2LYAA

Structure of hiv-1 myr(-) matrix protein in complex with 1,2-dioctanoyl-sn-phosphatidylcholine
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein p17
publication title Trio engagement via plasma membrane phospholipids and the myristoyl moiety governs HIV-1 matrix binding to bilayers.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 36
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lyaA00
4JMUA 2K4EA 2K4HA 1HEKA 4IC9A 2HMXA 2H3IA 1L6NA 2H3ZA 1UPHA 1TAMA 2H3FA 2JMGA 2H3QA 2LYAA 1ECWA 2GOLA 2N1RA 1ED1A 1A6SA 2NV3A 2LYBA 2K4IA 1HIWA 4ICAA 2H3VA
chains in the Genus database with same CATH superfamily
2YB4A 3HPOA 2WB1F 1XC9A 4E0DA 4PHDA 4QWEA 1KW4A 1L7PA 3L5KA 3K1ZA 1B4FA 4K4IA 4B9MA 1SWVA 1SIJA 5K4LA 4NXZA 1SV0A 3CRXA 3NUQA 3ZDEA 9ICCA 8ICCA 5F3XB 1UCVA 2FMQA 3NVWA 5AI4A 4RPYA 7ICSA 3T5KA 1QTMA 5DG9A 2JH7A 5KFIA 2KFZA 2E3TA 4GIBA 3UMBA 5AKEA 3PW7A 4F5PA 4F4XA 3PNCA 5ALFA 4BX9C 3TFRA 1Q3UA 4EENA 3GV5B 4Q8EA 8ICFA 4I29A 2FLNA 3U26A 4ED6A 7ICIA 2DPIA 5AK5A 2BPFA 2ZUDA 5HNKA 3UM9A 5J2DA 2N1RA 4NLBA 3RJGA 2RQ5A 4TUPA 2RLTA 2PFPA 3MGIA 3NRWA 3SAFA 4PZNA 5DB6A 2HDOA 9ICLA 3LYSA 1TE2A 2B0CA 2KKVA 3D2NA 4C8KA 4Y2JA 4GXIA 1B0XA 2NRXA 4F72A 4IC9A 5FP0A 1CRXA 4JV0A 2KJ8A 4I2CA 7ICPA 2KZ3A 4EX6A 5ALNA 4BGDA 3PMLA 3KBBA 3M9OB 2KVCA 4FZMA 5ALJA 1V38A 2LHTA 4TQRA 7ICOA 4KLFA 2AQ0A 4ELTA 2W54A 2ZIXA 1T8EA 4EELA 4QZGA 3KTQA 4KX5A 2HOQA 1TAQA 1DK3A 4R8UA 3CP8A 3GFKB 1S97A 3PW4A 4UB5A 4QZDA 2YY6A 2Y1IA 7ICRA 5AKZA 4OJLA 2R8HA 3GV8B 5HMMA 4C8NA 3C2LA 1ZD4A 2UVVA 3BQ0A 2IA6A 2XGQA 5IIMA 1UQVA 5KFYA 3JPRA 4USAA 4NLNA 2LYAA 5ALUA 5KL1B 3SD7A 5BOLA 3V72A 7ICTA 1KFSA 2HHVA 3GIIA 1KRPA 4WJ3B 3KOOA 2K89A 4IQTA 2E1EA 3TQ1A 3T5LA 1ZQFA 5AHXA 1C7YA 1U9LA 2YX8A 1KN5A 3AM9A 1SGGA 3QX7A 4DSLA 4C8LA 4U6PA 4J9QA 4C8OA 1ZQKA 1K1QA 2MUTA 4QNLA 3LVWA 8ICOA 1FFUA 1D9FA 2Q0ZX 5HR6A 1FEZA 2EDUA 1N5WA 1N5XA 2KIWA 5J2IA 2B6GA 1XS9D 4J9PA 2ISPA 4RNMA 4PZOA 5AK3A 5KFWA 4ED0A 2CN1A 2ZIWA 1NK0A 4DSKA 4C4TA 4QWDA 1ECWA 1ZQOA 5ALZA 2E8MA 1ZQTA 2DF4B 4BXOB 3GIMA 4DEZA 4QZFA 1JXEA 4NY8A 1X9WA 4UASA 2F1IA 4NLKA 4NLCA 5GTHU 1XSLA 1V9PA 4YG2A 1GO3F 4YXJA 5DBAA 3N4MB 3Q8MA 2WF5A 2A3VA 4O3RA 1ZQZA 3GDXA 4KTQA 2W43A 4OD0A 1QSSA 2BDUA 2CXYA 5CP2A 1T3QA 1D9DA 1QH9A 3F53A 2QARB 2BPGA 5DQGA 1KDHA 3M7DA 4ED2A 4NV0A 5AKXA 2IOHA 1Q46A 4DL3A 3UXNA 4B9SA 4AYBC 4RQ2A 2F44A 2KG5A 4JV2A 4DSEA 5ALOA 3F5AA 4M9HA 3H8WA 2A1JA 3BS5A 5KFHA 2BCRA 3RB0A 2AH5A 4UAYA 5J0XA 4R65A 3H8JA 4Y2PA 4DF4A 3N97B 3MR3A 4RT2A 2ZIUB 2WB1C 4PH5A 1WWUA 4BUGA 4O3SA 1RYSA 2R8GA 2KICA 4DL5A 2KZZA 1Q8KA 1A77A 5DDYA 2RDJA 5L9XA 4PGYA 2KV2A 3UQ0A 1WG8A 4Q43A 2GO7A 3TANA 3HT3A 4UAVA 3C5FA 2KP7A 1KQQA 4J9RA 1WWVA 1X6IA 4XA5A 4PHEA 4P4MA 1PK3A 5HR7A 2XI9A 5ALDA 1S0MA 3B0XA 4DF8A 1BPDA 4US8A 3OSPA 4F93B 3BQ7A 4P4OA 1MQ2A 2WHEA 2KMDA 5J2AA 1ZQQA 3QU9A 5E79U 4CF5A 5HHIA 4KLGA 2EANA 1SL0A 7ICJA 1N61A 4KLDA 2QB0A 4I2AA 2PXIA 1U4BA 3KHGA 3OJUA 4ECSA 1U45A 3AU6A 1RM6C 8ICGA 2W9CB 2KOBA 1PUZA 3QUBA 3ZDBA 1ZQXA 4KLSA 5J2GA 4ECZA 1QQ5A 1QQ7A 2GLEA 2JGAA 4IL6U 5KTQA 5DQIA 1QLNA 1X2IA 1SWWA 1SV0C 4Q45A 9ICFA 3PV8A 3NRZA 3B9JA 5J0PA 4M6WA 1DRGA 2R8IA 3ONNA 2W3SA 2ZXIA 4Q8FA 2H5XA 4ED1A 4F3OA 5TISU 2KD1A 2MA1A 2F3NA 3BZCA 2NRVA 4UAWA 2IOFA 4AP9A 4M0AA 2VIXA 5KG0A 3ZDAA 7ICUA 3F2CA 2NRWA 3I1YA 4UARA 3Q8KA 3JPPA 4KLOA 1UA1A 2FI1A 2W55A 3NTUA 1N62A 3N7RC 2WF6A 4BWJA 2NRTA 4EBCA 5ALWA 1CI4A 4EBEA 1BNPA 1HUZA 2OEHA 3RBDA 1QSLA 5AM3A 2IHMA 4TUQA 3N28A 3H0LB 4YFKA 4R64A 2GOLA 1DGJA 9ICAA 2FE9A 4UB2A 5KG1A 4QZIA 2ASLA 1FO4A 3ETLA 4YMNA 4DFJA 1Z4NA 2PMZC 2ZIVA 4PL1A 4RQ1A 1Z00B 2BKEA 4KLHA 2K4HA 3Q8SB 4TQSA 5KT5A 4FS1A 2AGOA 4GC6A 5J2KA 4OJ6A 1TVAA 2HBMA 2ESEA 4OCZA 5J0WA 3V7LA 5KG5A 3MFIA 5AK6A 4I27A 4B9UA 1L3TA 4EEKA 2BDPA 1U49A 3T79A 3M9NB 5HMLA 5BPCA 5CA7A 1PZNA 3V6JA 2JZBB 4F4KA 2LM4A 5DB8A 3VC8A 5T14A 1TV9A 2J6UA 5J0TA 5ALQA 3NASA 3HP6A 4RQ8A 5AM4A 2NO5A 9ICJA 5G5GA 2DGZA 5AIBA 1CUKA 2YMMA 4I2DA 1CEZA 5DGAA 4F5QA 3KZIU 4C0ZA 2F8LA 4UBCA 5KFRA 4YR3A 2C2EA 3C2KA 1TAMA 4P0PA 5CB1A 2OH2A 4G3IA 3C5GA 3K1RB 4QZEA 1F44A 3NGDA 4RQ4A 4P0QB 1L7NA 1XU4A 5KAFU 2WF8A 4F5RA 1U47A 1D8BA 2JEIA 1PK1A 5A0LA 3Q8LA 1N56A 2OM6A 7ICVA 2L5YA 2Y1JA 3TARA 4UW9A 3I76A 4AYBF 