG4A 4QSHA 3GTOJ 3O8GA 3ZOBA 5FGMA 5KK1A 4A3IJ 5IP6A 4BJTA 2H8WA 5BQTA 2N8GA 2DA5A 3NARA 3I59A 2W85A 4L5EA 4W97A 5CQEA 3ZP5A 4G7ZF 3DTEA 4R8HA 2STWA 1PP7U 4XLFA 4BXFA 5BOXA 3CCLI 2XVCA 2O3FA 4QPOA 3IP4B 1REPC 2NYXA 1BA5A 3RKQA 1GUUA 2Y30A 1QQIA 2HXOA 5LBQA 4WXCA 1J09A 1KGSA 4F52A 5K5RA 3G1MA 4OINF 3ABMH 3R60A 4IVNA 5C44J 4L0YB 1Y8RB 2KLOA 5HLGA 3HOXJ 4PJLA 2F5CA 2MW8A 4XLNF 1ZG5A 3HUGB 5M5WJ 3CF5F 5ICEA 3A03A 4HPQA 2HDDA 2IT0A 2E7WA 2XAJA 2ZB9A 1X1BA 1IDYA 2HVSA 1JKPC 2IS2A 2LY2A 1H89C 2P4WA 1XSXA 2XF7A 4AM3A 1SVOA 1TW3A 1QZYA 3P9IA 3E5XA 1U6GA 3PL8A 2QKLB 2OV7A 3WHCA 4M6YA 3OMYA 1IV6A 5CKTA 3RQ4A 2MYSA 5J40A 5BNGA 4KNYA 1VFCA 4D5FA 2V7FA 4G9YA 1HLVA 4YEJA 1TQIA 3K4MA 2I5UA 2F5DA 4RA2A 3TKYA 1JKRC 2Y75A 3DBRB 4Y3OA 4BAYA 3H35A 4A5NA 2ESHA 1R7JA 4I98B 1S9HA 4X6AJ 1IV8A 2P6SA 5CVJA 3A4CA 2W24A 2CV2A 1T38A 1O4XA 3FXKA 2Z5UA 3QYEA 4HLYA 1GXPA 1N78A 2IS4A 3DU6A 1MBJA 1D8JA 1I1GA 2QCOA 3O3KA 2FD5A 1X58A 3MAJA 4M3DA 5F0CA 3COAC 1MBHA 2IP2A 2PN6A 3TL4X 1SVLA 4RS8A 3I71A 4HG2A 3ULQB 5K5OA 2WA0A 2GQQA 3BG5A 4NC7A 4WXHA 4UNOA 2JTVA 3AL0B 2DCEA 5L3BA 3F9KA 1I50J 2QLZA 1BR1A 4BE0A 2G7HA 5IYBJ 4FE4A 2LF7A 1O3SA 4O6JA 3HTSB 2KJBA 4YFNF 3TEDA 1E3HA 4LB5A 2L4AA 2HYGD 1QO0D 3F72A 3RPQA 3BT9A 2L7MP 2DFIA 5CVVA 2Y31A 3H9JA 1I39A 3FK6A 5DCMA 2EB7A 3FX3A 3M9AA 2AO9A 1X3UA 2M8GX 2PFBA 3KP7A 4II3A 2X9DA 1LJ9A 1R1TA 4TV7A 4U7DA 4MFDA 2PMUA 3TW6A 2R7RA 2A61A 2UXNA 3PUBA 2NXNB 3QP6A 5LGUA 1EF4A 2LKPA 1GT0C 3CC4I 1YFHA 5KNLA 4O5VA 2FA5A 3RSNA 3GUDA 5HDNA 4A3KJ 2CGPA 2EWNA 1KYZA 2CMPA 1JUPA 3FKIJ 2LP0A 2VASA 1RR8C 3HOVJ 5ILVA 3K2ZA 4JP0A 2GIZA 1V55H 5GAEJ 4YRVA 3ZPLA 3ZXSA 2V79A 4MEXF 3OYNA 4OIRF 3HOWJ 1XPXA 2E19A 2OC6A 3SJMA 3BPXA 3LNQA 2KIUA 4HRIA 4CGZA 3HGGA 5FLVA 1G3SA 2V1UA 2FMLA 2K40A 3JSOA 3BG7A 1YRNB 2HOAA 1YJ9I 2MC3A 4OIQF 1HQCA 1TQMA 2VXZA 1OQYA 4LIVA 2XV4S 2LBFB 2ELHA 2VBWA 2ZMEC 4CZZA 1X19A 3S14J 1Z3YA 2P5LC 1H0MA 4Y7NJ 3R61A 3D1NI 4QIWN 1LE8A 1ULYA 4U0WA 1XMXA 5J47A 5L3EA 4HZFA 3MFKA 3CCEI 4PZJA 1G6NA 4G6DA 3BR5A 1ZK8A 4XSXF 3K10A 2CW8A 1W36C 4I99C 3LSJA 2XKPA 5EGOA 1RNLA 4BDYA 3IAS2 4EGZA 4GRIA 3F22A 1A6IA 3ECHA 3H0DA 4M9SA 4B44A 3HSRA 2M5WA 1JKOC 4RB0A 2KRCA 3BR3A 1JT6A 3D5SC 4ZDLA 1O3TA 3J7AO 3ZQQA 3RI4A 2O61A 5IP7J 3DV8A 2VQGA 4HNUA 3MKYB 4CXFA 2R4GA 5HS7A 1ZRDA 4Y13A 3DBHB 1Z67A 3WG7H 1D3YA 1XTAA 4XICA 2AS5F 4XRFA 3CUOA 2XAGA 1ON1A 2RAEA 5EZHA 3VYUB 5J4VA 3I55I 5L3CA 1SEUA 1KU3A 4BDZA 1Z21A 1IXSB 3L2VA 3O2PE 4BXUA 1JKQC 4X0GA 5FKLA 1TL8A 2C6YA 2L54A 1C0WA 2DBBA 4U88A 1L3LA 2GAUA 1P4XA 1TT5B 5LFAA 1R00A 4HDVA 1IXRC 2JJ7A 3BG9A 2XPWA 2R7XA 4HSTA 5LRRA 2M4KA 2MH9A 4LK1F 4A0YA 1IC8A 4F93B 3HOYJ 2CW0F 2NOJB 4Y4RA 1A36A 5FLXK 3HRTA 3S93A 2ZMEB 3K1MA 2KISA 5K5QA 3IL2A 4JYKA 2XGDA 1B72A 2OU2A 1ETWA 2DA2A 1EH6A 1ZQ3P 4AUXA 5FD5A 2V26A 2BV6A 1ZGWA 4NC8A 3T8RA 3R0AA 4RMNA 4E7JA 2HZDA 2XAUA 2YPRA 5E18F 3BZCA 5D4SA 3IRRA 1NG6A 2ZO4A 3KP2A 2QWWA 1TTYA 4FHTA 5FKOA 3K4JA 1E0EA 1I1SA 1IUFA 3CZ6A 3JR9A 1FSEA 1ZR4A 5F0FA 5JFRA 3RTRA 2LOOA 1WRJA 3OSGA 2WV0A 1PUFA 2HQRA 4XN3A 2HOSA 2VQHA 3LSTA 4RAFA 1R22A 1Z7LA 3K6GA 1RUOA 3PO2J 4BBRJ 1HF0A 3MVPA 3E3VA 2VOOA 1JE8A 1OYWA 4HF2A 5B1BH 3M8JA 3EYIA 3S2WA 4U7BA 1YIJI 3C7JA 4I01A 2EZKA 1QHGA 2G0EA 4IRHA 3FMQA 1FOKA 4DOZA 3BOQA 3ABTA 3FXRA 3U1KA 3RJPA 2RN7A 2W00A 1ZAOA 3ECOA 2BXYA 4L0ZB 5E8IA 2XF5A 3G1LA 2HTSA 5ED4A 2XAHA 3N97A 2Z9OA 3WODF 5JHFA 1H88C 2CH0A 4X1EA 1LQ1A 3BJOA 3DLAA 4ZDPA 3J7AY 3IWZA 2H8RA 4V19K 3MZ8A 3KX2A 3P9KA 4M74A 1P7IA 5B5EC 2QEXI 3ESWB 4QPQA 4XLAA 2DDBA 2NNYA 2CQKA 4E7KA 1JGSA 4EM0B 3ZQ7A 2K02A 2ZXJA 5BPDA 1AU7A 5LRSA 3KYCB 1S8NA 3K7AJ 2DMUA 3CUQC 3K4LA 3ML6A 2DA4A 2IXSA 2W1OA 4BEHA 4KMFA 2V9VA 1J59A 2E1MC 2DMNA 1I3QJ 3JW4A 1GXQA 2QVOA 2IA1A 4RDUA 3P9CA 1UG2A 2JA7J 4B8XA 2ZC2A 2JT1A 4I76A 1GVDA 1ACIA 3QPHA 4ETSA 2WAEA 3H5AA 3D5RC 1WJDA 1ZRCA 3BDDA 2LRDA 4RBOA 3FF5A 3JRCA 4Z6YA 4RGRA 3EPZA 1WVRA 1Z3XA 2K9MA 3H3UA 4H0EA 2ZSHB 1GLNA 3LMMA 5EJCA 1K78A 1MMDA 2DA3A 1FP1D 2QQAA 2YSRA 4BH9A 2FX0A 3CMAI 3C18A 4DW6A 4D9JA 3IC7A 5TJJA 1WJBA 1WCMJ 2XAFA 3P5JA 1WHUA 1SD5A 2FF4A 3I54A 2V1NA 1BI2A 5FFZA 4JX6A 1O3RA 2M7BA 3MMYB 4CZCA 3WTYC 3G1OA 2ECCA 4LB6B 3C2GA 4IRGA 2ADUA 1NHAA 3ZQGA 5FJ8J 3F8NA 4ESFA 1VF9A 4ESJA 2ZXHA 4C3IJ 2W57A 2Q2EA 4BY7J 4HEA2 3DCFA 1ONVA 4UVAA 2M87A 2DW4A 4AWXB 4D7MA 3QP5A 1UG0A 4QLCU 3BJAA 5GAGJ 4ITVA 4H4KC 4L9JA 2X1EA 4LG3A 2D45A 3OIQA 2FOKA 3KIOA 4ENJA 2DPDA 5IT9K 2R5YA 3FMSA 2CRGA 1DU6A 1G8XA 2Y0MA 4CCLA 3IWFA 3Q0VA 2VT2A 1FEXA 2P81A 2XDVA 3CO7C 2DFFA 2X4HA 2HU9A 3WHBA 4XRSG 2K3PA 3HEFA 3GTLJ 5FKKA 1X1CA 2ZXIA 4RAZA 2HQ5A 4AD9A 4F91B 1MNMC 3IUOA 2ZBKA 2Z99A 3K1NA 3ZRGA 3CUQB 3LA3A 2DDAA 1F5TA 2Y2ZA 3PIOF 4Q48A 1QVUA 3JRFA 1VQLI 2E1MB 2XKOA 2JA6J 4EV0A 2HDWA 2W84A 5KCMA 2ZJPF 1BR2A 4IHSA 4U87A 4IOCF 1X2MA 1ZH5A 4L5IA 2IS6A 2W82A 4IKFA 2WBMA 2DOAA 3LSMA 2HGCA 3F0CA 4ZYGA 1Y56A 2EA2A 4XSZF 4DQ2A 2WC2A 4E6KG 2HEOA 3SQNA 2OTJI 1QPMA 2TCTA 2COMA 3FXUA 4D0PA 1QBJA 2XROA 1V5EA 2EINH 2VI6A 2XSJC 1FMVA 3K4KA 3UKGA 4BS9A 4MO7A 1U3EM 3MD2A 4DBRA 3BLYA 4GCVA 1ERDA 3LSHA 1A35A 1W1WE 1R5HA 1TWGJ 2QF7A 4M3BA 4KICA 3H1CA 1JTYA 3SFIA 5FO5A 2DK8A 4LJZF 5C4XJ 5F27A 1ZLJA 4F55A 2IS1A 2JQ7A 1I6XA 1FMWA 2MBFA 2KRFA 4B3AA 2LSOA 1S6LA 3ZMVA 1RI7A 3E7LA 4GGGA 5FKNA 5GADJ 2NS8A 3A0BC 3WTZA 3ZQLA 2XASA 1LVKA 1POGA 3VYTB 3LSIA 4A0ZA 3GTQJ 5LGNA 1K79A 4L9NA 4NB5A 5F08A 3GYHX 1R1VA 3GZ6A 4S0HB 4IJAA 3A02A 4ON0A 4E4HA 3GFJA 2L0KA 1LUJB 4DYCA 4HX4A 3GLXA 2QSHX 2HWVA 3SXYA 1O3QA 2HVQA 1OCZH 3HM5A 2V1XA 1UHWA 4DNCA 4EVIA 1MDMA 3E97A 2UZKA 3LQQA 3V8JA 3TW7A 3OS2A 2CJJA 1B9MA 1J2XA 4XLCA 4BYYA 4F7ZA 2DYRH 3LSRA 2H6CA 3GTPJ 5HNFA 5HDKA 2A3SA 2X48A 4XKWA 4LLLA 1O7FA 1Y0NA 1IRXA 1DUXC 2VT3A 2DMTA 5JLWA 1WJEA 4BE2A 1FP2A 5H20A 3HOTA 3Q9SA 3Q3SA 1YW9A 1WI9A 1XG1A 1DDNA 2D1VA 5E1XA 1SFEA 3U9GA 4KFCA 4BKXA 2Z2SB 1P9QC 1OCCH 2JUGA 2RQQA 1OR7C 3L09A 3KZYA 2QGUA 4V2GA 3HPHA 4LIUA 4BJ5C 1A31A 2DT7B 2WWYA 3KE2A 4PJ0C 4JX5A 4HF0A 5F6FA 4WK8F 6PAXA 4A3CJ 4FQGA 1YRNA 4AYBN 3QYFA 3AG1H 4R1HA 1PDNC 3L2WA 4OMYA 3M8EA 1IAWA 2LBFA 2DTRA 2QSFX 5LEJA 5F04A 1QPIA 2GOMA 2LF8A 5GTHC 1Y1VJ 3TO6A 3JREA 2OCCH 3KEYA 3L9FA 4RAGA 1FBSA 2JVHA 1X2NA 4RB3C 2WAQN 3U21A 1APLC 1VQ4I 1J7KA 3PNTA 3BQZA 3AL0C 5BMZA 1MMSA 1BOAA 1ETVA 1R36A 2K9QA 2R7DA 1YJWI 3S1NJ 3CJTB 3WGGA 5FD6A 3G2BA 2CUFA 1SFXA 3MWMA 1ENHA 2DFEA 2P6TA 1D1AA 1LFPA 3CTAA 4DYQA 2LNBA 1Z91A 1FBUA 2NS0A 2DA1A 2EV5A 4AYBA 3ZMUA 2JN6A 3IRQA 3VB2A 1F4KA 2DPUA 3K1PA 2LKSA 4BQNA 3OYKA 2IRFG 2Y69H 1FYKA 2QBYB 1WH7A 2QQBA 1LDKB 3TO7A 1ETQA 4AVZA 3OSFA 2H09A 3H9GA 4WXDA 5CVIA 3QQAA 5E3MA 5DTDA 4I2OA 3IAM2 1QA6A 3S2DJ 2CQXA 2PG4A 3JRBA 1W7PB 1WH5A 2EJRA 3GTMJ 4LFUA 3WTXC 2VPRA 4FCYA 5DD4A 2PQ8A 4KDPA 4CYDA 5GPAA 2F4MB 2NVQJ 1YO5C 3ASNH 3TBIA 1IF1A 1VQ5I 2D5VA 4AIHA 3AAFA 1R71A 1RKWA 2HS5A 3E1SA 9ANTA 2B7EA 2XPUA 1YX5A 1YE9A 4AVPA 5DV5A 3VEPA 4XNFA 2COBA 1U9NA 3OOUA 3GF2A 2GM4A 3PQKA 2ID3A 4CCNA 2DJIA 2QQ9A 4CYCA 1V3FA 2DA7A 1TWFJ 2V4JC 1UELB 