2LYAA

Structure of hiv-1 myr(-) matrix protein in complex with 1,2-dioctanoyl-sn-phosphatidylcholine
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trio engagement via plasma membrane phospholipids and the myristoyl moiety governs HIV-1 matrix binding to bilayers.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
molecule keywords Matrix protein p17
total genus 36
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lyaA00
1TAMA 4ICAA 2H3VA 2K4IA 2K4EA 4JMUA 4IC9A 1HIWA 2GOLA 1A6SA 1UPHA 2H3IA 1ECWA 2K4HA 2LYBA 1HEKA 2H3ZA 2N1RA 2NV3A 2HMXA 2LYAA 2H3QA 1L6NA 2JMGA 1ED1A 2H3FA
chains in the Genus database with same CATH superfamily
5CJ7A 4JK1A 5L9XA 3MDAA 2PXIA 4NLNA 5ALEA 2EAPA 4DOCA 2KVCA 5ALZA 4K4IA 3AQEA 5TISU 1KTQA 3EYZA 3PO4A 4LVSA 4GXIA 4KLOA 2E3TA 1V97A 4Y2UA 5IINA 1YZ7A 4NLKA 2W8KA 5KG4A 3WKBA 3BZCA 3T3FA 2JEJA 3SAHA 2D8CA 3L3FX 2JGAA 2R8KA 1XC9A 4DF8A 4ECXA 2WB1F 2EAOA 5AI4A 8ICBA 2JV3A 2HHVA 4F5RA 3PY8A 2F8KA 1WWUA 3QNMA 2D3DA 4MHVA 4F4ZA 1BPXA 2WF7A 2ZTDA 5J29A 3EPIA 4KLGA 4MEXA 4RQ8A 1IV8A 4J9OA 4PZOA 3RB6A 3TADA 1NK0A 3C1YA 5HMLA 5KFUA 5DBCA 1XO1A 2PFOA 1X42A 2BHNA 1ZQPA 3SMVA 2H3IA 2M9NA 3SEIA 1Z19A 5DG7A 4I2FA 3THVA 1ZJNA 2LMRA 4YXMA 2YB1A 3QEAZ 2ZXIA 1SKWA 2KZMA 2JZBB 2DUYA 4I27A 2XCPA 2F1IA 5DB8A 3AQFA 3F2DA 4ACOA 4EENA 3EPGA 3D2SA 1Z4OA 2HHUA 2VANA 1L5UA 4NLCA 2KFZA 4J9NA 4MFFA 9ICUA 2ZG6A 1L7MA 4ELTA 5IIOA 4UW9A 2W43A 2AHOB 4Y2RA 4YVZA 1NK9A 4IR9A 1U49A 3SR6A 2A19A 1HIWA 5KL8B 1RG6A 3QU9A 4GFJA 4CF5A 5KFCA 3QX7A 4UAVA 1CUKA 2VJ5A 4C8OA 1BPYA 3ZDEA 3RF9A 2R8GA 7ICOA 4RUCA 4PZNA 2DPJA 4FBUA 4O5EA 3GIMA 4RQ6A 3PR5B 3RAXA 2YY6A 3WK9A 3H0MB 4B9MA 4RQNA 1ZD4A 2QB0A 4DF4A 4DQPA 1X6JA 3K4GA 5AK4A 1L7NA 3GFKB 2JHDA 8ICKA 2W9AA 1L3SA 4I2AA 4BDPA 3BJYA 5AI5A 3NGDA 5EE9A 3OHAA 4R8UA 3MGHA 5AK3A 2KIVA 2RDIA 1ZD2P 2JH1A 2CN1A 3DEEA 8ICIA 5ALGA 1D8YA 2K8CB 8ICSA 5HHHA 1VLBA 3R9KA 5DB7A 7ICLA 4O3PA 5IIKA 4QWCA 3G6XA 4JMUA 3ISDA 3ETRA 3ZDDA 4PGQA 1KSPA 3ETLA 2Y9TA 5AKHA 2MUTB 5HP4A 3PW4A 3MABA 2ZTEA 5K4LA 3M1YA 1L8LA 1L8OA 1Q46A 4NXZA 5AI9A 2FPLA 5AM4A 4KN7A 1H38A 4BWJA 5J0YA 1ZJMA 2BCVA 3TAPA 1JX4A 1Z00B 2QLTA 2AH5A 2OM6A 2KNJA 3IV6A 1OUQA 