1SKWA 5AM5A 1Y88A 3HWTA 4BWMA 2HHQA 1J2NA 2Y0SC 2B21A 1NK9A 4EBDA 2NV3A 4KLUA 2AXTU 4EZ9A 1NNLA 2Q4TA 1MC8A 2V9WA 4KN7A 3RB4A 2O6KA 2K4EA 4UB3A 1N60A 3C21A 1T3NA 4KLLA 4NL9A 4B9NA 1TFRA 3RRGA 2XY7A 3N7PD 3Q8PB 1YZ7A 1XNSA 3AUOA 1LVHA 1L8OA 2KHQA 4B6JA 4IQWA 5KAIU 5KFGA 1L7OA 3SQIA 3CW2C 1YZ6A 4ICAA 3ZD8A 3BDPA 1S8OA 7ICKA 2KVSA 1TKDA 1LV5A 5KFSA 4Y2TA 5DLGA 3RRHA 3BQTA 9ICQA 3UMCA 3M8SA 2MSNA 3V6HA 4YQWA 3PZPA 4O3OA 2W9AA 1L7MA 3PX6A 3C2MA 3QUQA 1T7PA 3FC4A 2DKXA 4DQIA 2LYHA 1YT3A 1ZQMA 9ICOA 3TADA 5J0SA 2EQYA 2E8OA 4GC7A 1X9SA 1JN3A 3H8MA 2DKZA 1ZXIA 3PSTA 5KFEA 2HHXA 8ICHA 4BJQA 3RTVA 4UBBA 4QZBA 1IV8A 2ZTDA 2KSOA 5EOZA 8ICNA 4MF8A 1KFDA 2Y9UA 4J9LA 2ZJAA 3GIKA 4Y2VA 4B9VA 3RB6A 2E5SA 4QZ9A 2XY6A 2VANA 1NK8A 4PHPA 3C1ZA 9ICBA 5L1MA 4YR2A 8ICBA 3ZI4A 1MSWD 3H0RB 3OHBA 3PSFA 4YMMA 4KLQA 4F2RA 3RAXA 3KHLA 2HHSA 1PVRA 4M9GA 5GTIU 4U7CA 1KLNA 4FBTA 3HX0A 5CJ7A 3FYHA 4JUZA 2DQNB 5AKIA 4YN4A 5AIAA 2G5IB 2PKEA 1FFVA 2A1AA 5KFAA 1SL2A 4PHAA 2NYVA 4DQRA 5HP4A 3ORYA 3IM1A 4F91B 3ZDCA 1NK4A 2C2DA 5D49A 4I2FA 2PFQA 3DEEA 3SR6A 2W04A 3M1YA 2DBYA 4O9MA 5DQHA 4US9A 3PX0A 1S9FA 5KFFA 3G6VA 2VA8A 1NJXA 3WKAA 1HJPA 4HAIA 3A0BU 2PMZF 4RQ5A 1VJ5A 3KFUF 1ED1A 2I9GA 2DFLA 2V4RA 3Q8QB 3LDAA 5HHHA 2DUYA 1UT8A 9ICGA 1V85A 2EAMA 1NZPA 4EZ6A 5ALVA 1SZHA 5KG6A 4FZNA 4RZRA 1NKBA 4P2HA 2DPJA 4ECWA 3NVZA 2QKQA 3D2SA 1KBUA 4OJOA 5ALTA 3Q8RB 9ICWA 3WK7A 3GV7B 3UXOA 2ZIUA 4JMUA 5ALSA 3PR5B 4NLZA 3M8RA 3L3FX 5IIIA 5AM0A 3KHRA 4O3QA 4GXJA 2HHUA 2K8BB 2XICA 2UVRA 2BCSA 3WK4A 1TK8A 1KTQA 3AL0B 4RQNA 5J8YA 3VCBA 4UATA 3QU2A 4M9NA 1SZPA 7ICNA 4I2EA 2KK0A 2BCQA 2CPRA 5G5HA 5CEHA 3QUCA 1FIQA 9ICXA 1Z4OA 8ICVA 1UT5A 5ALGA 5KFVA 3MABA 3GQCA 2Y0SF 1T4GA 1Z19A 2ZJ8A 4ACOA 1N63A 4ED8A 2OCEA 2IBKA 5F9NA 3ETRA 4ED7A 4JV1A 3V7KA 1SKRA 3GILA 2YN4A 1S76D 1NJZA 2W11A 4C4RA 3C23A 5D4BA 2BQUA 4B9TA 3RF9A 2YMQA 1ZQWA 3ED5A 5CWRA 2LM1A 9ICVA 3HRDD 2NRZA 1ZJNA 1UPHA 4MFAA 1U48A 4Z6DA 2F8KA 3ZD9A 3PO5A 3K75D 4NM2A 3NS1A 4FS2A 1BPBA 3UPQA 1XWLA 1BPXA 1RZTA 1O03A 1JI7A 8ICTA 2YB1A 4R8UB 5CHGA 5DLFA 3OSNA 4KLTA 2ZTEA 3AQEA 1BPYA 4I2JA 4PPXA 5KFOA 4EX7A 4JWNA 1ZQLA 3T5JA 4YCXA 1SL1A 3RJHA 5ALKA 2H3VA 1S5LU 3F5EA 4MEXA 1X9MA 3MGVA 2RDIA 3EWAA 3TFSA 4F4WA 3EYZA 3KKAA 4RQ3A 2XGPA 2DL0A 2W9BA 4ECXA 4RQ7A 1KSPA 2IMWP 3FM9A 1DOQA 4RUCA 2D3DA 4DS5A 1NZBA 4IR9A 2K4IA 3GU3A 1ZQGA 2W8LA 4IS7A 4QWAA 4Z6FA 2MUTB 1L6NA 1IM4A 4KMOB 2HW3A 2D8CA 1L8LA 5EE9A 2EZYA 2LPEA 4UB4A 1WCNA 1ZOLA 4I2IA 1ZQCA 4Z6CA 5KG4A 5ALRA 1L3SA 4MF2A 4LVSA 4MHVA 4DOAA 3MFHA 2ZIWB 3HKZC 5JTIA 3RH4A 3H7IA 2IHNA 4NL9C 2AJQA 3NVVA 3CNHA 1TK5A 3KZXA 3G6YA 4CGZA 9ICNA 4I28A 2YQEA 4DFKA 4A8EA 2JR5A 4CNQA 2W8KA 3OPXA 5DB7A 2VJ5A 4K4GA 3ICXA 5ALHA 2ISOA 3HILA 1QCKA 2YMLA 5KFBA 4R66A 4IRDA 1ZQYA 1NK7A 1DK2A 4FE3A 5CR0A 1RXVA 1BPEA 4F71A 5J2CA 1F5SA 2BQ3A 2J6TA 1XO1A 1NKCA 1DGSA 1SB3C 2E8PA 3WK8A 2E1FA 2H3IA 4F5NA 3RJKA 3OGUA 4QIWC 4IRKA 1ZQRA 3BJYA 4RQ0A 4O5CA 2BQRA 3FDSA 8ICJA 2KIVA 3A0HU 3AN1A 5KT6A 5L1JA 4F2SA 3BS5B 5F9LA 3G6XA 4Y2QA 3WK9A 4XRHA 4UAZA 2C22A 1Z1BA 2MRLA 4JB3A 5KNIA 1HIWA 5J0RA 5J0YA 4KLIA 4PJ0U 8ICZA 5KT7A 1L3UA 4GFJA 5KFUA 4ZH4A 4O0IA 1D8LA 3TAQA 1X6JA 1DXSA 3SAGA 3LWLA 2EAOA 1ZQHA 2F1HA 5TZVA 2G09A 4UB6U 3AEVA 3IP4B 2AQ4A 1K5OA 5L1LA 2RHFA 4PGQA 3H4BA 3PO4A 1T94A 2XC9A 4UB8U 8ICAA 2MAXA 3PSIA 4F4ZA 4F92B 2BPCA 4F5OA 3V7JA 3I28A 4RQMA 2HHTA 3PR4A 5ALEA 5DG7A 5KFZA 2ALZA 1J97A 2JRZA 4Y2YA 2HVIA 1P7DA 4MEYA 3TACB 2K4PA 1KFTA 2VJ4A 2AHOB 5ALMA 1JROA 8ICWA 5DKWA 5KFCA 4ECRA 1EXNA 4RNOA 1WCLA 1AQ6A 4DWIA 5C5JA 2LMRA 4ECUA 4Z6EA 4QW9A 8ICSA 1A6SA 1J2MA 2FDRA 8ICUA 2FLPA 2HSZA 5EE3A 2NO4A 5KT3A 4RT3A 4QZAA 5KFMA 3EZ5A 4DL2A 4UAUA 2QLTA 4RPZA 3MR6A 1NKEA 3LWMA 4M9LA 3ALRA 2FMPA 3QZ8A 3OHAA 2DWQA 3RJEA 4M6WB 1B43A 2H3QA 4DQQA 2KJ5A 2K8AA 2WF9A 4DQPA 4NWIA 4YD1A 5IIKA 1NOMA 4LZDA 2JEFA 1X66A 5CRXA 4J9SA 5B5EU 3RJIA 3SAHA 3RAQA 1JRPA 2W7PA 1L3VA 3C1YA 4XUSA 2GWSA 4NM1A 4ECQA 5J8YC 2XO7A 2ASJA 5AKYA 7ICLA 4C7ZA 3HJEA 2I6XA 2R18A 2BR0A 2K60A 2EZZA 4LZGA 5AI6A 8ICLA 2ZIVB 4G9BA 2PI5A 4O3PA 4DL4A 1BNOA 1UHUA 1SXDA 1RQNA 2HCFA 5ALIA 1N2XA 4B9LA 1LKYB 2FPMA 4DCCA 1KKXA 2GH1A 2KFNA 1IIPA 1ZQNA 5JRTA 3MBYA 3EPIA 1JIHA 2A19A 2OHFA 2RRDA 3JPOA 4DL7A 3IHQB 