4XR6A 2QUFA 3PQJA 4XORA 2JWTA 3GTJJ 2HYFA 5J3LA 1OYIA 3G6EI 3VWBA 2DTZA 3DEEA 3E6MA 4ZYHA 3HRSA 1FC3A 2IEKA 3V42A 4KISA 4KIFA 3OYAA 3EUHC 5HS8A 2ZMEA 1ZN2A 2WY8Q 3JSPA 4MEYF 2VN2A 4XLPF 4BU2A 1JXSA 1PYVA 3CO6C 2VJ4A 2BGCA 3HXLA 3JTGA 1H8AC 3U1DA 1YQAA 2M0CA 1QHHD 3PSIA 2XGCA 3Q5FA 4P55A 3F6VA 1U8RA 4A0XA 3RIRA 3KFWX 4L9TA 2R7QA 3ZN1A 1VQ6I 3Q0UA 3TO9A 4ZH4F 2O8KA 4EEFG 3DU5A 4KITB 4YG2F 2EILH 3H3ZA 2ESNA 4PGHA 3VYRB 5E3LA 2JVGA 2NAZA 3CMYA 1BM9A 2JMWA 2YUSA 3J80Z 1HKSA 3OYMA 3HRUA 4FT8A 3CJQB 1WJFA 5LHGA 1T2KA 2PMZN 4C9YA 2W7NA 1TC3C 5E3OA 1AKHA 4Z2YA 3I4PA 4UHTA 1PJRA 1Z0XA 2B9SA 5ERIA 3ASOH 1TLHB 2OAZA 3TP0A 4CHUA 3SFZA 1MNDA 4Y15A 2VJ5A 3OYBA 5IOZA 2O8XA 1YS7A 1G4DA 1EJ9A 1NTCA 5DDGA 2R7VA 2G7UA 1WJ5A 4XKVA 2IAIA 3M07A 1QRYA 2B0LA 2V6CA 4KUMA 4E7SA 5DM7F 3MZYA 1JI8A 1K83J 2R93J 2CQQA 2E35A 1D1BA 3GZNB 2MA3A 3G71I 1K4TA 2OQRA 2BY0A 3CJNA 4RGXA 3CMMA 3KLNA 5TRDA 3B6CA 5EEHA 2ZKZA 1K61A 2ECBA 1X1PA 5BPIA 3HG9A 1U9OA 1D0YA 2FOWA 4OAYA 1BW5A 1D5YA 2VJIA 1EH8A 2XRLA 1HW5A 1USSA 4HSRA 2RC4A 2EBIA 3AFHA 2AHQA 1XX5A 1GHCA 4YIRX 3ELKA 3W6JB 2XSDC 3FWEA 1K7AA 1NH3A 3W2AA 2V9PA 4G7HF 4B47A 4ZTJA 5CVRA 3BZ6A 4D5CA 1QVTA 3S3OA 3E6DA 2FNAA 3OY9A 3S17J 3K70C 1D5VA 4A69C 3BCAA 2VODA 3K2AA 2ME0A 1MBKA 3WU2C 4RB2C 2BHYA 1SANA 2LK2A 4YELA 3EYYA 1T95A 1KYWA 2CU7A 2P5KA 1IG7A 5B1AH 5JLXA 2GXGA 4HA8A 3I9V2 2V1DA 3FKJA 4J00A 1HW2A 2M30A 5E8GA 3CCSI 4MGRA 5EG0B 4GYIA 2Y9ZA 2ID6A 2FQ4A 2M0MA 3RPUA 3VSKA 1SC7A 5C4JJ 1ETOA 4G6TB 3VOEA 1TNTA 4IHTA 4HAMA 2FQ3A 3I4NJ 3QAHA 1HSJA 4XN0A 2LR8A 4RM2A 4N0BA 1W5TA 3L2QA 2CSOA 5FKMA 3I3LA 2ZNZA 4C2TA 2LY9A 2KHMA 1BI3A 3FBNB 1M1EB 2Z1DA 2MLGA 2R7TA 5HOOA 2G9WA 3SDGA 4PFPA 2F2EA 4PDKA 2MD5A 2HPMA 2CQ7A 4A6EA 3JAMZ 4JX4A 4NBQA 1VZ0A 5KAIC 2LC2A 2FSWA 2BVMA 2EFOA 2STTA 2EFPA 3EETA 4MLOA 2DK5A 5DYMA 1R9TJ 3GBGA 1FOYA 4HNVA 5F1JA 4ZTFA 2MLKA 5DD8A 2K86A 4LG0B 1SFUA 4HQMA 2GWRA 1SMTA 2HQAA 2J5OA 3PFIA 1SD4A 3KP5A 2ACJA 5E3NA 2VBZA 4Q5SF 1BIBA 2CFXA 3VYSB 3J81K 3QYBA 5C3EJ 3CUQA 3M8FA 1ZARA 3V8KA 3E5QA 4N9HA 2R7UA 3TOBA 2ISZA 4V2FA 2FBIA 3DXJF 3C3WA 4MTEA 2AXLA 2KZGA 3FXMA 5H6QA 1B4AA 1YHQI 2VIXA 5IYDJ 4ENMA 1RR7A 1XD7A 1BR4A 1U8BA 5M5YJ 1S72I 2ZJQF 1FBQA 4FTHA 1LB2A 3FM3A 1X3ZB 2XUBA 2DQRA 3QPTA 4UUSB 3E6CC 3LFKA 2DU9A 2A6HF 4NHJA 3IHUA 4IOAF 1IN8A 4GXOA 5CVUA 4M71A 1IN7A 3FDYA 3BY6A 3ISPA 1B6AA 3ZMZA 1T8IA 4UXNA 4BY1J 4ENKA 1WPKA 3JRHA 4E7ZA 3W6VA 3B6AA 4CCMA 4I6ZA 2BHZA 1UAAA 2FMYA 4PUSA 1MGTA 2DT6A 5FB2A 2QA4I 1MKMA 3S2HJ 3PFYA 3BG3A 5GTIC 1LPQA 1HW1A 3S15J 1Z77A 4GYGA 1FY7A 2OBPA 4L18B 3F23A 2P7CB 2GOXB 3MKLA 1Z6TA 1Z6RA 3UNGC 3DP7A 1IDZA 2H94A 4CCKA 2FXAA 4XL9A 5IYCJ 1JGGA 2LYCA 1GV5A 2LVSA 1TQPA 3CCUI 3BC8A 1U5TC 2AQEA 3F3XA 2CV0A 3CC2I 3I64A 3V4GA 2A07F 2IBDA 3RCOA 1VQ8I 3GO5A 2L7KA 2VQCA 3OYIA 3BR0A 3GEZA 1T39A 1LNWA 1GDTA 4GFBA 2R92J 3QRFF 3EDPA 1K4SA 1VQMI 2PBIA 1BBYA 1ORKA 1P4AA 2HR3A 2QM3A 2EFQA 1IRGA 3RKYA 5D6FA 5AIQA 1RZ4A 5DM6F 1BC7C 3CLQA 3PIPF 3K0LA 3LA7A 5JR3A 5FRNA 3PUFA 3H3VK 1FYLA 3CCMI 1XB4A 4XM3A 1ZKGA 1LKXA 1FWZA 3KEQA 2DMQA 1AOYA 1LE8B 4C2UA 2V6EA 4NUBA 2OCEA 4F3QA 2R7SA 3H92A 3NWSA 4HDUA 1JTXA 1J5YA 2KRHA 2LDUA 4XOPA 4ZJZA 2L2OA 4DBQA 3G3ZA 4XK4A 3N4MA 1W36D 2B63J 1ODDA 1UJ8A 5EGOB 3C2BA 2PI0A 4M3EA 3EQLF 5A2QZ 4RAYA 3FIWA 2MGQA
chains in the Genus database with same CATH topology
3M3YJ 2Y0SN 1MBJA 4M6VA 2QCOA 4M3DA 5F0CA 2FD5A 1X58A 3TW7A 3PO3J 1MBHA 2CJJA 3ZQHA 5K7ZA 1ZTRA 3PM1A 3LSRA 3GTPJ 4CYCB 3IH2A 4A3LJ 5FLMJ 2X48A 3BG5A 5IOYA 3HBLA 4ABZA 3TP3A 3LOCA 1G2HA 1I50J 2FJ1A 2JA5J 2DMTA 5JLWA 3H0GJ 3Q3SA 1VI0A 2KT0A 4FE4A 5IYBJ 1XG1A 3TEDA 1IGNA 4BKXA 4IHXA 3BT9A 4V2GA 2L7MP 2Y31A 3FK6A 2LFBA 1U78A 2AO9A 4JX5A 1BW6A 2M8GX 2X9DA 4A3CJ 2DA6A 1RKTA 4A3JJ 5J1RA 4MFDA 1YRNA 4AYBN 2Y9YA 3TW6A 2K9SA 1EF4A 4FISA 1IRZA 1GT0C 5HODA 1Y1WJ 2EQRA 2R7ZJ 3Q0WA 4A3KJ 1FTZA 1QPIA 1JUPA 3FKIJ 5F04A 2LP0A 4LOCA 3JREA 1Y1VJ 4JP0A 1LFBA 4XRSA 1E3OC 1X2NA 3M4OJ 2WAQN 4MFEA 3HOWJ 3BTLA 1APLC 2E19A 3SJMA 3BR2A 3BQZA 3LNQA 2K9QA 1ETVA 3HGGA 5FLVA 3S1NJ 1AKHB 2K40A 1YRNB 2HOAA 1OCTC 2CUFA 3L1PA 1ENHA 2OPTA 3BR1A 4DYQA 5EF6A 3ZQIA 1ETYA 2DA1A 4DYRA 3CDLA 2O9LA 2JN6A 2JK3A 2M9HA 3S14J 4Y7NJ 1TWCJ 3D1NI 1WH7A 4QIWN 1LE8A 2NOGA 4A3FJ 1ETQA 3FISA 3OSFA 1XS9A 3QQAA 1FIPA 5E3MA 5DTDA 3S2DJ 3BR5A 2CQXA 3JRBA 1ZK8A 2W48A 1WH5A 3GTMJ 2VPRA 3LSJA 4FCYA 3DEWA 5EGOA 5M3MJ 5EZGA 5M5XJ 2MSYA 1MBFA 5GPAA 3RZOJ 2NVQJ 2KDZA 1ETKA 2D5VA 1A6IA 1RESA 1RKWA 1JKOC 1JJ8C 2XPUA 9ANTA 1FTTA 3BR3A 1JT6A 4FE7A 1HOMA 3QPLA 2COBA 1U9NA 3OOUA 2GLOA 2GM4A 4C3HJ 1JUSA 2ID3A 5IP7J 1HCRA 5EDNA 4CYCA 4IHVA 2DA7A 2XB0X 1TWFJ 2OF7A 1SFOJ 5IP9J 2JWTA 3JRDA 3GTJJ 5J3LA 1B8IA 4A93J 2DTZA 3IV5A 3RQIA 4XICA 3HOZJ 1OFCX 2IEKA 2RAEA 4A3DJ 5EZHA 2TRTA 5GP9A 3CCYA 1JKQC 5FKLA 2EZHA 1RETA 3S1QJ 1H8AC 1HDPA 2ELKA 2DJNA 1RPWA 2EH3A 1BJZA 2M0CA 2WV1A 2JJ7A 3BG9A 2XPWA 1OCPA 1B8IB 2XGCA 2XGEA 1IC8A 3HOYJ 3O8HA 2L7ZA 4A3BJ 3Q0UA 2O8KA 4EEFG 4JYKA 2XGDA 1B72A 5E3LA 3BTCA 1ETWA 2DA2A 3CMYA 1ZQ3P 2JMWA 2YUSA 2XB5A 4IEJA 4AUXA 3RZDJ 1WI3A 1ZGWA 4J19A 1TC3C 2PMZN 5J1UA 5E3OA 1AKHA 1JUMA 5J1YA 1Z0XA 3GTKJ 2HYJA 3HKZN 1S7EA 1LFUP 4BBSJ 1OJLA 2L7FP 1MSFC 3TP0A 5FKOA 2E1OA 1IUFA 3JR9A 1ZR4A 5F0FA 2EZLA 4BXXJ 5IOZA 4DZJA 5EYRA 1B72B 2NVXJ 1NTCA 3OSGA 1PUFA 2R0QC 2HOSA 2X6OA 1TWHJ 2IAIA 1QRYA 3PO2J 3IH4A 4BBRJ 1HF0A 3MVPA 4XRMA 4M3GA 1K83J 2R93J 3JRGA 2CQQA 4C3JJ 1AHDP 3OIOA 5EEAA 4IHWA 3LSGA 1ITYA 1BL0A 1A5JA 2O7OA 3B6CA 1K61A 2EZKA 2G0EA 2ECBA 1U9OA 1BW5A 1D5YA 3HOVJ 2XRLA 4B4CA 1PUFB 1F43A 2HOTA 2L9RA 2EBIA 2AHQA 3G1LA 2M34A 3NAUA 1H88C 2XSDC 4X1EA 4A3GJ 5EG0A 4A3MJ 4AC0A 2H8RA 4XIDA 4IHYA 4D5CA 1QVTA 3BTIA 3S17J 1P7IA 4A69C 5F0HA 3K2AA 2ME0A 1MBKA 2YU9J 2NS7A 4UUTA 1WGXA 1SANA 2LK2A 2CU7A 2LLKA 1IG7A 1AU7A 4W1UA 5JLXA 2GBYA 3QPSA 3K7AJ 2DMUA 1CQTA 4Y52J 3A01A 2DA4A 2HXIA 3IH3A 2E2HJ 2DMNA 5EG0B 3ZQCA 1I3QJ 5K7HA 2ID6A 2Y9ZA 2FQ4A 4B1RA 4RDUA 5IPAA 1UG2A 4D7NA 2JA7J 5C4JJ 2WB1N 1ETOA 3CQZJ 4I76A 1DU0A 1GVDA 3BR6A 3VPRA 2LTPA 2R5ZA 2CUEA 3I4NJ 4A3EJ 1W0TA 1I6HJ 2LR8A 1W0UA 1XC5A 3S16J 4RBOA 2E2JJ 5FKMA 3JRAA 3JRCA 2LY9A 2ME6A 1TWAJ 4MIMA 1T33A 2YS9A 1NK2P 3SDGA 1IJWC 4QTRA 3A01B 1UMQA 2DA3A 4JX4A 1MH4A 2FX0A 3LSPA 3HDDA 4DW6A 2VUMJ 1WCMJ 1HDDC 1NK3P 4MLOA 1R9TJ 4JX6A 3GBGA 2M2EA 2R5ZB 4HNVA 5F1JA 3G1OA 1JJ6C 3HGYA 2ECCA 1MBEA 2NVYJ 4UUSA 1FJLA 3ZQGA 5FJ8J 1VF9A 4C2MJ 1GV2A 4C3IJ 1F36A 3FK7A 4BY7J 5E3NA 5C3EJ 3DCFA 4D7MA 2NVTJ 3S1MJ 2DMPA 1ZR2A 4V2FA 1UHSA 2MG4A 3ZQFA 2R5YA 5IYDJ 1RR7A 2CRGA 1DU6A 1U8BA 5M5YJ 4FTHA 2K9NA 3Q0VA 1FEXA 2P81A 3I4MJ 4UUSB 2DN0A 3WHBA 4XRSG 3HEFA 3GTLJ 5FKKA 2VKEA 1MNMC 2HQ5A 1MSEC 1JT0A 1T56A 2Y2ZA 4BY1J 1QVUA 3HB9A 3JRFA 1WPKA 2JA6J 3JRHA 3W6VA 3B6AA 2LD5A 2R5YB 1MBGA 4I6ZA 1X2MA 1MH3A 2HI3A 2VKVA 4NDLA 2JA8J 4QSHA 2EZIA 3GTOJ 3O8GA 3ZOBA 3S2HJ 5M3FJ 2H1KA 3BG3A 3F0CA 2XPVA 5DS9A 4A3IJ 5IP6A 4G12A 2DA5A 2N8GA 3NARA 1Z77A 4L5EA 4W97A 2E2IJ 3GTGJ 3S15J 2TCTA 3MKLA 3MN2A 1IDZA 2VI6A 5IYCJ 