5J0QA 1KKXA 3PW2A 2HHQA 1ZQNA 2R8HA 4O3MA 4KX3A 2EDUA 3PSIA 4QZ8A 4F4YA 2OWOA 1K1SA 3H4BA 3NVWA 1KN5A 1ZQHA 1U45A 5KG3A 1UT5A 3L4PA 1SZHA 4PGXA 3SAFA 2KICA 5ALUA 2DWQA 2IMWP 9ICQA 1L6NA 2NO4A 4TURA 4DFMA 4UAZA 2EAMA 3C21A 4DFJA 4YMNA 3H40A 1XO0A 3H8JA 3JPRA 3ZI4A 4UASA 5KFDA 2HSZA 1PK1B 5D4BA 2BQUA 4UB2A 3QU5A 4CDGA 1D9FA 3RBEA 2CXYA 4YR0A 3C2KA 3TADC 4F2SA 3PSFA 3NVYA 3E58A 7ICMA 4KLFA 2KEYA 2MSNA 3D2QA 2AQ0A 4YR2A 4EZ9A 3RH5A 1ECWA 1NK4A 4JWNA 5DBBA 4RNMA 5J0SA 5EE1A 3KKAC 1V9PA 4DOBA 4FO6A 2HBJA 2RP5A 4J9QA 2Z7JA 3AM9A 5AKKA 5CHGA 2WF5A 4YR3A 1BNPA 4F93B 3WKCA 2OYYA 4QZGA 1X6IA 3D6JA 4KLSA 3KKAA 1MSWD 4F5QA 2OCEA 1TFRA 4F4WA 4M2YA 4QZFA 1T94A 1NOMA 1SB3C 4F8RA 2UVVA 2A1JB 5KFPA 9ICVA 5GTHU 3RJFA 4I28A 2LYAA 2EZZA 1WCNA 4P4PA 4ED8A 2PKEA 2JH7A 2HI0A 5KG1A 2P66A 3RJEA 2FPMA 2W04A 1ZQQA 3GILA 5BPCA 4ED0A 3HT3A 1COKA 4ED3A 3UXNA 1XU4A 1RXVA 4QWAA 2N1RA 3QUBA 5ALFA 4Z6CA 1D8LA 1QQ7A 4YFKA 3ZD9A 2NRXA 5DKWA 3RJKA 4UAWA 2G06A 8ICVA 5ALPA 1N5WA 3NASA 4EEYA 2KJ5A 4NV0A 3PX6A 4E0DA 4EX7A 4ED6A 2G07A 7ICGA 1CEZA 3LWLA 2G0AA 3WKDA 2ZIVB 2PMZC 5JUMA 3JPQA 5KT3A 4QIWF 1RQNA 4YN4A 2BR0A 3RAQA 1K5OA 2WB1C 2UVUA 4M9HA 4RT2A 3T5HA 9ICRA 5DLFA 3UMBA 2LM1A 1YZ6A 2LM4A 4JB3A 2R8JA 1NKBA 4GC6A 1UQVA 4DSJA 1XWLA 2H3ZA 4ZOHC 1DGSA 5IIIA 3T5LA 2XGQA 5J0OA 3RB3A 1HUOA 1XNSA 1RYRA 1SKSA 4C4SA 2HCFA 4U6PA 2HOFA 1ZETA 1VJ5A 2FMPA 3MGVA 2OXOA 4Z6DA 2GH1A 3SZ2A 2YMQA 5KFLA 4J03A 3ALRA 3PW7A 2H3FA 2GLEA 3OTQA 3GIKA 1T7PA 4XA5A 2ASDA 4C8KA 3OSPA 2ALZA 3AEVA 2WF9A 5ALWA 4IRKA 4OD0A 3QUQA 3JPOA 1L7OA 3C2MA 4F2RA 1QH9A 1FO4A 5ALTA 4DOAA 3OPXA 3DDHA 1X9SA 4OO1J 5ALOA 4X5VA 2QB1A 4B9LA 4YG2A 2KV2A 1QTMA 4YD2A 4HAIA 4QWEA 5DGBA 1O08A 1TAQA 2W3SA 2F1JA 5AIAA 1N48A 2WTFA 2XC9A 5KG0A 5KT7A 4JV0A 4CF4A 2AGPA 1ZOLA 4KLQA 1ZQYA 3PZPA 1NK7A 5DB9A 2E8OA 2BPCA 1MA7A 3OGUA 1FFUA 2NRTA 4U7CA 2HBLA 2KFNA 4TUQA 3FC4A 4QZHA 2HOQA 4R66A 3VC8A 9ICOA 3FYHA 2ASJA 1FIQA 2CRXA 8ICGA 3F5EA 3BS5B 5KT2A 4QZBA 4BJQA 3HPOA 2KIWA 5EWGA 3Q8KA 5J0XA 4DO9A 1V85A 1DOQA 9ICLA 1BPDA 3QXGA 2WF6A 4DCCA 3LDAA 2GO7A 2KE7A 4QNLA 2AGOA 4M47A 1RXWA 5CRXA 3RB4A 5HR6A 5AKYA 1ZQKA 4F4KA 4QZDA 1A0PA 1UCVA 3B9JA 3PSPA 1DGJA 