3HKZF 2BZFA 4ZOHC 4J9MA 1K1SA 3PW5A 3LK9A 2ZXHA 2ZUCA 2J6SA 2JV3A 2R8JA 3QU5A 1X42A 2F77X 3SENA 2WAQF 5KFKA 2FPLA 2P6RA 4QJFB 5J2FA 3DV9A 5AM1A 2JEJA 2LKYA 2Y9TA 2F2AB 1BGXT 2V4QA 2YMPA 8ICKA 2G5HB 3R9KA 1VLBA 2AGQA 2W3RA 2ZTCA 5L1KA 4ECTA 5IIJA 3UQ2A 1ZD3A 4P0PB 1SKSA 1ZRNA 1N48A 4DFPA 2CRXA 3OTQA 4FFDA 5KFTA 2ES6A 1RQLA 3H4DA 4BXOA 2PFNA 2HBLA 1PK1B 1ZD5A 8ICXA 2KEYA 1ZQDA 4DSIA 2LBOA 4IRCA 1M6YA 1ZQEA 4ECYA 1OUQA 3AU2A 4QIWF 5KG7A 4RQ6A 8ICRA 1C20A 5D46A 3KHHA 4EYIB 2FJ6A 4QZ8A 2JEGA 2ATLA 1OXJA 1Z3EB 2E8NA 3MDAA 3KKAC 2D6FC 1ZQPA 2JH1A 5DDMA 4XQ8A 3RR7A 5AICA 1JXLA 1S0NA 1ZQ1C 3CYMA 4TUSA 2ODGA 5EWEA 2QARA 5B66U 3QU4A 3TKAA 2G0AA 4KN4A 4TURA 5AI8A 5KT4A 4PL2A 4KX3A 3J81j 3N7SC 3D6JA 4LJXA 1NK5A 2QB1A 3RBEA 7ICHA 5EE1A 3NVYA 4DL6A 1HUOA 1NJWA 3SEIA 1ZQUA 4F4YA 4GXKA 4RUAA 4K4HA 3ZDDA 3JPNA 3F2DA 4C7YA 4O5KA 3LVVA 4C80A 2H3ZA 2FPKA 4CCHA 3QE9Y 2XVTA 1XO0A 2ZJ5A 2G06A 1H38A 7ICEA 8ICEA 5AK4A 2JXJA 4DLEA 1TAUA 1MQ3A 5AKGA 4QWBA 2HOIA 3ISBA 2IOFK 1BVSA 2LYBA 4YD2A 1PVQA 4YMOA 3BS7A 1LB2B 4O5EA 2OYYA 2KSOB 4IR1A 1RXWA 3M6ZA 3PVXA 3QU7A 3IN5A 4P4PA 4DFDA 2EAPA 3IG5A 4IQUA 3UXPA 5DGBA 3TAPA 4BDPA 4CE6A 2UVWA 1COOA 9ICHA 2K8CB 2JHDA 3L4PA 4IQVA 3BQ1A 2WTFA 3H40A 1RPLA 5ALXA 1QQ6A 4ED3A 4ELVA 3RH6A 3RB3A 5KT2A 1BPZA 3WKBA 4DSJA 5J0UA 4NLGA 5AI5A 3K4GA 1D8YA 2W9CA 1JX4A 4M47A 3RFAA 4CRXA 3SV4A 3IRUA 4RU9A 5IILA 3MR2A 4YP3A 1KL9A 4DS4A 5ALPA 2KTQA 1OW5A 2WFAA 4QZCA 1A76A 1ZD2P 4DLGA 3EUB2 1O08A 2WF7A 4OJPA 2AU0A 2PFOA 2HBKA 2XCAA 4KMUA 3SMVA 3SYZA 2ZIXB 5IIOA 1A0PA 4Y2RA 2HVHA 4J9NA 5KFXA 2XIDA 2KE7A 5AI9A 4QZHA 2P66A 2KJ9A 8ICIA 2BGWA 4DFMA 1ZQAA 3C28A 5H2FU 5C0YA 2P35A 4FBUA 4C4SA 4JWMA 3RH5A 1COKA 2I5HA 3PY8A 9ICMA 2MU2A 4MFCA 1URJA 2W9MA 2Z7JA 5EWGA 4F50A 3C29A 5DBBA 2YTUA 3ISDA 9ICEA 5AKLA 5KFJA 4O3MA 1Z00A 3E0FA 3SV3A 4RNNA 1JMSA 3PMNA 1NI3A 4M04A 1JALA 5DB9A 2UVUA 4UQGA 4DO9A 1V97A 2VKQA 2HBJA 3RR8A 4DOCA 2HHWA 2JZBA 4DQSA 4ELUA 1X9XA 4HYKA 2AGPA 1MN8A 3OJSA 4X5VA 2ASDA 3PW2A 9ICPA 3M9MB 2M9NA 2WAQC 4GLXA 1VDVA 1RG6A 2VA3A 5J2JA 5KG3A 1S0OA 1AROP 3D2QA 2C28A 2EH9A 2HI0A 3AMZA 1HEKA 8ICQA 4OO1J 5J0OA 4P0QA 1F0MA 2I1QA 1ZETA 3GZFA 2JMGA 1RDFA 3TADC 4DOBA 5KL8B 3SZ2A 1ZQJA 1S77D 9ICTA 3UMGA 1UA0A 4NJ8A 2P6UA 3WK6A 2G07A 7ICMA 5JU5A 2ZUBA 5DG8A 4Y2UA 1RYUA 2BCVA 1S10A 3PW0A 1QSYA 2A1JB 1ZQIA 1NJYA 4YVZA 3WKCA 5J2EA 2FLLA 3M6KA 3T3FA 2F1JA 4UB1A 3WKDA 5J2BA 4I2BA 5AM2A 3JPSA 2KNJA 2KZMA 3QNMA 1WUDA 2HMXA 4Y2XA 1ZYQA 4DSFA 4KITB 4M9JA 5ALYA 5ALLA 1ZQSA 1WYGA 2ZG6A 4J03A 3EPGA 4JK1A 4RPXA 3SI8A 4Q44A 5L1IA 5AKHA 2W9BB 5AI0A 4OJ5A 3JPQA 1XSPA 5J29A 2BHNA 1SV4A 2LI6A 1NK6A 5KFDA 4F8RA 4C8MA 4QW8A 3ISCA 3H0MB 5J0QA 3PSPA 3QUTA 3F2BA 2KKPA 1ZJMA 2C2RA 1TK0A 1LKYA 1Z1VA 1SXEA 1JUDA 1X40A 4CDGA 4PGXA 9ICSA 3THVA 2EZXA 3IG8A 2OXOA 4EYHB 1MA7A 2BCUA 5KFNA 4YXMA 3QZ7A 1ZQBA 2KHVA 2FMSA 3MDCA 2XCPA 3RJFA 2QB0B 1ZQVA 4J9OA 1IXRA 2XY5A 2R8KA 1B22A 3MC1A 3IDWA 3BQ2A 8ICYA 3QEBZ 3RJJA 1RYRA 3HW8A 5KFQA 3FAHA 1IG6A 5AKJA 4KLJA 4QWCA 5J2HA 3EW9A 3DDHA 4Y2SA 1XSNA 2W7OA 4I2GA 3MGHA 1KEJA 3QYPA 3O0FA 4R63A 5KG2A 4M2YA 2OWOA 1S0VA 3B0YA 3KD3A 3E58A 4O3NA 2G08A 3WKEA 2H3FA 3V6KA 7ICFA 4J9KA 3H8SA 3S6JA 3AQFA 7ICQA 2VA2A 4KLEA 2HOFA 9ICKA 2RP5A 3QXGA 3E2EA 1ZRMA 3T5HA 2M0NA 9ICRA 5EWFA 5KFPA 4FO6A 3WU2U 4CF4A 4FZLA 5EE0A 7ICGA 4YR0A 4CF3A 5JUMA 1PVPA 1L5UA 4MFFA 3TI0A 5KFLA 5DBCA 2KN7A 4I2HA 4ECVA 2PI4A 4KLMA 3IV6A 3QEAZ 5AKKA 3BZKA 3WK5A 3JPTA 2W03A 5IINA 9ICIA 5BOMA 2F76X 9ICUA 4EEYA 1Q3VA 3PX4A 3MR5A 3GIJA 8ICPA 8ICMA
chains in the Genus database with same CATH topology
2ZIUA 3ICXA 4JMUA 1IIPA 2YB4A 4IC9A 2WB1F 2YB1A 3N7RC 2E5SA 4PL2A 4KX3A 4AYBF 2RRDA 2KV2A 3H0MB 3PSPA 3F2BA 2KKPA 3N7SC 1CRXA 2KJ8A 2CN1A 2ZIWA 3HKZF 3L3FX 3AQEA 3H0LB 2Y0SC 1ECWA 2WAQC 4OJPA 2GOLA 3H0RB 3K1ZA 4CDGA 2ZXHA 3PSFA 2KVCA 4FZMA 1A6SA 2HBKA 2DF4B 2NV3A 4FE3A 2K8BB 1PVRA 3IG8A 2OXOA 3SMVA 2ZIXB 2LHTA 2XICA 2Q4TA 1MA7A 5HR7A 3D2QA 2F77X 2XI9A 1A0PA 4U7CA 3CRXA 2ZIVA 2PMZC 2WAQF 4PL1A 3F2DA 3AL0B 2KHVA 2H3VA 4NLCA 3NUQA 2K4EA 2K4HA 3LVVA 1HEKA 2DQNB 3F5EA 2E1FA 3VCBA 4QJFB 4OO1J 2H3IA 2H3ZA 4P0QA 2G5IB 2LKYA 2XIDA 2F2AB 3ALRA 4OJ6A 4QIWC 2HBMA 2ZIXA 3MGVA 2XVTA 1GO3F 2G5HB 1XO0A 3GZFA 2G06A 2JMGA 