1JGGA 1BA5A 1GV5A 3RKQA 3UKGA 2LVSA 1GUUA 2Y30A 4MO7A 2HXOA 2I10A 3G1MA 1Q1VA 5C44J 3HOXJ 2IBDA 1P7JA 1TWGJ 4DZPA 2QF7A 2MW8A 3BQYA 5M5WJ 4M3BA 3BR0A 4GFBA 1GDTA 2R92J 1JTYA 3SFIA 3A03A 2HDDA 1ORKA 5C4XJ 2ZB9A 5F27A 1IDYA 1JKPC 3BTJA 1H89C 5K7FA 5GPCA 1ETXA 1FIAA 3WHCA 4B3AA 3JRIA 3H3VK 2LKXA 1IV6A 3E7LA 1ZKGA 5BNGA 1VFCA 5FKNA 4D5FA 2NS8A 2DMQA 3ZQLA 1LE8B 1POGA 1HLVA 3S1RJ 3GTQJ 1JTXA 3HOUJ 1JKRC 5F08A 4S0HB 4XK4A 3A02A 4M3FA 2B63J 2L0KA 5EGOB 4DYCA 4X6AJ 1VNDA 3C2BA 4M3EA 1O4XA 3HM5A 3FIWA 2MGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Y J;  2Y0S N;  1MBJ A;  4M6V A;  2QCO A;  4M3D A;  5F0C A;  2FD5 A;  1X58 A;  3TW7 A;  3PO3 J;  1MBH A;  2CJJ A;  3ZQH A;  5K7Z A;  1ZTR A;  3PM1 A;  3LSR A;  3GTP J;  4CYC B;  3IH2 A;  4A3L J;  5FLM J;  2X48 A;  3BG5 A;  5IOY A;  3HBL A;  4ABZ A;  3TP3 A;  3LOC A;  1G2H A;  1I50 J;  2FJ1 A;  2JA5 J;  2DMT A;  5JLW A;  3H0G J;  3Q3S A;  1VI0 A;  2KT0 A;  4FE4 A;  5IYB J;  1XG1 A;  3TED A;  1IGN A;  4BKX A;  4IHX A;  3BT9 A;  4V2G A;  2L7M P;  2Y31 A;  3FK6 A;  2LFB A;  1U78 A;  2AO9 A;  4JX5 A;  1BW6 A;  2M8G X;  2X9D A;  4A3C J;  2DA6 A;  1RKT A;  4A3J J;  5J1R A;  4MFD A;  1YRN A;  4AYB N;  2Y9Y A;  3TW6 A;  2K9S A;  1EF4 A;  4FIS A;  1IRZ A;  1GT0 C;  5HOD A;  1Y1W J;  2EQR A;  2R7Z J;  3Q0W A;  4A3K J;  1FTZ A;  1QPI A;  1JUP A;  3FKI J;  5F04 A;  2LP0 A;  4LOC A;  3JRE A;  1Y1V J;  4JP0 A;  1LFB A;  4XRS A;  1E3O C;  1X2N A;  3M4O J;  2WAQ N;  4MFE A;  3HOW J;  3BTL A;  1APL C;  2E19 A;  3SJM A;  3BR2 A;  3BQZ A;  3LNQ A;  2K9Q A;  1ETV A;  3HGG A;  5FLV A;  3S1N J;  1AKH B;  2K40 A;  1YRN B;  2HOA A;  1OCT C;  2CUF A;  3L1P A;  1ENH A;  2OPT A;  3BR1 A;  4DYQ A;  5EF6 A;  3ZQI A;  1ETY A;  2DA1 A;  4DYR A;  3CDL A;  2O9L A;  2JN6 A;  2JK3 A;  2M9H A;  3S14 J;  4Y7N J;  1TWC J;  3D1N I;  1WH7 A;  4QIW N;  1LE8 A;  2NOG A;  4A3F J;  1ETQ A;  3FIS A;  3OSF A;  1XS9 A;  3QQA A;  1FIP A;  5E3M A;  5DTD A;  3S2D J;  3BR5 A;  2CQX A;  3JRB A;  1ZK8 A;  2W48 A;  1WH5 A;  3GTM J;  2VPR A;  3LSJ A;  4FCY A;  3DEW A;  5EGO A;  5M3M J;  5EZG A;  5M5X J;  2MSY A;  1MBF A;  5GPA A;  3RZO J;  2NVQ J;  2KDZ A;  1ETK A;  2D5V A;  1A6I A;  1RES A;  1RKW A;  1JKO C;  1JJ8 C;  2XPU A;  9ANT A;  1FTT A;  3BR3 A;  1JT6 A;  4FE7 A;  1HOM A;  3QPL A;  2COB A;  1U9N A;  3OOU A;  2GLO A;  2GM4 A;  4C3H J;  1JUS A;  2ID3 A;  5IP7 J;  1HCR A;  5EDN A;  4CYC A;  4IHV A;  2DA7 A;  2XB0 X;  1TWF J;  2OF7 A;  1SFO J;  5IP9 J;  2JWT A;  3JRD A;  3GTJ J;  5J3L A;  1B8I A;  4A93 J;  2DTZ A;  3IV5 A;  3RQI A;  4XIC A;  3HOZ J;  1OFC X;  2IEK A;  2RAE A;  4A3D J;  5EZH A;  2TRT A;  5GP9 A;  3CCY A;  1JKQ C;  5FKL A;  2EZH A;  1RET A;  3S1Q J;  1H8A C;  1HDP A;  2ELK A;  2DJN A;  1RPW A;  2EH3 A;  1BJZ A;  2M0C A;  2WV1 A;  2JJ7 A;  3BG9 A;  2XPW A;  1OCP A;  1B8I B;  2XGC A;  2XGE A;  1IC8 A;  3HOY J;  3O8H A;  2L7Z A;  4A3B J;  3Q0U A;  2O8K A;  4EEF G;  4JYK A;  2XGD A;  1B72 A;  5E3L A;  3BTC A;  1ETW A;  2DA2 A;  3CMY A;  1ZQ3 P;  2JMW A;  2YUS A;  2XB5 A;  4IEJ A;  4AUX A;  3RZD J;  1WI3 A;  1ZGW A;  4J19 A;  1TC3 C;  2PMZ N;  5J1U A;  5E3O A;  1AKH A;  1JUM A;  5J1Y A;  1Z0X A;  3GTK J;  2HYJ A;  3HKZ N;  1S7E A;  1LFU P;  4BBS J;  1OJL A;  2L7F P;  1MSF C;  3TP0 A;  5FKO A;  2E1O A;  1IUF A;  3JR9 A;  1ZR4 A;  5F0F A;  2EZL A;  4BXX J;  5IOZ A;  4DZJ A;  5EYR A;  1B72 B;  2NVX J;  1NTC A;  3OSG A;  1PUF A;  2R0Q C;  2HOS A;  2X6O A;  1TWH J;  2IAI A;  1QRY A;  3PO2 J;  3IH4 A;  4BBR J;  1HF0 A;  3MVP A;  4XRM A;  4M3G A;  1K83 J;  2R93 J;  3JRG A;  2CQQ A;  4C3J J;  1AHD P;  3OIO A;  5EEA A;  4IHW A;  3LSG A;  1ITY A;  1BL0 A;  1A5J A;  2O7O A;  3B6C A;  1K61 A;  2EZK A;  2G0E A;  2ECB A;  1U9O A;  1BW5 A;  1D5Y A;  3HOV J;  2XRL A;  4B4C A;  1PUF B;  1F43 A;  2HOT A;  2L9R A;  2EBI A;  2AHQ A;  3G1L A;  2M34 A;  3NAU A;  1H88 C;  2XSD C;  4X1E A;  4A3G J;  5EG0 A;  4A3M J;  4AC0 A;  2H8R A;  4XID A;  4IHY A;  4D5C A;  1QVT A;  3BTI A;  3S17 J;  1P7I A;  4A69 C;  5F0H A;  3K2A A;  2ME0 A;  1MBK A;  2YU9 J;  2NS7 A;  4UUT A;  1WGX A;  1SAN A;  2LK2 A;  2CU7 A;  2LLK A;  1IG7 A;  1AU7 A;  4W1U A;  5JLX A;  2GBY A;  3QPS A;  3K7A J;  2DMU A;  1CQT A;  4Y52 J;  3A01 A;  2DA4 A;  2HXI A;  3IH3 A;  2E2H J;  2DMN A;  5EG0 B;  3ZQC A;  1I3Q J;  5K7H A;  2ID6 A;  2Y9Z A;  2FQ4 A;  4B1R A;  4RDU A;  5IPA A;  1UG2 A;  4D7N A;  2JA7 J;  5C4J J;  2WB1 N;  1ETO A;  3CQZ J;  4I76 A;  1DU0 A;  1GVD A;  3BR6 A;  3VPR A;  2LTP A;  2R5Z A;  2CUE A;  3I4N J;  4A3E J;  1W0T A;  1I6H J;  2LR8 A;  1W0U A;  1XC5 A;  3S16 J;  4RBO A;  2E2J J;  5FKM A;  3JRA A;  3JRC A;  2LY9 A;  2ME6 A;  1TWA J;  4MIM A;  1T33 A;  2YS9 A;  1NK2 P;  3SDG A;  1IJW C;  4QTR A;  3A01 B;  1UMQ A;  2DA3 A;  4JX4 A;  1MH4 A;  2FX0 A;  3LSP A;  3HDD A;  4DW6 A;  2VUM J;  1WCM J;  1HDD C;  1NK3 P;  4MLO A;  1R9T J;  4JX6 A;  3GBG A;  2M2E A;  2R5Z B;  4HNV A;  5F1J A;  3G1O A;  1JJ6 C;  3HGY A;  2ECC A;  1MBE A;  2NVY J;  4UUS A;  1FJL A;  3ZQG A;  5FJ8 J;  1VF9 A;  4C2M J;  1GV2 A;  4C3I J;  1F36 A;  3FK7 A;  4BY7 J;  5E3N A;  5C3E J;  3DCF A;  4D7M A;  2NVT J;  3S1M J;  2DMP A;  1ZR2 A;  4V2F A;  1UHS A;  2MG4 A;  3ZQF A;  2R5Y A;  5IYD J;  1RR7 A;  2CRG A;  1DU6 A;  1U8B A;  5M5Y J;  4FTH A;  2K9N A;  3Q0V A;  1FEX A;  2P81 A;  3I4M J;  4UUS B;  2DN0 A;  3WHB A;  4XRS G;  3HEF A;  3GTL J;  5FKK A;  2VKE A;  1MNM C;  2HQ5 A;  1MSE C;  1JT0 A;  1T56 A;  2Y2Z A;  4BY1 J;  1QVU A;  3HB9 A;  3JRF A;  1WPK A;  2JA6 J;  3JRH A;  3W6V A;  3B6A A;  2LD5 A;  2R5Y B;  1MBG A;  4I6Z A;  1X2M A;  1MH3 A;  2HI3 A;  2VKV A;  4NDL A;  2JA8 J;  4QSH A;  2EZI A;  3GTO J;  3O8G A;  3ZOB A;  3S2H J;  5M3F J;  2H1K A;  3BG3 A;  3F0C A;  2XPV A;  5DS9 A;  4A3I J;  5IP6 A;  4G12 A;  2DA5 A;  2N8G A;  3NAR A;  1Z77 A;  4L5E A;  4W97 A;  2E2I J;  3GTG J;  3S15 J;  2TCT A;  3MKL A;  3MN2 A;  1IDZ A;  2VI6 A;  5IYC J;  1JGG A;  1BA5 A;  1GV5 A;  3RKQ A;  3UKG A;  2LVS A;  1GUU A;  2Y30 A;  4MO7 A;  2HXO A;  2I10 A;  3G1M A;  1Q1V A;  5C44 J;  3HOX J;  2IBD A;  1P7J A;  1TWG J;  4DZP A;  2QF7 A;  2MW8 A;  3BQY A;  5M5W J;  4M3B A;  3BR0 A;  4GFB A;  1GDT A;  2R92 J;  1JTY A;  3SFI A;  3A03 A;  2HDD A;  1ORK A;  5C4X J;  2ZB9 A;  5F27 A;  1IDY A;  1JKP C;  3BTJ A;  1H89 C;  5K7F A;  5GPC A;  1ETX A;  1FIA A;  3WHC A;  4B3A A;  3JRI A;  3H3V K;  2LKX A;  1IV6 A;  3E7L A;  1ZKG A;  5BNG A;  1VFC A;  5FKN A;  4D5F A;  2NS8 A;  2DMQ A;  3ZQL A;  1LE8 B;  1POG A;  1HLV A;  3S1R J;  3GTQ J;  1JTX A;  3HOU J;  1JKR C;  5F08 A;  4S0H B;  4XK4 A;  3A02 A;  4M3F A;  2B63 J;  2L0K A;  5EGO B;  4DYC A;  4X6A J;  1VND A;  3C2B A;  4M3E A;  1O4X A;  3HM5 A;  3FIW A;  2MGQ A; 
#chains in the Genus database with same CATH topology