2KJ9A 2H3QA 4KX5A 3N7PD 2CPRA 2JH7A 2A3VA 2KJ5A 2HOQA 1XNSA 5KL8B 2K8AA 2KHQA 3CP8A 4NWIA 3T79A 2HOIA 3C28A 1Z1BA 4P0PB 2LYBA 2MRLA 1NZBA 5C0YA 3SQIA 2K4IA 1HIWA 3DEEA 2KOBA 2G07A 3GU3A 2BDUA 4BX9C 4ICAA 1PVQA 2OYYA 2CRXA 2Y0SF 2W04A 4OJLA 1Q3UA 1Z19A 5CRXA 2W7OA 3M6ZA 3F53A 4ACOA 3O0FA 1URJA 1L6NA 2Z7JA 3IN5A 4KMOB 4GFJA 3VC8A 5T14A 2JGAA 2HBLA 3SAHA 3M7DA 2G08A 3C29A 2H3FA 3IG5A 2KEYA 4NV0A 2LBOA 2W7PA 2PMZF 3PZPA 2LYAA 5KL1B 2N1RA 3AQFA 4O3MA 3E0FA 4NLBA 3SAGA 3KFUF 1ED1A 2HOFA 2K8CB 2RP5A 2JHDA 1YT3A 2DGZA 4AYBC 4QIWF 1OUQA 3M6KA 3RF9A 2G09A 2M0NA 2ZIWB 4WJ3B 2K89A 3F5AA 3HKZC 3NRWA 3IP4B 4C0ZA 1DRGA 2F8LA 2KNJA 3ONNA 4FZLA 3SAFA 2ZXIA 2E1EA 2R18A 1WUDA 2HMXA 2RHFA 1PVPA 1T94A 1UPHA 2YX8A 3PSTA 2D6FC 1SZHA 2KD1A 1TAMA 4FZNA 2MA1A 3PSIA 4P0PA 4BJQA 2OH2A 2JH1A 2ZIVB 3KZXA 2VKQA 4CGZA 2ZG6A 1F44A 4U6PA 2HBJA 3RFAA 4CRXA 2VIXA 2ZIUB 3F2CA 3LYSA 3D2SA 4A8EA 1ZQ1C 4P0QB 3CYMA 1KBUA 4QNLA 2WB1C 3LVWA 2W03A 4OJOA 5HR6A 2KKVA 3D2NA 4BUGA 3OPXA 1P7DA 1D8BA 2F76X 1Q3VA 2VJ5A 4OJ5A 2VJ4A 5A0LA 2KIWA 2G0AA 2OM6A 2KICA 2GH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JMU A;  2K4E A;  2K4H A;  1HEK A;  4IC9 A;  2HMX A;  2H3I A;  1L6N A;  2H3Z A;  1UPH A;  1TAM A;  2H3F A;  2JMG A;  2H3Q A;  2LYA A;  1ECW A;  2GOL A;  2N1R A;  1ED1 A;  1A6S A;  2NV3 A;  2LYB A;  2K4I A;  1HIW A;  4ICA A;  2H3V A; 
#chains in the Genus database with same CATH topology
 2YB4 A;  3HPO A;  2WB1 F;  1XC9 A;  4E0D A;  4PHD A;  4QWE A;  1KW4 A;  1L7P A;  3L5K A;  3K1Z A;  1B4F A;  4K4I A;  4B9M A;  1SWV A;  1SIJ A;  5K4L A;  4NXZ A;  1SV0 A;  3CRX A;  3NUQ A;  3ZDE A;  9ICC A;  8ICC A;  5F3X B;  1UCV A;  2FMQ A;  3NVW A;  5AI4 A;  4RPY A;  7ICS A;  3T5K A;  1QTM A;  5DG9 A;  2JH7 A;  5KFI A;  2KFZ A;  2E3T A;  4GIB A;  3UMB A;  5AKE A;  3PW7 A;  4F5P A;  4F4X A;  3PNC A;  5ALF A;  4BX9 C;  3TFR A;  1Q3U A;  4EEN A;  3GV5 B;  4Q8E A;  8ICF A;  4I29 A;  2FLN A;  3U26 A;  4ED6 A;  7ICI A;  2DPI A;  5AK5 A;  2BPF A;  2ZUD A;  5HNK A;  3UM9 A;  5J2D A;  2N1R A;  4NLB A;  3RJG A;  2RQ5 A;  4TUP A;  2RLT A;  2PFP A;  3MGI A;  3NRW A;  3SAF A;  4PZN A;  5DB6 A;  2HDO A;  9ICL A;  3LYS A;  1TE2 A;  2B0C A;  2KKV A;  3D2N A;  4C8K A;  4Y2J A;  4GXI A;  1B0X A;  2NRX A;  4F72 A;  4IC9 A;  5FP0 A;  1CRX A;  4JV0 A;  2KJ8 A;  4I2C A;  7ICP A;  2KZ3 A;  4EX6 A;  5ALN A;  4BGD A;  3PML A;  3KBB A;  3M9O B;  2KVC A;  4FZM A;  5ALJ A;  1V38 A;  2LHT A;  4TQR A;  7ICO A;  4KLF A;  2AQ0 A;  4ELT A;  2W54 A;  2ZIX A;  1T8E A;  4EEL A;  4QZG A;  3KTQ A;  4KX5 A;  2HOQ A;  1TAQ A;  1DK3 A;  4R8U A;  3CP8 A;  3GFK B;  1S97 A;  3PW4 A;  4UB5 A;  4QZD A;  2YY6 A;  2Y1I A;  7ICR A;  5AKZ A;  4OJL A;  2R8H A;  3GV8 B;  5HMM A;  4C8N A;  3C2L A;  1ZD4 A;  2UVV A;  3BQ0 A;  2IA6 A;  2XGQ A;  5IIM A;  1UQV A;  5KFY A;  3JPR A;  4USA A;  4NLN A;  2LYA A;  5ALU A;  5KL1 B;  3SD7 A;  5BOL A;  3V72 A;  7ICT A;  1KFS A;  2HHV A;  3GII A;  1KRP A;  4WJ3 B;  3KOO A;  2K89 A;  4IQT A;  2E1E A;  3TQ1 A;  3T5L A;  1ZQF A;  5AHX A;  1C7Y A;  1U9L A;  2YX8 A;  1KN5 A;  3AM9 A;  1SGG A;  3QX7 A;  4DSL A;  4C8L A;  4U6P A;  4J9Q A;  4C8O A;  1ZQK A;  1K1Q A;  2MUT A;  4QNL A;  3LVW A;  8ICO A;  1FFU A;  1D9F A;  2Q0Z X;  5HR6 A;  1FEZ A;  2EDU A;  1N5W A;  1N5X A;  2KIW A;  5J2I A;  2B6G A;  1XS9 D;  4J9P A;  2ISP A;  4RNM A;  4PZO A;  5AK3 A;  5KFW A;  4ED0 A;  2CN1 A;  2ZIW A;  1NK0 A;  4DSK A;  4C4T A;  4QWD A;  1ECW A;  1ZQO A;  5ALZ A;  2E8M A;  1ZQT A;  2DF4 B;  4BXO B;  3GIM A;  4DEZ A;  4QZF A;  1JXE A;  4NY8 A;  1X9W A;  4UAS A;  2F1I A;  4NLK A;  4NLC A;  5GTH U;  1XSL A;  1V9P A;  4YG2 A;  1GO3 F;  4YXJ A;  5DBA A;  3N4M B;  3Q8M A;  2WF5 A;  2A3V A;  4O3R A;  1ZQZ A;  3GDX A;  4KTQ A;  2W43 A;  4OD0 A;  1QSS A;  2BDU A;  2CXY A;  5CP2 A;  1T3Q A;  1D9D A;  1QH9 A;  3F53 A;  2QAR B;  2BPG A;  5DQG A;  1KDH A;  3M7D A;  4ED2 A;  4NV0 A;  5AKX A;  2IOH A;  1Q46 A;  4DL3 A;  3UXN A;  4B9S A;  4AYB C;  4RQ2 A;  2F44 A;  2KG5 A;  4JV2 A;  4DSE A;  5ALO A;  3F5A A;  4M9H A;  3H8W A;  2A1J A;  3BS5 A;  5KFH A;  2BCR A;  3RB0 A;  2AH5 A;  4UAY A;  5J0X A;  4R65 A;  3H8J A;  4Y2P A;  4DF4 A;  3N97 B;  3MR3 A;  4RT2 A;  2ZIU B;  2WB1 C;  4PH5 A;  1WWU A;  4BUG A;  4O3S A;  1RYS A;  2R8G A;  2KIC A;  4DL5 A;  2KZZ A;  1Q8K A;  1A77 A;  5DDY A;  2RDJ A;  5L9X A;  4PGY A;  2KV2 A;  3UQ0 A;  1WG8 A;  4Q43 A;  2GO7 A;  3TAN A;  3HT3 A;  4UAV A;  3C5F A;  2KP7 A;  1KQQ A;  4J9R A;  1WWV A;  1X6I A;  4XA5 A;  4PHE A;  4P4M A;  1PK3 A;  5HR7 A;  2XI9 A;  5ALD A;  1S0M A;  3B0X A;  4DF8 A;  1BPD A;  4US8 A;  3OSP A;  4F93 B;  3BQ7 A;  4P4O A;  1MQ2 A;  2WHE A;  2KMD A;  5J2A A;  1ZQQ A;  3QU9 A;  5E79 U;  4CF5 A;  5HHI A;  4KLG A;  2EAN A;  1SL0 A;  7ICJ A;  1N61 A;  4KLD A;  2QB0 A;  4I2A A;  2PXI A;  1U4B A;  3KHG A;  3OJU A;  4ECS A;  1U45 A;  3AU6 A;  1RM6 C;  8ICG A;  2W9C B;  2KOB A;  1PUZ A;  3QUB A;  3ZDB A;  1ZQX A;  4KLS A;  5J2G A;  4ECZ A;  1QQ5 A;  1QQ7 A;  2GLE A;  2JGA A;  4IL6 U;  5KTQ A;  5DQI A;  1QLN A;  1X2I A;  1SWW A;  1SV0 C;  4Q45 A;  9ICF A;  3PV8 A;  3NRZ A;  3B9J A;  5J0P A;  4M6W A;  1DRG A;  2R8I A;  3ONN A;  2W3S A;  2ZXI A;  4Q8F A;  2H5X A;  4ED1 A;  4F3O A;  5TIS U;  2KD1 A;  2MA1 A;  2F3N A;  3BZC A;  2NRV A;  4UAW A;  2IOF A;  4AP9 A;  4M0A A;  2VIX A;  5KG0 A;  3ZDA A;  7ICU A;  3F2C A;  2NRW A;  3I1Y A;  4UAR A;  3Q8K A;  3JPP A;  4KLO A;  1UA1 A;  2FI1 A;  2W55 A;  3NTU A;  1N62 A;  3N7R C;  2WF6 A;  4BWJ A;  2NRT A;  4EBC A;  5ALW A;  1CI4 A;  4EBE A;  1BNP A;  1HUZ A;  2OEH A;  3RBD A;  1QSL A;  5AM3 A;  2IHM A;  4TUQ A;  3N28 A;  3H0L B;  4YFK A;  4R64 A;  2GOL A;  1DGJ A;  9ICA A;  2FE9 A;  4UB2 A;  5KG1 A;  4QZI A;  2ASL A;  1FO4 A;  3ETL A;  4YMN A;  4DFJ A;  1Z4N A;  2PMZ C;  2ZIV A;  4PL1 A;  4RQ1 A;  1Z00 B;  2BKE A;  4KLH A;  2K4H A;  3Q8S B;  4TQS A;  5KT5 A;  4FS1 A;  2AGO A;  4GC6 A;  5J2K A;  4OJ6 A;  1TVA A;  2HBM A;  2ESE A;  4OCZ A;  5J0W A;  3V7L A;  5KG5 A;  3MFI A;  5AK6 A;  4I27 A;  4B9U A;  1L3T A;  4EEK A;  2BDP A;  1U49 A;  3T79 A;  3M9N B;  5HML A;  5BPC A;  5CA7 A;  1PZN A;  3V6J A;  2JZB B;  4F4K A;  2LM4 A;  5DB8 A;  3VC8 A;  5T14 A;  1TV9 A;  2J6U A;  5J0T A;  5ALQ A;  3NAS A;  3HP6 A;  4RQ8 A;  5AM4 A;  2NO5 A;  9ICJ A;  5G5G A;  2DGZ A;  5AIB A;  1CUK A;  2YMM A;  4I2D A;  1CEZ A;  5DGA A;  4F5Q A;  3KZI U;  4C0Z A;  2F8L A;  4UBC A;  5KFR A;  4YR3 A;  2C2E A;  3C2K A;  1TAM A;  4P0P A;  5CB1 A;  2OH2 A;  4G3I A;  3C5G A;  3K1R B;  4QZE A;  1F44 A;  3NGD A;  4RQ4 A;  4P0Q B;  1L7N A;  1XU4 A;  5KAF U;  2WF8 A;  4F5R A;  1U47 A;  1D8B A;  2JEI A;  1PK1 A;  5A0L A;  3Q8L A;  1N56 A;  2OM6 A;  7ICV A;  2L5Y A;  2Y1J A;  3TAR A;  4UW9 A;  3I76 A;  4AYB F;  1SKW A;  5AM5 A;  1Y88 A;  3HWT A;  4BWM A;  2HHQ A;  1J2N A;  2Y0S C;  2B21 A;  1NK9 A;  4EBD A;  2NV3 A;  4KLU A;  2AXT U;  4EZ9 A;  1NNL A;  2Q4T A;  1MC8 A;  2V9W A;  4KN7 A;  3RB4 A;  2O6K A;  2K4E A;  4UB3 A;  1N60 A;  3C21 A;  1T3N A;  4KLL A;  4NL9 A;  4B9N A;  1TFR A;  3RRG A;  2XY7 A;  3N7P D;  3Q8P B;  1YZ7 A;  1XNS A;  3AUO A;  1LVH A;  1L8O A;  2KHQ A;  4B6J A;  4IQW A;  5KAI U;  5KFG A;  1L7O A;  3SQI A;  3CW2 C;  1YZ6 A;  4ICA A;  3ZD8 A;  3BDP A;  1S8O A;  7ICK A;  2KVS A;  1TKD A;  1LV5 A;  5KFS A;  4Y2T A;  5DLG A;  3RRH A;  3BQT A;  9ICQ A;  3UMC A;  3M8S A;  2MSN A;  3V6H A;  4YQW A;  3PZP A;  4O3O A;  2W9A A;  1L7M A;  3PX6 A;  3C2M A;  3QUQ A;  1T7P A;  3FC4 A;  2DKX A;  4DQI A;  2LYH A;  1YT3 A;  1ZQM A;  9ICO A;  3TAD A;  5J0S A;  2EQY A;  2E8O A;  4GC7 A;  1X9S A;  1JN3 A;  3H8M A;  2DKZ A;  1ZXI A;  3PST A;  5KFE A;  2HHX A;  8ICH A;  4BJQ A;  3RTV A;  4UBB A;  4QZB A;  1IV8 A;  2ZTD A;  2KSO A;  5EOZ A;  8ICN A;  4MF8 A;  1KFD A;  2Y9U A;  4J9L A;  2ZJA A;  3GIK A;  4Y2V A;  4B9V A;  3RB6 A;  2E5S A;  4QZ9 A;  2XY6 A;  2VAN A;  1NK8 A;  4PHP A;  3C1Z A;  9ICB A;  5L1M A;  4YR2 A;  8ICB A;  3ZI4 A;  1MSW D;  3H0R B;  3OHB A;  3PSF A;  4YMM A;  4KLQ A;  4F2R A;  3RAX A;  3KHL A;  2HHS A;  1PVR A;  4M9G A;  5GTI U;  4U7C A;  1KLN A;  4FBT A;  3HX0 A;  5CJ7 A;  3FYH A;  4JUZ A;  2DQN B;  5AKI A;  4YN4 A;  5AIA A;  2G5I B;  2PKE A;  1FFV A;  2A1A A;  5KFA A;  1SL2 A;  4PHA A;  2NYV A;  4DQR A;  5HP4 A;  3ORY A;  3IM1 A;  4F91 B;  3ZDC A;  1NK4 A;  2C2D A;  5D49 A;  4I2F A;  2PFQ A;  3DEE A;  3SR6 A;  2W04 A;  3M1Y A;  2DBY A;  