 1R5I D;  2Y0S N;  2XHK A;  1DPU A;  1J0R A;  2GZW A;  1JHF A;  3I5U A;  3PNV A;  4WWC A;  3ZQH A;  3L2R A;  5K7Z A;  4XKC A;  2A69 F;  1ZTR A;  3PM1 A;  5F64 A;  2BY1 A;  2ZFW A;  2M7A A;  4A3L J;  1O7L A;  1ZEL A;  2O0Y A;  1U0J A;  3HBL A;  4ABZ A;  3TP3 A;  3LOC A;  3IKT A;  1FT9 A;  1G2H A;  3WG9 A;  1WJC A;  3DLL F;  2FJ1 A;  2MFZ A;  2DI3 A;  1LDJ A;  3E0J B;  4XKB A;  1V54 H;  1YW7 A;  1VI0 A;  2L01 A;  3OYL A;  4UVB A;  1IGN A;  2JA2 A;  4ZC3 A;  2ZCW A;  5LHH A;  2QQ8 A;  3WU1 B;  4IHX A;  1FNN A;  1U5T B;  2UXX A;  4IZZ A;  1KON A;  4I09 A;  3LSK A;  3CF2 A;  1U78 A;  3VFZ A;  3WTV C;  2Y0S A;  1YTY A;  2KZV A;  2KFD A;  2KIQ A;  1Z05 A;  2DA6 A;  4A3J J;  5J1R A;  2OZ6 A;  2K9S A;  4I0A A;  4FIS A;  3L7W A;  1UST A;  1IRZ A;  2LRE A;  1KQ8 A;  2EQR A;  2R7Z J;  3Q0W A;  2L5Q A;  4HLX A;  1FTZ A;  3CJR B;  3HC7 A;  2BW3 B;  1XMA A;  3GFM A;  1QNT A;  4ZYD A;  1EH7 A;  1LFB A;  2ZXW H;  4PJN A;  3AKZ A;  2QBY A;  3T1B A;  1E3O C;  4OOI A;  4B48 A;  4AIK A;  3QOD A;  1D0Z A;  3HUG A;  4BHB A;  2K3F A;  3SEQ A;  3HTU A;  1S29 A;  3CC7 I;  3FMR A;  4UB8 C;  1W7P A;  4R79 A;  3SZP A;  2IW5 A;  2OPT A;  3SEZ A;  3BR1 A;  1R58 A;  4J01 A;  2XGX A;  1FOX A;  4IX7 A;  3ZQI A;  1ETY A;  4DYR A;  5DUI A;  1T0F C;  2M9H A;  1MMA A;  4JOM A;  4IQJ A;  4ENN A;  3KYD B;  4NC6 A;  1TWC J;  4G6Q A;  4UB6 C;  4EM2 A;  1OR7 A;  4CO8 A;  4A3F J;  1BOB A;  3FIS A;  5HLT A;  2DQL A;  3A2K A;  1XS9 A;  1W5S A;  3GFL A;  1Y39 A;  2GXB A;  3AG2 H;  2DOE A;  2F5V A;  3GWZ A;  1DP7 P;  1FPQ A;  1WSU A;  2W48 A;  3CDH A;  4KN4 X;  3RPU D;  4XLH A;  2CG4 A;  1TP4 A;  2A6T A;  2IPQ X;  3DEW A;  5D6E A;  5M3M J;  1UZC A;  2KIF A;  1ETK A;  1MIJ A;  2HOE A;  3EUA A;  5B66 C;  1ZRE A;  2EV6 A;  4HYE A;  3V8L A;  1R6R A;  3MEX A;  1JJ8 C;  3A1Y A;  4LIT A;  3TMO A;  1FTT A;  2CV1 A;  2VE8 A;  2EFW A;  1YIO A;  2YR2 A;  1HOM A;  3QPL A;  3W2V A;  2M45 A;  3OIP A;  4AU7 A;  2IJL A;  2GLO A;  4CSW A;  4OIO F;  1MJ9 A;  1HCR A;  5CYV A;  3GVA A;  1YYV A;  2W4S A;  4Q4Z F;  2VC0 A;  1PVE A;  2FU4 A;  2XB0 X;  4FET A;  1SFO J;  2UWM A;  3RDI A;  2BEO A;  3JRD A;  2JSP A;  4KIG A;  3D5L A;  1OIS A;  3K69 A;  4A93 J;  5ICC A;  3ZMT A;  2GIV A;  2OUM A;  4KT6 A;  1R4N B;  4XON A;  1J75 A;  1S7A A;  3D0S A;  1P6R A;  2X1C A;  2YX7 A;  3CCY A;  3MZH A;  4L9V A;  1V5F A;  3T5X A;  2K27 A;  2IA0 A;  2EIK H;  2EZH A;  1XGM A;  3S1Q J;  3J80 K;  3CLO A;  2ISY A;  1HDP A;  2ELK A;  4MQ9 F;  1ZRF A;  1TT0 A;  1IUY A;  4BEH B;  4NQW B;  1UCR A;  3K4C A;  2HVR A;  1OCP A;  3OYF A;  2VB6 A;  1B8I B;  1HXD A;  2L9N A;  3LA2 A;  5FFX A;  4ZZL A;  2X51 A;  3O8H A;  2WTE A;  2YU3 A;  4CCJ A;  4UY8 I;  2NRA C;  2XF6 A;  2Q0O A;  4GO1 A;  3I58 A;  3T0Y A;  2ETH A;  1DP3 A;  3BTC A;  3DQV C;  3GLL A;  2XB5 A;  1SD6 A;  4IEJ A;  3RZD J;  1HKT A;  3OYE A;  1FZP B;  4ESB A;  4J19 A;  2R7W A;  4PGG A;  4I0B A;  5J1U A;  2VKH A;  5CLS A;  2GA2 A;  4G94 A;  1TNS A;  4M72 A;  3S8P A;  4CA0 A;  2P7V B;  5J6X A;  2HYJ A;  3S3N A;  1S7E A;  4A6D A;  1LFU P;  4BBS J;  1OJL A;  3REO A;  1MSF C;  2L9S A;  4S05 A;  4L5J A;  3WTU C;  1SVM A;  4ASN A;  4XOT A;  5H2F C;  2EZL A;  1IN5 A;  2CUZ A;  3EUH A;  4BXX J;  2Q8K A;  1K6Y A;  1UHM A;  4BE1 A;  2R0Q C;  3ZGK A;  1DPR A;  4IRI A;  1IZ1 A;  1TWH J;  3PJR A;  2Q2E B;  2E71 A;  4KA4 A;  4XRM A;  4PFO A;  2LY1 A;  2ZJR F;  2FE3 A;  2I8D A;  5DUK A;  3JRG A;  1VQK I;  1AHD P;  1HST A;  1EA3 A;  3AG4 H;  1T08 B;  4HV5 A;  5EEA A;  3R4K A;  1ITY A;  1A5J A;  2R7F A;  3GFI A;  2RQP A;  4YFK F;  2X1D A;  4KN7 X;  3WTT C;  4MHG A;  2P5V A;  1DQU A;  2K9L A;  4K2E A;  2FRH A;  3TGN A;  1MNE A;  4IL6 C;  3SYT A;  2NNN A;  1OCR H;  2L9R A;  2X85 A;  1L0O C;  1F43 A;  5ICG A;  3KLO A;  2KKO A;  1W4M A;  1T98 A;  3GZ5 A;  4ANJ A;  4P96 A;  2V9K A;  3U2R A;  3OYC A;  2CWE A;  4RGS A;  5E20 A;  4BAC A;  2RDP A;  1EKE A;  4A3G J;  2WAQ A;  5EG0 A;  4Y17 A;  4A3M J;  1YS6 A;  2EFN A;  4AC0 A;  2E7X A;  4XID A;  2CW7 A;  5AIP A;  2KIM A;  4IHY A;  2JRT A;  3BTI A;  5D5U B;  1ZHF A;  5F0H A;  3M1C A;  3KYL A;  2PJR B;  1TW2 A;  2VJJ A;  2HFH A;  1KU9 A;  1D1C A;  3TDZ C;  2A6E F;  1B59 A;  2BZT A;  1D0X A;  3QOE A;  4GDF A;  3OV8 A;  1ZLK A;  4AID A;  1U2W A;  1KQ0 A;  2HXI A;  2E2H J;  1I27 A;  3OL4 A;  3JAM K;  3ZQC A;  1BI0 A;  2BYV E;  1YX3 A;  5IPA A;  1D8K A;  4D7N A;  3HHG A;  2WB1 N;  2WAF A;  1N25 A;  2OZU A;  1DU0 A;  3VPR A;  2LTP A;  2CUE A;  4RB1 A;  4A3E J;  4EGY A;  2HQN A;  1I6H J;  2E1N A;  5FRM A;  1W0U A;  1MMN A;  4LG0 A;  1XSV A;  2E2J J;  3DTI A;  4ZDO A;  2ME6 A;  3HYI A;  1TWA J;  1T33 A;  2ZSI B;  4QTR A;  3A01 B;  1UMQ A;  1HC8 A;  2KQR A;  1QGP A;  4EQQ A;  1MH4 A;  4JQF A;  1G3W A;  3LSP A;  1RUN A;  3HSF A;  3CP8 A;  1BJA A;  1QZZ A;  2KJC A;  3B02 A;  4WX9 A;  1MW7 A;  2FEZ A;  2J5P A;  5HLI A;  2OTL I;  5H6R A;  5DCF A;  3CCQ I;  3EUK L;  3NQO A;  2R5Z B;  1H9T A;  2L4M A;  4PJM A;  3KZZ A;  2DT5 A;  2IGO A;  3B73 A;  4UUS A;  4PCQ A;  1FJL A;  2WB1 A;  2R3S A;  3HRM A;  1HBX G;  1Z9C A;  3W3C A;  3FXO A;  3FK7 A;  2QYO A;  4OU0 A;  1RRJ A;  2NVT J;  1SMY F;  3R0J A;  1SAU A;  4MTD A;  1ZR2 A;  2LH9 A;  1BI1 A;  3OYG A;  4MNU A;  3OL3 A;  1Q1H A;  1UHS A;  3R6S A;  3M7G A;  1MDM B;  1J9I A;  1O57 A;  1ZYR F;  3LQR A;  3ZQF A;  4EJV A;  1LVA A;  1UFM A;  2OJE D;  3LAJ A;  1S7O A;  3WTW C;  2K9N A;  1DGR M;  3I4M J;  1T6S A;  1R4M B;  2FNP A;  1MJB A;  4OAZ A;  5J4Y A;  1W7P D;  2VKE A;  4EM1 A;  4U0Y A;  3OYD A;  5EEG A;  3OYJ A;  4PJJ A;  5LD2 C;  2DLL A;  1JT0 A;  3MQ0 A;  4OMZ A;  2P0W A;  2F4O B;  2E34 A;  4CCO A;  4N9I A;  1T56 A;  1RIO H;  1AA7 A;  2DAO A;  3HB9 A;  4M9Z A;  2BY2 A;  4B09 A;  2PMZ A;  4B43 A;  2K7L A;  1IN4 A;  4YFX F;  2JSC A;  2ZJ2 A;  1CF7 B;  1YW8 A;  4E7I A;  4NDL A;  5ICF A;  3V7S A;  3DPU A;  2EZI A;  3CCR I;  1WZ2 A;  4FX0 A;  3W6K B;  5M3F J;  2H1K A;  1ON2 A;  1A6Q A;  2XPV A;  2L3D A;  5DS9 A;  3NWT A;  4G12 A;  3BWG A;  1WWX A;  5L3G A;  2E2I J;  5KAF C;  3GTG J;  3CP2 A;  4F92 B;  1E2X A;  3OS0 A;  2VKD A;  3MN2 A;  2K4B A;  3DKX A;  3MCZ A;  3CDI A;  2DO7 A;  5D8K B;  3KZI C;  4JBA A;  3KCC A;  1KQ9 A;  2M8E A;  5E1W A;  3RKX A;  2I10 A;  4E7L A;  5HDG A;  3C1D A;  1Q1V A;  2BVL A;  3I56 I;  1P7J A;  4DZP A;  1I5Z A;  3IKV A;  1VQP I;  2PEX A;  2WAD A;  3BQY A;  1XSD A;  3HPG A;  3TOA A;  3KP4 A;  4HNT A;  3I59 B;  4JK1 X;  5D5W B;  3J7Y J;  1XDS A;  2CYY A;  2QZ8 A;  2M3A A;  3BTJ A;  3VSL A;  4EMS A;  5K7F A;  2YX4 A;  4IQ4 A;  4A12 A;  3RKW A;  5GPC A;  1ETX A;  1R23 A;  3DF8 A;  1KA8 A;  2BY3 A;  4XQF A;  1FIA A;  3CES A;  5A2Q K;  3JRI A;  1ZGA A;  2LKX A;  1VTN C;  1P4W A;  4OWR B;  4UVC A;  2IA2 A;  2K85 A;  1B9N A;  1KU7 A;  1H9G A;  3S1R J;  1MD0 A;  1P92 A;  2VBY A;  3HOU J;  3F21 A;  1V4R A;  4EJO A;  5E1Z B;  3KP6 A;  2PJP A;  1E17 A;  3P7N A;  5CQG A;  2X0L A;  3Q9V A;  4M3F A;  3F8B A;  3FXJ A;  5LGT A;  1ZG3 A;  4WF2 A;  1VND