4O9M A;  5DQH A;  4US9 A;  3PX0 A;  1S9F A;  5KFF A;  3G6V A;  2VA8 A;  1NJX A;  3WKA A;  1HJP A;  4HAI A;  3A0B U;  2PMZ F;  4RQ5 A;  1VJ5 A;  3KFU F;  1ED1 A;  2I9G A;  2DFL A;  2V4R A;  3Q8Q B;  3LDA A;  5HHH A;  2DUY A;  1UT8 A;  9ICG A;  1V85 A;  2EAM A;  1NZP A;  4EZ6 A;  5ALV A;  1SZH A;  5KG6 A;  4FZN A;  4RZR A;  1NKB A;  4P2H A;  2DPJ A;  4ECW A;  3NVZ A;  2QKQ A;  3D2S A;  1KBU A;  4OJO A;  5ALT A;  3Q8R B;  9ICW A;  3WK7 A;  3GV7 B;  3UXO A;  2ZIU A;  4JMU A;  5ALS A;  3PR5 B;  4NLZ A;  3M8R A;  3L3F X;  5III A;  5AM0 A;  3KHR A;  4O3Q A;  4GXJ A;  2HHU A;  2K8B B;  2XIC A;  2UVR A;  2BCS A;  3WK4 A;  1TK8 A;  1KTQ A;  3AL0 B;  4RQN A;  5J8Y A;  3VCB A;  4UAT A;  3QU2 A;  4M9N A;  1SZP A;  7ICN A;  4I2E A;  2KK0 A;  2BCQ A;  2CPR A;  5G5H A;  5CEH A;  3QUC A;  1FIQ A;  9ICX A;  1Z4O A;  8ICV A;  1UT5 A;  5ALG A;  5KFV A;  3MAB A;  3GQC A;  2Y0S F;  1T4G A;  1Z19 A;  2ZJ8 A;  4ACO A;  1N63 A;  4ED8 A;  2OCE A;  2IBK A;  5F9N A;  3ETR A;  4ED7 A;  4JV1 A;  3V7K A;  1SKR A;  3GIL A;  2YN4 A;  1S76 D;  1NJZ A;  2W11 A;  4C4R A;  3C23 A;  5D4B A;  2BQU A;  4B9T A;  3RF9 A;  2YMQ A;  1ZQW A;  3ED5 A;  5CWR A;  2LM1 A;  9ICV A;  3HRD D;  2NRZ A;  1ZJN A;  1UPH A;  4MFA A;  1U48 A;  4Z6D A;  2F8K A;  3ZD9 A;  3PO5 A;  3K75 D;  4NM2 A;  3NS1 A;  4FS2 A;  1BPB A;  3UPQ A;  1XWL A;  1BPX A;  1RZT A;  1O03 A;  1JI7 A;  8ICT A;  2YB1 A;  4R8U B;  5CHG A;  5DLF A;  3OSN A;  4KLT A;  2ZTE A;  3AQE A;  1BPY A;  4I2J A;  4PPX A;  5KFO A;  4EX7 A;  4JWN A;  1ZQL A;  3T5J A;  4YCX A;  1SL1 A;  3RJH A;  5ALK A;  2H3V A;  1S5L U;  3F5E A;  4MEX A;  1X9M A;  3MGV A;  2RDI A;  3EWA A;  3TFS A;  4F4W A;  3EYZ A;  3KKA A;  4RQ3 A;  2XGP A;  2DL0 A;  2W9B A;  4ECX A;  4RQ7 A;  1KSP A;  2IMW P;  3FM9 A;  1DOQ A;  4RUC A;  2D3D A;  4DS5 A;  1NZB A;  4IR9 A;  2K4I A;  3GU3 A;  1ZQG A;  2W8L A;  4IS7 A;  4QWA A;  4Z6F A;  2MUT B;  1L6N A;  1IM4 A;  4KMO B;  2HW3 A;  2D8C A;  1L8L A;  5EE9 A;  2EZY A;  2LPE A;  4UB4 A;  1WCN A;  1ZOL A;  4I2I A;  1ZQC A;  4Z6C A;  5KG4 A;  5ALR A;  1L3S A;  4MF2 A;  4LVS A;  4MHV A;  4DOA A;  3MFH A;  2ZIW B;  3HKZ C;  5JTI A;  3RH4 A;  3H7I A;  2IHN A;  4NL9 C;  2AJQ A;  3NVV A;  3CNH A;  1TK5 A;  3KZX A;  3G6Y A;  4CGZ A;  9ICN A;  4I28 A;  2YQE A;  4DFK A;  4A8E A;  2JR5 A;  4CNQ A;  2W8K A;  3OPX A;  5DB7 A;  2VJ5 A;  4K4G A;  3ICX A;  5ALH A;  2ISO A;  3HIL A;  1QCK A;  2YML A;  5KFB A;  4R66 A;  4IRD A;  1ZQY A;  1NK7 A;  1DK2 A;  4FE3 A;  5CR0 A;  1RXV A;  1BPE A;  4F71 A;  5J2C A;  1F5S A;  2BQ3 A;  2J6T A;  1XO1 A;  1NKC A;  1DGS A;  1SB3 C;  2E8P A;  3WK8 A;  2E1F A;  2H3I A;  4F5N A;  3RJK A;  3OGU A;  4QIW C;  4IRK A;  1ZQR A;  3BJY A;  4RQ0 A;  4O5C A;  2BQR A;  3FDS A;  8ICJ A;  2KIV A;  3A0H U;  3AN1 A;  5KT6 A;  5L1J A;  4F2S A;  3BS5 B;  5F9L A;  3G6X A;  4Y2Q A;  3WK9 A;  4XRH A;  4UAZ A;  2C22 A;  1Z1B A;  2MRL A;  4JB3 A;  5KNI A;  1HIW A;  5J0R A;  5J0Y A;  4KLI A;  4PJ0 U;  8ICZ A;  5KT7 A;  1L3U A;  4GFJ A;  5KFU A;  4ZH4 A;  4O0I A;  1D8L A;  3TAQ A;  1X6J A;  1DXS A;  3SAG A;  3LWL A;  2EAO A;  1ZQH A;  2F1H A;  5TZV A;  2G09 A;  4UB6 U;  3AEV A;  3IP4 B;  2AQ4 A;  1K5O A;  5L1L A;  2RHF A;  4PGQ A;  3H4B A;  3PO4 A;  1T94 A;  2XC9 A;  4UB8 U;  8ICA A;  2MAX A;  3PSI A;  4F4Z A;  4F92 B;  2BPC A;  4F5O A;  3V7J A;  3I28 A;  4RQM A;  2HHT A;  3PR4 A;  5ALE A;  5DG7 A;  5KFZ A;  2ALZ A;  1J97 A;  2JRZ A;  4Y2Y A;  2HVI A;  1P7D A;  4MEY A;  3TAC B;  2K4P A;  1KFT A;  2VJ4 A;  2AHO B;  5ALM A;  1JRO A;  8ICW A;  5DKW A;  5KFC A;  4ECR A;  1EXN A;  4RNO A;  1WCL A;  1AQ6 A;  4DWI A;  5C5J A;  2LMR A;  4ECU A;  4Z6E A;  4QW9 A;  8ICS A;  1A6S A;  1J2M A;  2FDR A;  8ICU A;  2FLP A;  2HSZ A;  5EE3 A;  2NO4 A;  5KT3 A;  4RT3 A;  4QZA A;  5KFM A;  3EZ5 A;  4DL2 A;  4UAU A;  2QLT A;  4RPZ A;  3MR6 A;  1NKE A;  3LWM A;  4M9L A;  3ALR A;  2FMP A;  3QZ8 A;  3OHA A;  2DWQ A;  3RJE A;  4M6W B;  1B43 A;  2H3Q A;  4DQQ A;  2KJ5 A;  2K8A A;  2WF9 A;  4DQP A;  4NWI A;  4YD1 A;  5IIK A;  1NOM A;  4LZD A;  2JEF A;  1X66 A;  5CRX A;  4J9S A;  5B5E U;  3RJI A;  3SAH A;  3RAQ A;  1JRP A;  2W7P A;  1L3V A;  3C1Y A;  4XUS A;  2GWS