A;  1DGW Y;  2ZFU A;  1KZH A;  3WE2 A;  3GW2 A;  4BJ6 C;  3TDU C;  2RNG A;  2F6C A;  1BC8 C;  5BS6 A;  2KMU A;  4UUV A;  3M3Y J;  5E17 F;  4BQO A;  4M6V A;  5D5X B;  1G3Y A;  1CGP A;  3SHF A;  3ABK H;  3PO3 J;  2E1C A;  1U5T A;  2BE5 F;  1G3T A;  2H27 A;  2F4I A;  3KPH A;  2HDC A;  5LEK A;  3IH2 A;  4CYC B;  5FLM J;  5IOY A;  1X3W B;  2K4J A;  4BQQ A;  1EV7 A;  2XC7 A;  3O6B B;  2HPI A;  2JA5 J;  3G73 A;  1LEA A;  1SD7 A;  2ICW G;  1E3P A;  3H0G J;  3F6O A;  2KT0 A;  2IGK A;  4BHP A;  3WGH A;  3L2C A;  2VPL A;  3QU6 A;  1B1B A;  2MAB A;  4FX4 A;  4Q47 A;  2BW3 A;  1GVJ A;  3ROU A;  5J8C A;  1SFK A;  4KIB A;  4P9F A;  5LLQ A;  2X6W A;  1YOV B;  2LFB A;  1S5L C;  4KJZ A;  1K6O A;  4HV6 A;  3L2U A;  2KPM A;  2F5F A;  1BW6 A;  2MC4 A;  3HIF A;  4MQV A;  4N4N B;  5D4R A;  1RKT A;  1ZGJ A;  4II2 A;  3ERE D;  2Y9Y A;  1YIT I;  2Z16 A;  2XIG A;  4BHC A;  2D1H A;  2HKO A;  4M73 A;  5E79 C;  2HZT A;  4IXA A;  5HOD A;  1Y1W J;  4LLG F;  2MH2 A;  5L3D A;  3ZR8 X;  1VQ9 I;  3PSF A;  3FXQ A;  2H6B A;  3DWL E;  4LOC A;  5B3S H;  1Y8Q B;  3OOP A;  5IT3 A;  2F48 A;  4XRS A;  4KMU X;  4PSX A;  3OS1 A;  1SAX A;  1N75 A;  2Q1Z B;  2HNH A;  1XCV A;  5ILS A;  3M4O J;  3F8F A;  4MFE A;  5DCM B;  3BTL A;  1TZL A;  1XGN A;  3BJ6 A;  3BR2 A;  1Z7U A;  2BBY A;  1AKH B;  2NVU B;  2BXZ A;  1FOW A;  3ZN0 A;  1OCT C;  3NRV A;  4I02 A;  3X2Q H;  3L1P A;  3ZCO A;  3SZG A;  5EF6 A;  3K9T A;  2PMH A;  3I0T A;  4DJA A;  3CDL A;  2O9L A;  2JK3 A;  2L9V A;  4G8X A;  1QU3 A;  5D5V B;  4M6X A;  2NOG A;  4KYW A;  4BUP A;  4D1Q A;  1FIP A;  2EPF A;  5JVG F;  2KDO A;  1F9N A;  3CD6 I;  4BGD A;  4U0V A;  1VQO I;  3E6B A;  4QWQ A;  3VOD A;  1IN6 A;  5EZG A;  1RC9 A;  5M5X J;  1LEB A;  1Y6I A;  3QOP A;  2MSY A;  2W25 A;  1MBF A;  3RZO J;  4P1W A;  1UB9 A;  2KDZ A;  1OYY A;  4RGU A;  3FM5 A;  2X6Y A;  3DFG A;  3FZV A;  1RES A;  4LD5 A;  2AQF A;  3H5R A;  3SDB A;  1W5C C;  2RRE A;  4FE7 A;  1WQ2 A;  3BCB A;  5J8F A;  2UV1 A;  2XAQ A;  1OKR A;  3FBI B;  1PP8 F;  3BPV A;  3I53 A;  3HJE A;  1JUS A;  4C3H J;  5EDN A;  2UUZ A;  4IHV A;  2HTJ A;  3OWT A;  4BL0 B;  2OF7 A;  4YIF A;  1XDU A;  5IP9 J;  3F8C A;  1VQN I;  3DKY A;  3K4B A;  4NQW A;  5ILU A;  1B8I A;  5JI6 A;  3IV5 A;  3RQI A;  1MMG A;  3M1E A;  1OFC X;  4UV8 A;  4N4O B;  2Z33 A;  3HOZ J;  3K70 D;  3KET A;  2HKX A;  4A3D J;  3J7Z I;  2TRT A;  3ZMS A;  5HVQ C;  4RM3 A;  3BP8 A;  4UV9 A;  5GP9 A;  4CDG A;  1T0F A;  3VDX A;  5LHI A;  4LK0 F;  1HKQ A;  2BOL A;  1RET A;  3H9Q A;  1OPC A;  3WU0 A;  3DPL C;  2CS3 A;  2RV8 A;  2CFO A;  4HF1 A;  2A68 F;  4HBL A;  2Y48 A;  2DJN A;  2RNJ A;  1RPW A;  2EH3 A;  1FLI A;  1BJZ A;  2DOF A;  2H1L A;  2JPC A;  2LMD A;  2WV1 A;  3DTK A;  4CUG A;  5HS9 A;  2IVM A;  5CJ9 A;  2XGE A;  5K1Y A;  4HOB A;  4XMY A;  4FAS D;  2P8T A;  2L7Z A;  1R5G A;  4A3B J;  1AWC A;  3WGI A;  3CME I;  1PUE E;  5AON A;  1S3J A;  2O03 A;  2O6G E;  3C2H A;  4A2U A;  3HL2 A;  2M1B A;  3WTS C;  1IW7 F;  1WI3 A;  5HNH A;  1R49 A;  1Y0U A;  4IPA A;  3ONQ A;  3WE3 A;  2MD0 A;  3V7R A;  4P9U A;  3CCJ I;  4S04 A;  1JUM A;  3LAP A;  5J1Y A;  3FXL A;  3HSE A;  3JCU C;  4CIC A;  3GTK J;  3HKZ N;  3S32 A;  2L02 A;  1X4P A;  3RYR A;  4HX8 A;  5FLX Z;  2DFH A;  2L7F P;  1QZE A;  1WKM A;  2RKH A;  1FX7 A;  2OD5 A;  1X1D A;  2E1O A;  5KHD A;  2A5W A;  3BG6 A;  1R1U A;  1OMI A;  4Y33 A;  1A04 A;  4DZJ A;  1YLF A;  5EYR A;  1B72 B;  2NVX J;  3K4N A;  3V7C A;  3AG3 H;  1YI2 I;  1F1Z A;  4KT5 C;  2JUC A;  2X6O A;  1XMK A;  2OA4 A;  2VL8 A;  3PNY A;  4P5O A;  2EA4 A;  4DGW B;  3J81 Z;  3GX4 X;  3MKW B;  4PSW A;  5IY5 H;  2VBX A;  3IH4 A;  4ZZD A;  4HW0 A;  3QWL A;  4M3G A;  1N77 A;  4C3J J;  3SZT A;  2VLA A;  3OIO A;  2VXD A;  2E36 A;  4EJW A;  1BIA A;  4IHW A;  3HOS A;  3FHZ A;  2AXT C;  2O5R A;  3LSG A;  3GXO A;  1BL0 A;  1FYM A;  4EJU A;  2X6X A;  2O7O A;  1YJN I;  1WFX A;  4XBF A;  2TDX A;  2PJR A;  2EV0 A;  1MJA A;  3HKZ A;  2EIM H;  5DEQ A;  4B4C A;  1IO2 A;  1I3A A;  1OCO H;  1PUF B;  1KU2 A;  5HLH A;  2HOT A;  2JPB A;  2QSG X;  2M34 A;  3DKW A;  3NAU A;  3GCM A;  4RLF A;  5CPR B;  1XN7 A;  2VON A;  4G7O F;  2F5E A;  2OQG A;  3DPT A;  1Z1D A;  2DYS H;  2QKM B;  2PLY A;  2VOP A;  4IO9 F;  1ZG1 A;  4RLQ A;  4HQE A;  3QU3 A;  2YU9 J;  4I7H A;  2NS7 A;  3GME A;  1WGX A;  4HX7 A;  4UUT A;  1TBX A;  1P2F A;  2LLK A;  3H36 A;  2CUJ A;  4W1U A;  5F1R A;  2GBY A;  3QPS A;  2Z3Y A;  3BRO A;  1CQT A;  3ZMD A;  4Y52 J;  2D2W A;  3A01 A;  2EIJ H;  3KP3 A;  2DXI A;  3IH3 A;  2KL4 A;  2E5N A;  5K7H A;  2KP6 A;  4B3X A;  3F8M A;  4B1R A;  2JRM A;  3HHH A;  3JTH A;  1XCB A;  3CCV I;  4OIP F;  4M9X A;  5L3F A;  3ABU A;  1XGS A;  3CQZ J;  4LGW A;  4A5M A;  3BR6 A;  4PK4 A;  2R5Z A;  1W0T A;  3FHN A;  1BN5 A;  3HZJ A;  2A05 A;  1XC5 A;  3S16 J;  3LFU A;  1HA8 A;  5TIS C;  2E60 A;  3JRA A;  4DIQ A;  2CO5 A;  4MIM A;  2YS9 A;  4YII A;  1NK2 P;  1IJW C;  3OYH A;  2WY7 Q;  3TQN A;  5FRO A;  3E5U A;  3UR3 C;  5JVT A;  2PX9 A;  3H5N A;  4CH7 A;  3HDD A;  1WJA A;  2K5C A;  2VUM J;  4NNJ A;  1HDD C;  4ZYE A;  4IF4 A;  1NK3 P;  3BZK A;  5KVR A;  4XLE A;  2GA1 A;  3NEU A;  2RGV A;  2M2E A;  2ELJ A;  3ABL H;  5D8L B;  3S3M A;  4EJT A;  2VC1 A;  1JJ6 C;  3RYP A;  3HGY A;  1MBE A;  2NVY J;  2QEN A;  2VE9 A;  4C2M J;  1X1A A;  3MKZ A;  2E5Z A;  2VQL A;  1GV2 A;  1F36 A;  3L00 A;  4LLN A;  1K78 B;  2CQN A;  2GXA A;  4O3M A;  1X4O A;  3S1M J;  2DMP A;  4WCG A;  5JHU A;  4BNC A;  3A0H C;  3OR2 C;  1LDD A;  2FUG 2;  2MG4 A;  2FBK A;  4ZYA A;  3DEU A;  2M4G A;  1YG2 A;  3LL7 A;  2A5Y B;  4EAT A;  4E70 A;  3KEO A;  3LWF A;  3W2W A;  1CF7 A;  1G59 A;  4BQA A;  2EK5 A;  3G4S I;  4AIJ A;  2ZNY A;  4E7H A;  3N05 A;  1STZ A;  2DN0 A;  4C30 A;  1VQ7 I;  1IXC A;  2DOD A;  3T8T A;  3DBL B;  1MSE C;  2JZY A;  2FBH A;  3OR1 C;  1IRF A;  1OLT A;  1JHH A;  3ERM A;  2XRN A;  2R7O A;  5GAH J;  2IGN A;  5IT9 Z;  5TGT A;  1XGO A;  2LD5 A;  1NG7 A;  2R5Y B;  1MBG A;  1V5G A;  2RVC A;  1MH3 A;  2IGM A;  1FSH A;  1MZB A;  2HI3 A;  2VKV A;  4LMY A;  2JA8 J;  2LG4 A;  4QSH A;  3GTO J;  3O8G A;  3ZOB A;  5FGM A;  5KK1 A;  4A3I J;  5IP6 A;  4BJT A;  2H8W A;  5BQT A;  2N8G A;  2DA5 A;  3NAR A;  3I59 A;  2W85 A;  4L5E A;  4W97 A;  5CQE A;  3ZP5 A;  4G7Z F;  3DTE A;  4R8H A;  2STW A;  1PP7 U;  4XLF A;  4BXF A;  5BOX A;  3CCL I;  2XVC A;  2O3F A;  4QPO A;  3IP4 B;  1REP C;  2NYX A;  1BA5 A;  3RKQ A;  1GUU A;  2Y30 A;  1QQI A;  2HXO A;  5LBQ A;  4WXC A;  1J09 A;  1KGS A;  4F52 A;  5K5R A;  3G1M A;  4OIN F;  3ABM H;  3R60 A;  4IVN A;  5C44 J;  4L0Y B;  1Y8R B;  2KLO A;  5HLG A;  3HOX J;  4PJL A;  2F5C A;  2MW8 A;  4XLN F;  1ZG5 A;  3HUG B;  5M5W J;  3CF5 F;  5ICE A;  3A03 A;  4HPQ A;  2HDD A;  2IT0 A;  2E7W A;  2XAJ A;  2ZB9 A;  1X1B A;  1IDY A;  2HVS A;  1JKP C;  2IS2 A;  2LY2 A;  1H89 C;  2P4W A;  1XSX A;  2XF7 A;  4AM3 A;  1SVO A;  1TW3 A;  1QZY A;  3P9I A;  3E5X A;  1U6G A;  3PL8 A;  2QKL B;  2OV7 A;  3WHC A;  4M6Y A;  3OMY A;  1IV6 A;  5CKT A;  3RQ4 A;  2MYS A;  5J40 A;  5BNG A;  4KNY A;  1VFC A;  4D5F A;  2V7F A;  4G9Y A;  1HLV A;  4YEJ A;  1TQI A;  3K4M A;  2I5U A;  2F5D A;  4RA2 A;  3TKY A;  1JKR C;  2Y75 A;  3DBR B;  4Y3O A;  4BAY A;  3H35 A;  4A5N A;  2ESH A;  1R7J A;  4I98 B;  1S9H A;  4X6A J;  1IV8 A;  2P6S A;  5CVJ A;  3A4C A;  2W24 A;  2CV2 A;  1T38 A;  1O4X A;  3FXK A;  2Z5U A;  3QYE A;  4HLY A;  1GXP A;  1N78 A;  2IS4 A;  3DU6 A;  1MBJ A;  1D8J A;  1I1G A;  2QCO A;  3O3K A;  2FD5 A;  1X58 A;  3MAJ A;  4M3D A;  5F0C A;  3COA C;  1MBH A;  2IP2 A;  2PN6 A;  3TL4 X;  1SVL A;  4RS8 A;  3I71 A;  4HG2 A;  3ULQ B;  5K5O A;  2WA0 A;  2GQQ A;  3BG5 A;  4NC7 A;  4WXH A;  4UNO A;  2JTV A;  3AL0 B;  2DCE A;  5L3B A;  3F9K A;  1I50 J;  2QLZ A;  1BR1 A;  4BE0 A;  2G7H A;  5IYB J;  4FE4 A;  2LF7 A;  1O3S A;  4O6J A;  3HTS B;  2KJB A;  4YFN F;  3TED A;  1E3H A;  4LB5 A;  2L4A A;  2HYG D;  1QO0 D;  3F72 A;  3RPQ A;  3BT9 A;  2L7M P;  2DFI A;  5CVV A;  2Y31 A;  3H9J A;  1I39 A;  3FK6 A;  5DCM A;  2EB7 A;  3FX3 A;  3M9A A;  2AO9 A;  1X3U A;  2M8G X;  2PFB A;  3KP7 A;  4II3 A;  2X9D A;  1LJ9 A;  1R1T A;  4TV7 A;  4U7D A;  4MFD A;  2PMU A;  3TW6 A;  2R7R A;  2A61 A;  2UXN A;  3PUB A;  2NXN B;  3QP6 A;  5LGU A;  1EF4 A;  2LKP A;  1GT0 C;  3CC4 I;  1YFH A;  5KNL A;  4O5V A;  2FA5 A;  3RSN A;  3GUD A;  5HDN A;  4A3K J;  2CGP A;  2EWN A;  1KYZ A;  2CMP A;  1JUP A;  3FKI J;  2LP0 A;  2VAS A;  1RR8 C;  3HOV J;  5ILV A;  3K2Z A;  4JP0 A;  2GIZ A;  1V55 H;  5GAE J;  4YRV A;  3ZPL A;  3ZXS A;  2V79 A;  4MEX F;  3OYN A;  4OIR F;  3HOW J;  1XPX A;  2E19 A;  2OC6 A;  3SJM A;  3BPX A;  3LNQ A;  2KIU A;  4HRI A;  4CGZ A;  3HGG A;  5FLV A;  1G3S A;  2V1U A;  2FML A;  2K40 A;  3JSO A;  3BG7 A;  1YRN B;  2HOA A;  1YJ9 I;  2MC3 A;  4OIQ F;  1HQC A;  1TQM A;  2VXZ A;  1OQY A;  4LIV A;  2XV4 S;  2LBF B;  2ELH A;  2VBW A;  2ZME C;  4CZZ A;  1X19 A;  3S14 J;  1Z3Y A;  2P5L C;  1H0M A;  4Y7N J;  3R61 A;  3D1N I;  4QIW N;  1LE8 A;  1ULY A;  4U0W A;  1XMX A;  5J47 A;  5L3E A;  4HZF A;  3MFK A;  3CCE I;  4PZJ A;  1G6N A;  4G6D A;  3BR5 A;  1ZK8 A;  4XSX F;  3K10 A;  2CW8 A;  1W36 C;  4I99 C;  3LSJ A;  2XKP A;  5EGO A;  1RNL A;  4BDY A;  3IAS 2;  4EGZ A;  4GRI A;  3F22 A;  1A6I A;  3ECH A;  3H0D A;  4M9S A;  4B44 A;  3HSR A;  2M5W A;  1JKO C;  4RB0 A;  2KRC A;  3BR3 A;  1JT6 A;  3D5S C;  4ZDL A;  1O3T A;  3J7A O;  3ZQQ A;  3RI4 A;  2O61 A;  5IP7 J;  3DV8 A;  2VQG A;  4HNU A;  3MKY B;  4CXF A;  2R4G A;  5HS7 A;  1ZRD A;  4Y13 A;  3DBH B;  1Z67 A;  3WG7 H;  1D3Y A;  1XTA A;  4XIC A;  2AS5 F;  4XRF A;  3CUO A;  2XAG A;  1ON1 A;  2RAE A;  5EZH A;  3VYU B;  5J4V A;  3I55 I;  5L3C A;  1SEU A;  1KU3 A;  4BDZ A;  1Z21 A;  1IXS B;  3L2V A;  3O2P E;  4BXU A;  1JKQ C;  4X0G A;  5FKL A;  1TL8 A;  2C6Y A;  2L54 A;  1C0W A;  2DBB A;  4U88 A;  1L3L A;  2GAU A;  1P4X A;  1TT5 B;  5LFA A;  1R00 A;  4HDV A;  1IXR C;  2JJ7 A;  3BG9 A;  2XPW A;  2R7X A;  4HST A;  5LRR A;  2M4K A;  2MH9 A;  4LK1 F;  4A0Y A;  1IC8 A;  4F93 B;  3HOY J;  2CW0 F;  2NOJ B;  4Y4R A;  1A36 A;  5FLX K;  3HRT A;  3S93 A;  2ZME B;  3K1M A;  2KIS A;  5K5Q A;  3IL2 A;  4JYK A;  2XGD A;  1B72 A;  2OU2 A;  1ETW A;  2DA2 A;  1EH6 A;  1ZQ3 P;  4AUX A;  5FD5 A;  2V26 A;  2BV6 A;  1ZGW A;  4NC8 A;  3T8R A;  3R0A A;  4RMN A;  4E7J A;  2HZD A;  2XAU A;  2YPR A;  5E18 F;  3BZC A;  5D4S A;  3IRR A;  1NG6 A;  2ZO4 A;  3KP2 A;  2QWW A;  1TTY A;  4FHT A;  5FKO A;  3K4J A;  1E0E A;  1I1S A;  1IUF A;  3CZ6 A;  3JR9 A;  1FSE A;  1ZR4 A;  5F0F A;  5JFR A;  3RTR A;  2LOO A;  1WRJ A;  3OSG A;  2WV0 A;  1PUF A;  2HQR A;  4XN3 A;  2HOS A;  2VQH A;  3LST A;  4RAF A;  1R22 A;  1Z7L A;  3K6G A;  1RUO A;  3PO2 J;  4BBR J;  1HF0 A;  3MVP A;  3E3V A;  2VOO A;  1JE8 A;  1OYW A;  4HF2 A;  5B1B H;  3M8J A;  3EYI A;  3S2W A;  4U7B A;  1YIJ I;  3C7J A;  4I01 A;  2EZK A;  1QHG A;  2G0E A;  4IRH A;  3FMQ A;  1FOK A;  4DOZ A;  3BOQ A;  3ABT A;  3FXR A;  3U1K A;  3RJP A;  2RN7 A;  2W00 A;  1ZAO A;  3ECO A;  2BXY A;  4L0Z B;  5E8I A;  2XF5 A;  3G1L A;  2HTS A;  5ED4 A;  2XAH A;  3N97 A;  2Z9O A;  3WOD F;  5JHF A;  1H88 C;  2CH0 A;  4X1E A;  1LQ1 A;  3BJO A;  3DLA A;  4ZDP A;  3J7A Y;  3IWZ A;  2H8R A;  4V19 K;  3MZ8 A;  3KX2 A;  3P9K A;  4M74 A;  1P7I A;  5B5E C;  2QEX I;  3ESW B;  4QPQ A;  4XLA A;  2DDB A;  2NNY A;  2CQK A;  4E7K A;  1JGS A;  4EM0 B;  3ZQ7 A;  2K02 A;  2ZXJ A;  5BPD A;  1AU7 A;  5LRS A;  3KYC B;  1S8N A;  3K7A J;  2DMU A;  3CUQ C;  3K4L A;  3ML6 A;  2DA4 A;  2IXS A;  2W1O A;  4BEH A;  4KMF A;  2V9V A;  1J59 A;  2E1M C;  2DMN A;  1I3Q J;  3JW4 A;  1GXQ A;  2QVO A;  2IA1 A;  4RDU A;  3P9C A;  1UG2 A;  2JA7 J;  4B8X A;  2ZC2 A;  2JT1 A;  4I76 A;  1GVD A;  1ACI A;  3QPH A;  4ETS A;  2WAE A;  3H5A A;  3D5R C;  1WJD A;  1ZRC A;  3BDD A;  2LRD A;  4RBO A;  3FF5 A;  3JRC A;  4Z6Y A;  4RGR A;  3EPZ A;  1WVR A;  1Z3X A;  2K9M A;  3H3U A;  4H0E A;  2ZSH B;  1GLN A;  3LMM A;  5EJC A;  1K78 A;  1MMD A;  2DA3 A;  1FP1 D;  2QQA A;  2YSR A;  4BH9 A;  2FX0 A;  3CMA I;  3C18 A;  4DW6 A;  4D9J A;  3IC7 A;  5TJJ A;  1WJB A;  1WCM J;  2XAF A;  3P5J A;  1WHU A;  1SD5 A;  2FF4 A;  3I54 A;  2V1N A;  1BI2 A;  5FFZ A;  4JX6 A;  1O3R A;  2M7B A;  3MMY B;  4CZC A;  3WTY C;  3G1O A;  2ECC A;  4LB6 B;  3C2G A;  4IRG A;  2ADU A;  1NHA A;  3ZQG A;  5FJ8 J;  3F8N A;  4ESF A;  1VF9 A;  4ESJ A;  2ZXH A;  4C3I J;  2W57 A;  2Q2E A;  4BY7 J;  4HEA 2;  3DCF A;  1ONV A;  4UVA A;  2M87 A;  2DW4 A;  4AWX B;  4D7M A;  3QP5 A;  1UG0 A;  4QLC U;  3BJA A;  5GAG J;  4ITV A;  4H4K C;  4L9J A;  2X1E A;  4LG3 A;  2D45 A;  3OIQ A;  2FOK A;  3KIO A;  4ENJ A;  2DPD A;  5IT9 K;  2R5Y A;  3FMS A;  2CRG A;  1DU6 A;  1G8X A;  2Y0M A;  4CCL A;  3IWF A;  3Q0V A;  2VT2 A;  1FEX A;  2P81 A;  2XDV A;  3CO7 C;  2DFF A;  2X4H A;  2HU9 A;  3WHB A;  4XRS G;  2K3P A;  3HEF A;  3GTL J;  5FKK A;  1X1C A;  2ZXI A;  4RAZ A;  2HQ5 A;  4AD9 A;  4F91 B;  1MNM C;  3IUO A;  2ZBK A;  2Z99 A;  3K1N A;  3ZRG A;  3CUQ B;  3LA3 A;  2DDA A;  1F5T A;  2Y2Z A;  3PIO F;  4Q48 A;  1QVU A;  3JRF A;  1VQL I;  2E1M B;  2XKO A;  2JA6 J;  4EV0 A;  2HDW A;  2W84 A;  5KCM A;  2ZJP F;  1BR2 A;  4IHS A;  4U87 A;  4IOC F;  1X2M A;  1ZH5 A;  4L5I A;  2IS6 A;  2W82 A;  4IKF A;  2WBM A;  2DOA A;  3LSM A;  2HGC A;  3F0C A;  4ZYG A;  1Y56 A;  2EA2 A;  4XSZ F;  4DQ2 A;  2WC2 A;  4E6K G;  2HEO A;  3SQN A;  2OTJ I;  1QPM A;  2TCT A;  2COM A;  3FXU A;  4D0P A;  1QBJ A;  2XRO A;  1V5E A;  2EIN H;  2VI6 A;  2XSJ C;  1FMV A;  3K4K A;  3UKG A;  4BS9 A;  4MO7 A;  1U3E M;  3MD2 A;  4DBR A;  3BLY A;  4GCV A;  1ERD A;  3LSH A;  1A35 A;  1W1W E;  1R5H A;  1TWG J;  2QF7 A;  4M3B A;  4KIC A;  3H1C A;  1JTY A;  3SFI A;  5FO5 A;  2DK8 A;  4LJZ F;  5C4X J;  5F27 A;  1ZLJ A;  4F55 A;  2IS1 A;  2JQ7 A;  1I6X A;  