A;  4NM1 A;  4ECQ A;  5J8Y C;  2XO7 A;  2ASJ A;  5AKY A;  7ICL A;  4C7Z A;  3HJE A;  2I6X A;  2R18 A;  2BR0 A;  2K60 A;  2EZZ A;  4LZG A;  5AI6 A;  8ICL A;  2ZIV B;  4G9B A;  2PI5 A;  4O3P A;  4DL4 A;  1BNO A;  1UHU A;  1SXD A;  1RQN A;  2HCF A;  5ALI A;  1N2X A;  4B9L A;  1LKY B;  2FPM A;  4DCC A;  1KKX A;  2GH1 A;  2KFN A;  1IIP A;  1ZQN A;  5JRT A;  3MBY A;  3EPI A;  1JIH A;  2A19 A;  2OHF A;  2RRD A;  3JPO A;  4DL7 A;  3IHQ B;  3HKZ F;  2BZF A;  4ZOH C;  4J9M A;  1K1S A;  3PW5 A;  3LK9 A;  2ZXH A;  2ZUC A;  2J6S A;  2JV3 A;  2R8J A;  3QU5 A;  1X42 A;  2F77 X;  3SEN A;  2WAQ F;  5KFK A;  2FPL A;  2P6R A;  4QJF B;  5J2F A;  3DV9 A;  5AM1 A;  2JEJ A;  2LKY A;  2Y9T A;  2F2A B;  1BGX T;  2V4Q A;  2YMP A;  8ICK A;  2G5H B;  3R9K A;  1VLB A;  2AGQ A;  2W3R A;  2ZTC A;  5L1K A;  4ECT A;  5IIJ A;  3UQ2 A;  1ZD3 A;  4P0P B;  1SKS A;  1ZRN A;  1N48 A;  4DFP A;  2CRX A;  3OTQ A;  4FFD A;  5KFT A;  2ES6 A;  1RQL A;  3H4D A;  4BXO A;  2PFN A;  2HBL A;  1PK1 B;  1ZD5 A;  8ICX A;  2KEY A;  1ZQD A;  4DSI A;  2LBO A;  4IRC A;  1M6Y A;  1ZQE A;  4ECY A;  1OUQ A;  3AU2 A;  4QIW F;  5KG7 A;  4RQ6 A;  8ICR A;  1C20 A;  5D46 A;  3KHH A;  4EYI B;  2FJ6 A;  4QZ8 A;  2JEG A;  2ATL A;  1OXJ A;  1Z3E B;  2E8N A;  3MDA A;  3KKA C;  2D6F C;  1ZQP A;  2JH1 A;  5DDM A;  4XQ8 A;  3RR7 A;  5AIC A;  1JXL A;  1S0N A;  1ZQ1 C;  3CYM A;  4TUS A;  2ODG A;  5EWE A;  2QAR A;  5B66 U;  3QU4 A;  3TKA A;  2G0A A;  4KN4 A;  4TUR A;  5AI8 A;  5KT4 A;  4PL2 A;  4KX3 A;  3J81 j;  3N7S C;  3D6J A;  4LJX A;  1NK5 A;  2QB1 A;  3RBE A;  7ICH A;  5EE1 A;  3NVY A;  4DL6 A;  1HUO A;  1NJW A;  3SEI A;  1ZQU A;  4F4Y A;  4GXK A;  4RUA A;  4K4H A;  3ZDD A;  3JPN A;  3F2D A;  4C7Y A;  4O5K A;  3LVV A;  4C80 A;  2H3Z A;  2FPK A;  4CCH A;  3QE9 Y;  2XVT A;  1XO0 A;  2ZJ5 A;  2G06 A;  1H38 A;  7ICE A;  8ICE A;  5AK4 A;  2JXJ A;  4DLE A;  1TAU A;  1MQ3 A;  5AKG A;  4QWB A;  2HOI A;  3ISB A;  2IOF K;  1BVS A;  2LYB A;  4YD2 A;  1PVQ A;  4YMO A;  3BS7 A;  1LB2 B;  4O5E A;  2OYY A;  2KSO B;  4IR1 A;  1RXW A;  3M6Z A;  3PVX A;  3QU7 A;  3IN5 A;  4P4P A;  4DFD A;  2EAP A;  3IG5 A;  4IQU A;  3UXP A;  5DGB A;  3TAP A;  4BDP A;  4CE6 A;  2UVW A;  1COO A;  9ICH A;  2K8C B;  2JHD A;  3L4P A;  4IQV A;  3BQ1 A;  2WTF A;  3H40 A;  1RPL A;  5ALX A;  1QQ6 A;  4ED3 A;  4ELV A;  3RH6 A;  3RB3 A;  5KT2 A;  1BPZ A;  3WKB A;  4DSJ A;  5J0U A;  4NLG A;  5AI5 A;  3K4G A;  1D8Y A;  2W9C A;  1JX4 A;  4M47 A;  3RFA A;  4CRX A;  3SV4 A;  3IRU A;  4RU9 A;  5IIL A;  3MR2 A;  4YP3 A;  1KL9 A;  4DS4 A;  5ALP A;  2KTQ A;  1OW5 A;  2WFA A;  4QZC A;  1A76 A;  1ZD2 P;  4DLG A;  3EUB 2;  1O08 A;  2WF7 A;  4OJP A;  2AU0 A;  2PFO A;  2HBK A;  2XCA A;  4KMU A;  3SMV A;  3SYZ A;  2ZIX B;  5IIO A;  1A0P A;  4Y2R A;  2HVH A;  4J9N A;  5KFX A;  2XID A;  2KE7 A;  5AI9 A;  4QZH A;  2P66 A;  2KJ9 A;  8ICI A;  2BGW A;  4DFM A;  1ZQA A;  3C28 A;  5H2F U;  5C0Y A;  2P35 A;  4FBU A;  4C4S A;  4JWM A;  3RH5 A;  1COK A;  2I5H A;  3PY8 A;  9ICM A;  2MU2 A;  4MFC A;  1URJ A;  2W9M A;  2Z7J A;  5EWG A;  4F50 A;  3C29 A;  5DBB A;  2YTU A;  3ISD A;  9ICE A;  5AKL A;  5KFJ A;  4O3M A;  1Z00 A;  3E0F A;  3SV3 A;  4RNN A;  1JMS A;  3PMN A;  1NI3 A;  4M04 A;  1JAL A;  5DB9 A;  2UVU A;  4UQG A;  4DO9 A;  1V97 A;  2VKQ A;  2HBJ A;  3RR8 A;  4DOC A;  2HHW A;  2JZB A;  4DQS A;  4ELU A;  1X9X A;  4HYK A;  2AGP A;  1MN8 A;  3OJS A;  4X5V A;  2ASD A;  3PW2 A;  9ICP A;  3M9M B;  2M9N A;  2WAQ C;  4GLX A;  1VDV A;  1RG6 A;  2VA3 A;  5J2J A;  5KG3 A;  1S0O A;  1ARO P;  3D2Q A;  2C28 A;  2EH9 A;  2HI0 A;  3AMZ A;  1HEK A;  8ICQ A;  4OO1 J;  5J0O A;  4P0Q A;  1F0M A;  2I1Q A;  1ZET A;  3GZF A;  2JMG A;  1RDF A;  3TAD C;  4DOB A;  5KL8 B;  3SZ2 A;  1ZQJ A;  1S77 D;  9ICT A;  3UMG A;  1UA0 A;  4NJ8 A;  2P6U A;  3WK6 A;  2G07 A;  7ICM A;  5JU5 A;  2ZUB A;  5DG8 A;  4Y2U A;  1RYU A;  2BCV A;  1S10 A;  3PW0 A;  1QSY A;  2A1J B;  1ZQI A;  1NJY A;  4YVZ A;  3WKC A;  5J2E A;  2FLL A;  3M6K A;  3T3F A;  2F1J A;  4UB1 A;  3WKD A;  5J2B A;  4I2B A;  5AM2 A;  3JPS A;  2KNJ A;  2KZM A;  3QNM A;  1WUD A;  2HMX A;  4Y2X A;  1ZYQ A;  4DSF A;  4KIT B;  4M9J A;  5ALY A;  5ALL A;  1ZQS A;  