1FMW A;  2MBF A;  2KRF A;  4B3A A;  2LSO A;  1S6L A;  3ZMV A;  1RI7 A;  3E7L A;  4GGG A;  5FKN A;  5GAD J;  2NS8 A;  3A0B C;  3WTZ A;  3ZQL A;  2XAS A;  1LVK A;  1POG A;  3VYT B;  3LSI A;  4A0Z A;  3GTQ J;  5LGN A;  1K79 A;  4L9N A;  4NB5 A;  5F08 A;  3GYH X;  1R1V A;  3GZ6 A;  4S0H B;  4IJA A;  3A02 A;  4ON0 A;  4E4H A;  3GFJ A;  2L0K A;  1LUJ B;  4DYC A;  4HX4 A;  3GLX A;  2QSH X;  2HWV A;  3SXY A;  1O3Q A;  2HVQ A;  1OCZ H;  3HM5 A;  2V1X A;  1UHW A;  4DNC A;  4EVI A;  1MDM A;  3E97 A;  2UZK A;  3LQQ A;  3V8J A;  3TW7 A;  3OS2 A;  2CJJ A;  1B9M A;  1J2X A;  4XLC A;  4BYY A;  4F7Z A;  2DYR H;  3LSR A;  2H6C A;  3GTP J;  5HNF A;  5HDK A;  2A3S A;  2X48 A;  4XKW A;  4LLL A;  1O7F A;  1Y0N A;  1IRX A;  1DUX C;  2VT3 A;  2DMT A;  5JLW A;  1WJE A;  4BE2 A;  1FP2 A;  5H20 A;  3HOT A;  3Q9S A;  3Q3S A;  1YW9 A;  1WI9 A;  1XG1 A;  1DDN A;  2D1V A;  5E1X A;  1SFE A;  3U9G A;  4KFC A;  4BKX A;  2Z2S B;  1P9Q C;  1OCC H;  2JUG A;  2RQQ A;  1OR7 C;  3L09 A;  3KZY A;  2QGU A;  4V2G A;  3HPH A;  4LIU A;  4BJ5 C;  1A31 A;  2DT7 B;  2WWY A;  3KE2 A;  4PJ0 C;  4JX5 A;  4HF0 A;  5F6F A;  4WK8 F;  6PAX A;  4A3C J;  4FQG A;  1YRN A;  4AYB N;  3QYF A;  3AG1 H;  4R1H A;  1PDN C;  3L2W A;  4OMY A;  3M8E A;  1IAW A;  2LBF A;  2DTR A;  2QSF X;  5LEJ A;  5F04 A;  1QPI A;  2GOM A;  2LF8 A;  5GTH C;  1Y1V J;  3TO6 A;  3JRE A;  2OCC H;  3KEY A;  3L9F A;  4RAG A;  1FBS A;  2JVH A;  1X2N A;  4RB3 C;  2WAQ N;  3U21 A;  1APL C;  1VQ4 I;  1J7K A;  3PNT A;  3BQZ A;  3AL0 C;  5BMZ A;  1MMS A;  1BOA A;  1ETV A;  1R36 A;  2K9Q A;  2R7D A;  1YJW I;  3S1N J;  3CJT B;  3WGG A;  5FD6 A;  3G2B A;  2CUF A;  1SFX A;  3MWM A;  1ENH A;  2DFE A;  2P6T A;  1D1A A;  1LFP A;  3CTA A;  4DYQ A;  2LNB A;  1Z91 A;  1FBU A;  2NS0 A;  2DA1 A;  2EV5 A;  4AYB A;  3ZMU A;  2JN6 A;  3IRQ A;  3VB2 A;  1F4K A;  2DPU A;  3K1P A;  2LKS A;  4BQN A;  3OYK A;  2IRF G;  2Y69 H;  1FYK A;  2QBY B;  1WH7 A;  2QQB A;  1LDK B;  3TO7 A;  1ETQ A;  4AVZ A;  3OSF A;  2H09 A;  3H9G A;  4WXD A;  5CVI A;  3QQA A;  5E3M A;  5DTD A;  4I2O A;  3IAM 2;  1QA6 A;  3S2D J;  2CQX A;  2PG4 A;  3JRB A;  1W7P B;  1WH5 A;  2EJR A;  3GTM J;  4LFU A;  3WTX C;  2VPR A;  4FCY A;  5DD4 A;  2PQ8 A;  4KDP A;  4CYD A;  5GPA A;  2F4M B;  2NVQ J;  1YO5 C;  3ASN H;  3TBI A;  1IF1 A;  1VQ5 I;  2D5V A;  4AIH A;  3AAF A;  1R71 A;  1RKW A;  2HS5 A;  3E1S A;  9ANT A;  2B7E A;  2XPU A;  1YX5 A;  1YE9 A;  4AVP A;  5DV5 A;  3VEP A;  4XNF A;  2COB A;  1U9N A;  3OOU A;  3GF2 A;  2GM4 A;  3PQK A;  2ID3 A;  4CCN A;  2DJI A;  2QQ9 A;  4CYC A;  1V3F A;  2DA7 A;  1TWF J;  2V4J C;  1UEL B;  4XR6 A;  2QUF A;  3PQJ A;  4XOR A;  2JWT A;  3GTJ J;  2HYF A;  5J3L A;  1OYI A;  3G6E I;  3VWB A;  2DTZ A;  3DEE A;  3E6M A;  4ZYH A;  3HRS A;  1FC3 A;  2IEK A;  3V42 A;  4KIS A;  4KIF A;  3OYA A;  3EUH C;  5HS8 A;  2ZME A;  1ZN2 A;  2WY8 Q;  3JSP A;  4MEY F;  2VN2 A;  4XLP F;  4BU2 A;  1JXS A;  1PYV A;  3CO6 C;  2VJ4 A;  2BGC A;  3HXL A;  3JTG A;  1H8A C;  3U1D A;  1YQA A;  2M0C A;  1QHH D;  3PSI A;  2XGC A;  3Q5F A;  4P55 A;  3F6V A;  1U8R A;  4A0X A;  3RIR A;  3KFW X;  4L9T A;  2R7Q A;  3ZN1 A;  1VQ6 I;  3Q0U A;  3TO9 A;  4ZH4 F;  2O8K A;  4EEF G;  3DU5 A;  4KIT B;  4YG2 F;  2EIL H;  3H3Z A;  2ESN A;  4PGH A;  3VYR B;  5E3L A;  2JVG A;  2NAZ A;  3CMY A;  1BM9 A;  2JMW A;  2YUS A;  3J80 Z;  1HKS A;  3OYM A;  3HRU A;  4FT8 A;  3CJQ B;  1WJF A;  5LHG A;  1T2K A;  2PMZ N;  4C9Y A;  2W7N A;  1TC3 C;  5E3O A;  1AKH A;  4Z2Y A;  3I4P A;  4UHT A;  1PJR A;  1Z0X A;  2B9S A;  5ERI A;  3ASO H;  1TLH B;  2OAZ A;  3TP0 A;  4CHU A;  3SFZ A;  1MND A;  4Y15 A;  2VJ5 A;  3OYB A;  5IOZ A;  2O8X A;  1YS7 A;  1G4D A;  1EJ9 A;  1NTC A;  5DDG A;  2R7V A;  2G7U A;  1WJ5 A;  4XKV A;  2IAI A;  3M07 A;  1QRY A;  2B0L A;  2V6C A;  4KUM A;  4E7S A;  5DM7 F;  3MZY A;  1JI8 A;  1K83 J;  2R93 J;  2CQQ A;  2E35 A;  1D1B A;  3GZN B;  2MA3 A;  3G71 I;  1K4T A;  2OQR A;  2BY0 A;  3CJN A;  4RGX A;  3CMM A;  3KLN A;  5TRD A;  3B6C A;  5EEH A;  2ZKZ A;  1K61 A;  2ECB A;  1X1P A;  5BPI A;  3HG9 A;  1U9O A;  1D0Y A;  2FOW A;  4OAY A;  1BW5 A;  1D5Y A;  2VJI A;  1EH8 A;  2XRL A;  1HW5 A;  1USS A;  4HSR A;  2RC4 A;  2EBI A;  3AFH A;  2AHQ A;  1XX5 A;  1GHC A;  4YIR X;  3ELK A;  3W6J B;  2XSD C;  3FWE A;  1K7A A;  1NH3 A;  3W2A A;  2V9P A;  4G7H F;  4B47 A;  4ZTJ A;  5CVR A;  3BZ6 A;  4D5C A;  1QVT A;  3S3O A;  3E6D A;  2FNA A;  3OY9 A;  3S17 J;  3K70 C;  1D5V A;  4A69 C;  3BCA A;  2VOD A;  3K2A A;  2ME0 A;  1MBK A;  3WU2 C;  4RB2 C;  2BHY A;  1SAN A;  2LK2 A;  4YEL A;  3EYY A;  1T95 A;  1KYW A;  2CU7 A;  2P5K A;  1IG7 A;  5B1A H;  5JLX A;  2GXG A;  4HA8 A;  3I9V 2;  2V1D A;  3FKJ A;  4J00 A;  1HW2 A;  2M30 A;  5E8G A;  3CCS I;  4MGR A;  5EG0 B;  4GYI A;  2Y9Z A;  2ID6 A;  2FQ4 A;  2M0M A;  3RPU A;  3VSK A;  1SC7 A;  5C4J J;  1ETO A;  4G6T B;  3VOE A;  1TNT A;  4IHT A;  4HAM A;  2FQ3 A;  3I4N J;  3QAH A;  1HSJ A;  4XN0 A;  2LR8 A;  4RM2 A;  4N0B A;  1W5T A;  3L2Q A;  2CSO A;  5FKM A;  3I3L A;  2ZNZ A;  4C2T A;  2LY9 A;  2KHM A;  1BI3 A;  3FBN B;  1M1E B;  2Z1D A;  2MLG A;  2R7T A;  5HOO A;  2G9W A;  3SDG A;  4PFP A;  2F2E A;  4PDK A;  2MD5 A;  2HPM A;  2CQ7 A;  4A6E A;  3JAM Z;  4JX4 A;  4NBQ A;  1VZ0 A;  5KAI C;  2LC2 A;  2FSW A;  2BVM A;  2EFO A;  2STT A;  2EFP A;  3EET A;  4MLO A;  2DK5 A;  5DYM A;  1R9T J;  3GBG A;  1FOY A;  4HNV A;  5F1J A;  4ZTF A;  2MLK A;  5DD8 A;  2K86 A;  4LG0 B;  1SFU A;  4HQM A;  2GWR A;  1SMT A;  2HQA A;  2J5O A;  3PFI A;  1SD4 A;  3KP5 A;  2ACJ A;  5E3N A;  2VBZ A;  4Q5S F;  1BIB A;  2CFX A;  3VYS B;  3J81 K;  3QYB A;  5C3E J;  3CUQ A;  3M8F A;  1ZAR A;  3V8K A;  3E5Q A;  4N9H A;  2R7U A;  3TOB A;  2ISZ A;  4V2F A;  2FBI A;  3DXJ F;  3C3W A;  4MTE A;  2AXL A;  2KZG A;  3FXM A;  5H6Q A;  1B4A A;  1YHQ I;  2VIX A;  5IYD J;  4ENM A;  1RR7 A;  1XD7 A;  1BR4 A;  1U8B A;  5M5Y J;  1S72 I;  2ZJQ F;  1FBQ A;  4FTH A;  1LB2 A;  3FM3 A;  1X3Z B;  2XUB A;  2DQR A;  3QPT A;  4UUS B;  3E6C C;  3LFK A;  2DU9 A;  2A6H F;  4NHJ A;  3IHU A;  4IOA F;  1IN8 A;  4GXO A;  5CVU A;  4M71 A;  1IN7 A;  3FDY A;  3BY6 A;  3ISP A;  1B6A A;  3ZMZ A;  1T8I A;  4UXN A;  4BY1 J;  4ENK A;  1WPK A;  3JRH A;  4E7Z A;  3W6V A;  3B6A A;  4CCM A;  4I6Z A;  2BHZ A;  1UAA A;  2FMY A;  4PUS A;  1MGT A;  2DT6 A;  5FB2 A;  2QA4 I;  1MKM A;  3S2H J;  3PFY A;  3BG3 A;  5GTI C;  1LPQ A;  1HW1 A;  3S15 J;  1Z77 A;  4GYG A;  1FY7 A;  2OBP A;  4L18 B;  3F23 A;  2P7C B;  2GOX B;  3MKL A;  1Z6T A;  1Z6R A;  3UNG C;  3DP7 A;  1IDZ A;  2H94 A;  4CCK A;  2FXA A;  4XL9 A;  5IYC J;  1JGG A;  2LYC A;  1GV5 A;  2LVS A;  1TQP A;  3CCU I;  3BC8 A;  1U5T C;  2AQE A;  3F3X A;  2CV0 A;  3CC2 I;  3I64 A;  3V4G A;  2A07 F;  2IBD A;  3RCO A;  1VQ8 I;  3GO5 A;  2L7K A;  2VQC A;  3OYI A;  3BR0 A;  3GEZ A;  1T39 A;  1LNW A;  1GDT A;  4GFB A;  2R92 J;  3QRF F;  3EDP A;  1K4S A;  1VQM I;  2PBI A;  1BBY A;  1ORK A;  1P4A A;  2HR3 A;  2QM3 A;  2EFQ A;  1IRG A;  3RKY A;  5D6F A;  5AIQ A;  1RZ4 A;  5DM6 F;  1BC7 C;  3CLQ A;  3PIP F;  3K0L A;  3LA7 A;  5JR3 A;  5FRN A;  3PUF A;  3H3V K;  1FYL A;  3CCM I;  1XB4 A;  4XM3 A;  1ZKG A;  1LKX A;  1FWZ A;  3KEQ A;  2DMQ A;  1AOY A;  1LE8 B;  4C2U A;  2V6E A;  4NUB A;  2OCE A;  4F3Q A;  2R7S A;  3H92 A;  3NWS A;  4HDU A;  1JTX A;  1J5Y A;  2KRH A;  2LDU A;  4XOP A;  4ZJZ A;  2L2O A;  4DBQ A;  3G3Z A;  4XK4 A;  3N4M A;  1W36 D;  2B63 J;  1ODD A;  1UJ8 A;  5EGO B;  3C2B A;  2PI0 A;  4M3E A;  3EQL F;  5A2Q Z;  4RAY A;  3FIW A;  2MGQ A; 
#chains in the Genus database with same CATH homology
 3M3Y J;  2Y0S N;  1MBJ A;  4M6V A;  2QCO A;  4M3D A;  5F0C A;  2FD5 A;  1X58 A;  3TW7 A;  3PO3 J;  1MBH A;  2CJJ A;  3ZQH A;  5K7Z A;  1ZTR A;  3PM1 A;  3LSR A;  3GTP J;  4CYC B;  3IH2 A;  4A3L J;  5FLM J;  2X48 A;  3BG5 A;  5IOY A;  3HBL A;  4ABZ A;  3TP3 A;  3LOC A;  1G2H A;  1I50 J;  2FJ1 A;  2JA5 J;  2DMT A;  5JLW A;  3H0G J;  3Q3S A;  1VI0 A;  2KT0 A;  4FE4 A;  5IYB J;  1XG1 A;  3TED A;  1IGN A;  4BKX A;  4IHX A;  3BT9 A;  4V2G A;  2L7M P;  2Y31 A;  3FK6 A;  2LFB A;  1U78 A;  2AO9 A;  4JX5 A;  1BW6 A;  2M8G X;  2X9D A;  4A3C J;  2DA6 A;  1RKT A;  4A3J J;  5J1R A;  4MFD A;  1YRN A;  4AYB N;  2Y9Y A;  3TW6 A;  2K9S A;  1EF4 A;  4FIS A;  1IRZ A;  1GT0 C;  5HOD A;  1Y1W J;  2EQR A;  2R7Z J;  3Q0W A;  4A3K J;  1FTZ A;  1QPI A;  1JUP A;  3FKI J;  5F04 A;  2LP0 A;  4LOC A;  3JRE A;  1Y1V J;  4JP0 A;  1LFB A;  4XRS A;  1E3O C;  1X2N A;  3M4O J;  2WAQ N;  4MFE A;  3HOW J;  3BTL A;  1APL C;  2E19 A;  3SJM A;  3BR2 A;  3BQZ A;  3LNQ A;  2K9Q A;  1ETV A;  3HGG A;  5FLV A;  3S1N J;  1AKH B;  2K40 A;  1YRN B;  2HOA A;  1OCT C;  2CUF A;  3L1P A;  1ENH A;  2OPT A;  3BR1 A;  4DYQ A;  5EF6 A;  3ZQI A;  1ETY A;  2DA1 A;  4DYR A;  3CDL A;  2O9L A;  2JN6 A;  2JK3 A;  2M9H A;  3S14 J;  4Y7N J;  1TWC J;  3D1N I;  1WH7 A;  4QIW N;  1LE8 A;  2NOG A;  4A3F J;  1ETQ A;  3FIS A;  3OSF A;  1XS9 A;  3QQA A;  1FIP A;  5E3M A;  5DTD A;  3S2D J;  3BR5 A;  2CQX A;  3JRB A;  1ZK8 A;  2W48 A;  1WH5 A;  3GTM J;  2VPR A;  3LSJ A;  4FCY A;  3DEW A;  5EGO A;  5M3M J;  5EZG A;  5M5X J;  2MSY A;  1MBF A;  5GPA A;  3RZO J;  2NVQ J;  2KDZ A;  1ETK A;  2D5V A;  1A6I A;  1RES A;  1RKW A;  1JKO C;  1JJ8 C;  2XPU A;  9ANT A;  1FTT A;  3BR3 A;  1JT6 A;  4FE7 A;  1HOM A;  3QPL A;  2COB A;  1U9N A;  3OOU A;  2GLO A;  2GM4 A;  4C3H J;  1JUS A;  2ID3 A;  5IP7 J;  1HCR A;  5EDN A;  4CYC A;  4IHV A;  2DA7 A;  2XB0 X;  1TWF J;  2OF7 A;  1SFO J;  5IP9 J;  2JWT A;  3JRD A;  3GTJ J;  5J3L A;  1B8I A;  4A93 J;  2DTZ A;  3IV5 A;  3RQI A;  4XIC A;  3HOZ J;  1OFC X;  2IEK A;  2RAE A;  4A3D J;  5EZH A;  2TRT A;  5GP9 A;  3CCY A;  1JKQ C;  5FKL A;  2EZH A;  1RET A;  3S1Q J;  1H8A C;  1HDP A;  2ELK A;  2DJN A;  1RPW A;  2EH3 A;  1BJZ A;  2M0C A;  2WV1 A;  2JJ7 A;  3BG9 A;  2XPW A;  1OCP A;  1B8I B;  2XGC A;  2XGE A;  1IC8 A;  3HOY J;  3O8H A;  2L7Z A;  4A3B J;  3Q0U A;  2O8K A;  4EEF G;  4JYK A;  2XGD A;  1B72 A;  5E3L A;  3BTC A;  1ETW A;  2DA2 A;  3CMY A;  1ZQ3 P;  2JMW A;  2YUS A;  2XB5 A;  4IEJ A;  4AUX A;  3RZD J;  1WI3 A;  1ZGW A;  4J19 A;  1TC3 C;  2PMZ N;  5J1U A;  5E3O A;  1AKH A;  1JUM A;  5J1Y A;  1Z0X A;  3GTK J;  2HYJ A;  3HKZ N;  1S7E A;  1LFU P;  4BBS J;  1OJL A;  2L7F P;  1MSF C;  3TP0 A;  5FKO A;  2E1O A;  1IUF A;  3JR9 A;  1ZR4 A;  5F0F A;  2EZL A;  4BXX J;  5IOZ A;  4DZJ A;  5EYR A;  1B72 B;  2NVX J;  1NTC A;  3OSG A;  1PUF A;  2R0Q C;  2HOS A;  2X6O A;  1TWH J;  2IAI A;  1QRY A;  3PO2 J;  3IH4 A;  4BBR J;  1HF0 A;  3MVP A;  4XRM A;  4M3G A;  1K83 J;  2R93 J;  3JRG A;  2CQQ A;  4C3J J;  1AHD P;  3OIO A;  5EEA A;  4IHW A;  3LSG A;  1ITY A;  1BL0 A;  1A5J A;  2O7O A;  3B6C A;  1K61 A;  2EZK A;  2G0E A;  2ECB A;  1U9O A;  1BW5 A;  1D5Y A;  3HOV J;  2XRL A;  4B4C A;  1PUF B;  1F43 A;  2HOT A;  2L9R A;  2EBI A;  2AHQ A;  3G1L A;  2M34 A;  3NAU A;  1H88 C;  2XSD C;  4X1E A;  4A3G J;  5EG0 A;  4A3M J;  4AC0 A;  2H8R A;  4XID A;  4IHY A;  4D5C A;  1QVT A;  3BTI A;  3S17 J;  1P7I A;  4A69 C;  5F0H A;  3K2A A;  2ME0 A;  1MBK A;  2YU9 J;  2NS7 A;  4UUT A;  1WGX A;  1SAN A;  2LK2 A;  2CU7 A;  2LLK A;  1IG7 A;  1AU7 A;  4W1U A;  5JLX A;  2GBY A;  3QPS A;  3K7A J;  2DMU A;  1CQT A;  4Y52 J;  3A01 A;  2DA4 A;  2HXI A;  3IH3 A;  2E2H J;  2DMN A;  5EG0 B;  3ZQC A;  1I3Q J;  5K7H A;  2ID6 A;  2Y9Z A;  2FQ4 A;  4B1R A;  4RDU A;  5IPA A;  1UG2 A;  4D7N A;  2JA7 J;  5C4J J;  2WB1 N;  1ETO A;  3CQZ J;  4I76 A;  1DU0 A;  1GVD A;  3BR6 A;  3VPR A;  2LTP A;  2R5Z A;  2CUE A;  3I4N J;  4A3E J;  1W0T A;  1I6H J;  2LR8 A;  1W0U A;  1XC5 A;  3S16 J;  4RBO A;  2E2J J;  5FKM A;  3JRA A;  3JRC A;  2LY9 A;  2ME6 A;  1TWA J;  4MIM A;  1T33 A;  2YS9 A;  1NK2 P;  3SDG A;  1IJW C;  4QTR A;  3A01 B;  1UMQ A;  2DA3 A;  4JX4 A;  1MH4 A;  2FX0 A;  3LSP A;  3HDD A;  4DW6 A;  2VUM J;  1WCM J;  1HDD C;  1NK3 P;  4MLO A;  1R9T J;  4JX6 A;  3GBG A;  2M2E A;  2R5Z B;  4HNV A;  5F1J A;  3G1O A;  1JJ6 C;  3HGY A;  2ECC A;  1MBE A;  2NVY J;  4UUS A;  1FJL A;  3ZQG A;  5FJ8 J;  1VF9 A;  4C2M J;  1GV2 A;  4C3I J;  1F36 A;  3FK7 A;  4BY7 J;  5E3N A;  5C3E J;  3DCF A;  4D7M A;  2NVT J;  3S1M J;  2DMP A;  1ZR2 A;  4V2F A;  1UHS A;  2MG4 A;  3ZQF A;  2R5Y A;  5IYD J;  1RR7 A;  2CRG A;  1DU6 A;  1U8B A;  5M5Y J;  4FTH A;  2K9N A;  3Q0V A;  1FEX A;  2P81 A;  3I4M J;  4UUS B;  2DN0 A;  3WHB A;  4XRS G;  3HEF A;  3GTL J;  5FKK A;  2VKE A;  1MNM C;  2HQ5 A;  1MSE C;  1JT0 A;  1T56 A;  2Y2Z A;  4BY1 J;  1QVU A;  3HB9 A;  3JRF A;  1WPK A;  2JA6 J;  3JRH A;  3W6V A;  3B6A A;  2LD5 A;  2R5Y B;  1MBG A;  4I6Z A;  1X2M A;  1MH3 A;  2HI3 A;  2VKV A;  4NDL A;  2JA8 J;  4QSH A;  2EZI A;  3GTO J;  3O8G A;  3ZOB A;  3S2H J;  5M3F J;  2H1K A;  3BG3 A;  3F0C A;  2XPV A;  5DS9 A;  4A3I J;  5IP6 A;  4G12 A;  2DA5 A;  2N8G A;  3NAR A;  1Z77 A;  4L5E A;  4W97 A;  2E2I J;  3GTG J;  3S15 J;  2TCT A;  3MKL A;  3MN2 A;  1IDZ A;  2VI6 A;  5IYC J;  1JGG A;  1BA5 A;  1GV5 A;  3RKQ A;  3UKG A;  2LVS A;  1GUU A;  2Y30 A;  4MO7 A;  2HXO A;  2I10 A;  3G1M A;  1Q1V A;  5C44 J;  3HOX J;  2IBD A;  1P7J A;  1TWG J;  4DZP A;  2QF7 A;  2MW8 A;  3BQY A;  5M5W J;  4M3B A;  3BR0 A;  4GFB A;  1GDT A;  2R92 J;  1JTY A;  3SFI A;  3A03 A;  2HDD A;  1ORK A;  5C4X J;  2ZB9 A;  5F27 A;  1IDY A;  1JKP C;  3BTJ A;  1H89 C;  5K7F A;  5GPC A;  1ETX A;  1FIA A;  3WHC A;  4B3A A;  3JRI A;  3H3V K;  2LKX A;  1IV6 A;  3E7L A;  1ZKG A;  5BNG A;  1VFC A;  5FKN A;  4D5F A;  2NS8 A;  2DMQ A;  3ZQL A;  1LE8 B;  1POG A;  1HLV A;  3S1R J;  3GTQ J;  1JTX A;  3HOU J;  1JKR C;  5F08 A;  4S0H B;  4XK4 A;  3A02 A;  4M3F A;  2B63 J;  2L0K A;  5EGO B;  4DYC A;  4X6A J;  1VND A;  3C2B A;  4M3E A;  1O4X A;  3HM5 A;  3FIW A;  2MGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...