1WYG A;  2ZG6 A;  4J03 A;  3EPG A;  4JK1 A;  4RPX A;  3SI8 A;  4Q44 A;  5L1I A;  5AKH A;  2W9B B;  5AI0 A;  4OJ5 A;  3JPQ A;  1XSP A;  5J29 A;  2BHN A;  1SV4 A;  2LI6 A;  1NK6 A;  5KFD A;  4F8R A;  4C8M A;  4QW8 A;  3ISC A;  3H0M B;  5J0Q A;  3PSP A;  3QUT A;  3F2B A;  2KKP A;  1ZJM A;  2C2R A;  1TK0 A;  1LKY A;  1Z1V A;  1SXE A;  1JUD A;  1X40 A;  4CDG A;  4PGX A;  9ICS A;  3THV A;  2EZX A;  3IG8 A;  2OXO A;  4EYH B;  1MA7 A;  2BCU A;  5KFN A;  4YXM A;  3QZ7 A;  1ZQB A;  2KHV A;  2FMS A;  3MDC A;  2XCP A;  3RJF A;  2QB0 B;  1ZQV A;  4J9O A;  1IXR A;  2XY5 A;  2R8K A;  1B22 A;  3MC1 A;  3IDW A;  3BQ2 A;  8ICY A;  3QEB Z;  3RJJ A;  1RYR A;  3HW8 A;  5KFQ A;  3FAH A;  1IG6 A;  5AKJ A;  4KLJ A;  4QWC A;  5J2H A;  3EW9 A;  3DDH A;  4Y2S A;  1XSN A;  2W7O A;  4I2G A;  3MGH A;  1KEJ A;  3QYP A;  3O0F A;  4R63 A;  5KG2 A;  4M2Y A;  2OWO A;  1S0V A;  3B0Y A;  3KD3 A;  3E58 A;  4O3N A;  2G08 A;  3WKE A;  2H3F A;  3V6K A;  7ICF A;  4J9K A;  3H8S A;  3S6J A;  3AQF A;  7ICQ A;  2VA2 A;  4KLE A;  2HOF A;  9ICK A;  2RP5 A;  3QXG A;  3E2E A;  1ZRM A;  3T5H A;  2M0N A;  9ICR A;  5EWF A;  5KFP A;  4FO6 A;  3WU2 U;  4CF4 A;  4FZL A;  5EE0 A;  7ICG A;  4YR0 A;  4CF3 A;  5JUM A;  1PVP A;  1L5U A;  4MFF A;  3TI0 A;  5KFL A;  5DBC A;  2KN7 A;  4I2H A;  4ECV A;  2PI4 A;  4KLM A;  3IV6 A;  3QEA Z;  5AKK A;  3BZK A;  3WK5 A;  3JPT A;  2W03 A;  5IIN A;  9ICI A;  5BOM A;  2F76 X;  9ICU A;  4EEY A;  1Q3V A;  3PX4 A;  3MR5 A;  3GIJ A;  8ICP A;  8ICM A; 
#chains in the Genus database with same CATH homology
 2ZIU A;  3ICX A;  4JMU A;  1IIP A;  2YB4 A;  4IC9 A;  2WB1 F;  2YB1 A;  3N7R C;  2E5S A;  4PL2 A;  4KX3 A;  4AYB F;  2RRD A;  2KV2 A;  3H0M B;  3PSP A;  3F2B A;  2KKP A;  3N7S C;  1CRX A;  2KJ8 A;  2CN1 A;  2ZIW A;  3HKZ F;  3L3F X;  3AQE A;  3H0L B;  2Y0S C;  1ECW A;  2WAQ C;  4OJP A;  2GOL A;  3H0R B;  3K1Z A;  4CDG A;  2ZXH A;  3PSF A;  2KVC A;  4FZM A;  1A6S A;  2HBK A;  2DF4 B;  2NV3 A;  4FE3 A;  2K8B B;  1PVR A;  3IG8 A;  2OXO A;  3SMV A;  2ZIX B;  2LHT A;  2XIC A;  2Q4T A;  1MA7 A;  5HR7 A;  3D2Q A;  2F77 X;  2XI9 A;  1A0P A;  4U7C A;  3CRX A;  2ZIV A;  2PMZ C;  2WAQ F;  4PL1 A;  3F2D A;  3AL0 B;  2KHV A;  2H3V A;  4NLC A;  3NUQ A;  2K4E A;  2K4H A;  3LVV A;  1HEK A;  2DQN B;  3F5E A;  2E1F A;  3VCB A;  4QJF B;  4OO1 J;  2H3I A;  2H3Z A;  4P0Q A;  2G5I B;  2LKY A;  2XID A;  2F2A B;  3ALR A;  4OJ6 A;  4QIW C;  2HBM A;  2ZIX A;  3MGV A;  2XVT A;  1GO3 F;  2G5H B;  1XO0 A;  3GZF A;  2G06 A;  2JMG A;  2KJ9 A;  2H3Q A;  4KX5 A;  3N7P D;  2CPR A;  2JH7 A;  2A3V A;  2KJ5 A;  2HOQ A;  1XNS A;  5KL8 B;  2K8A A;  2KHQ A;  3CP8 A;  4NWI A;  3T79 A;  2HOI A;  3C28 A;  1Z1B A;  4P0P B;  2LYB A;  2MRL A;  1NZB A;  5C0Y A;  3SQI A;  2K4I A;  1HIW A;  3DEE A;  2KOB A;  2G07 A;  3GU3 A;  2BDU A;  4BX9 C;  4ICA A;  1PVQ A;  2OYY A;  2CRX A;  2Y0S F;  2W04 A;  4OJL A;  1Q3U A;  1Z19 A;  5CRX A;  2W7O A;  3M6Z A;  3F53 A;  4ACO A;  3O0F A;  1URJ A;  1L6N A;  2Z7J A;  3IN5 A;  4KMO B;  4GFJ A;  3VC8 A;  5T14 A;  2JGA A;  2HBL A;  3SAH A;  3M7D A;  2G08 A;  3C29 A;  2H3F A;  3IG5 A;  2KEY A;  4NV0 A;  2LBO A;  2W7P A;  2PMZ F;  3PZP A;  2LYA A;  5KL1 B;  2N1R A;  3AQF A;  4O3M A;  3E0F A;  4NLB A;  3SAG A;  3KFU F;  1ED1 A;  2HOF A;  2K8C B;  2RP5 A;  2JHD A;  1YT3 A;  2DGZ A;  4AYB C;  4QIW F;  1OUQ A;  3M6K A;  3RF9 A;  2G09 A;  2M0N A;  2ZIW B;  4WJ3 B;  2K89 A;  3F5A A;  3HKZ C;  3NRW A;  3IP4 B;  4C0Z A;  1DRG A;  2F8L A;  2KNJ A;  3ONN A;  4FZL A;  3SAF A;  2ZXI A;  2E1E A;  2R18 A;  1WUD A;  2HMX A;  2RHF A;  1PVP A;  1T94 A;  1UPH A;  2YX8 A;  3PST A;  2D6F C;  1SZH A;  2KD1 A;  1TAM A;  4FZN A;  2MA1 A;  3PSI A;  4P0P A;  4BJQ A;  2OH2 A;  2JH1 A;  2ZIV B;  3KZX A;  2VKQ A;  4CGZ A;  2ZG6 A;  1F44 A;  4U6P A;  2HBJ A;  3RFA A;  4CRX A;  2VIX A;  2ZIU B;  3F2C A;  3LYS A;  3D2S A;  4A8E A;  1ZQ1 C;  4P0Q B;  3CYM A;  1KBU A;  4QNL A;  2WB1 C;  3LVW A;  2W03 A;  4OJO A;  5HR6 A;  2KKV A;  3D2N A;  4BUG A;  3OPX A;  1P7D A;  1D8B A;  2F76 X;  1Q3V A;  2VJ5 A;  4OJ5 A;  2VJ4 A;  5A0L A;  2KIW A;  2G0A A;  2OM6 A;  2KIC A;  2GH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...