1ZQMA 4JWMA 4M04A 2EZXA 2W3RA 4Q43A 2J6SA 4F5PA 2E1EA 4C8LA 3V72A 2BDUA 4ED7A 2O6KA 2HVIA 3AN1A 1RQLA 1OXJA 4MFAA 3KTQA 3PW5A 5L1JA 8ICPA 1HEKA 5J2KA 8ICRA 1N62A 4QZ9A 1ZQRA 5BOMA 1S97A 5DQIA 2BZFA 4FS1A 1N56A 5ALNA 2K4EA 3AU6A 1QSLA 2OH2A 5J2DA 4O3OA 3WK5A 1UA1A 3C5FA 4Y2TA 1JUDA 2HBKA 4LJXA 3Q8RB 3RBDA 4ECUA 4RPXA 2UVWA 4DEZA 3WK4A 1RYUA 1EXNA 1V38A 4JUZA 3SAGA 4YMOA 3UXPA 3MC1A 5KFVA 2OHFA 1BPZA 2JR5A 3IM1A 3UMGA 2KOBA 5KT4A 2AJQA 3N7RC 1RPLA 4QZEA 3H0LB 5KFSA 9ICXA 3M8SA 1FEZA 4YMMA 3J81j 8ICFA 2W8LA 5IIJA 5DQHA 5CWRA 3ISCA 4A8EA 3KHLA 4HYKA 4NLGA 2ZIVA 3K1ZA 2ZIUB 8ICOA 4IQUA 3H0RB 1SV0A 1TKDA 3N7SC 3NRWA 4YXJA 4DSEA 5KNIA 4DLGA 4C4RA 9ICEA 2HBMA 2BKEA 4O3NA 4IL6U 3GDXA 4R64A 1J2MA 4IR1A 3BQ7A 3AMZA 4PGYA 3EW9A 2A1AA 2Q4TA 4BX9C 4DSLA 3LYSA 4KLJA 9ICBA 4RUAA 5H2FU 4QIWC 1J2NA 1WG8A 2IHMA 2KP7A 4CE6A 1NK5A 2KHVA 4YD1A 5AM2A 1X9WA 4UB4A 3RRGA 4EBCA 3LK9A 3UQ2A 1DXSA 3HJEA 2K4HA 4QW9A 4G9BA 2M0NA 5J2GA 4BXOB 4GLXA 1S9FA 4PPXA 4ELVA 3TARA 5KTQA 1JROA 7ICEA 2VJ4A 3QZ7A 5AI6A 5DG9A 4ECVA 5AICA 4P2HA 2WAQC 2BCSA 8ICCA 1ZQTA 4B9UA 2DFLA 4IRCA 2HVHA 1X9MA 3M9OB 3TKAA 2VA2A 1CI4A 4DL3A 2BDPA 4Y2XA 4P0QB 5EWEA 3KBBA 7ICFA 1N5XA 5ALQA 3PSTA 1JXLA 4Y2PA 1QQ5A 2KZ3A 5DB6A 8ICJA 4RQ7A 1U4BA 3IG8A 2WF8A 7ICKA 2LBOA 1SXEA 3B0YA 4KITB 1UHUA 4DFDA 1N61A 2FI1A 3JPPA 2IBKA 9ICKA 4UQGA 3NRZA 4ED1A 2BPGA 5JRTA 4CF3A 2NO5A 1ZQVA 3TI0A 2MAXA 3ED5A 2ZIXB 5ALKA 1MN8A 1Z00A 5HMMA 1NJYA 4PL2A 4OJLA 2PFNA 5J2EA 2BCQA 2W7OA 4QZIA 4ECRA 1B4FA 3GQCA 2E5SA 3H8MA 4DSFA 3ICXA 5B5EU 5KFHA 3UPQA 1PK1A 5IILA 1S0MA 3V7JA 4DQQA 2R18A 1QLNA 3G6VA 4DFPA 4I2GA 3NUQA 1S77D 1ZQIA 1KFTA 2XGPA 5DDYA 2FE9A 2ODGA 4NM2A 3VCBA 4BXOA 3KD3A 1SWWA 4XRHA 2DPIA 1S0NA 2ZJ8A 3KZXA 3CYMA 4C80A 1Y88A 3RR7A 4K4GA 1NK6A 3QU7A 2XCAA 4RQ4A 4B9SA 5AM1A 4J9KA 1LV5A 3BZKA 3U26A 8ICUA 5AIBA 5KFGA 4IQVA 1S0OA 5AM0A 1PK3A 3OHBA 1X40A 4FZLA 4RPYA 8ICQA 4I2IA 3UM9A 3QYPA 1BGXT 1LVHA 3EUB2 3M7DA 1UT8A 4M6WA 2C2DA 1P7DA 3M8RA 3F5AA 3EWAA 2W55A 4KLEA 1Z4NA 2MA1A 1B22A 2ES6A 3Q8SB 7ICTA 4EBDA 3BS5A 3OSNA 1FFVA 3FM9A 1PUZA 2FJ6A 4I2DA 1NKCA 3Q8QB 1SIJA 3I28A 3NVVA 3PMLA 4J9PA 4NLBA 5ALSA 1ZQLA 4IQWA 3BQTA 5AM5A 4F3OA 4RQ0A 5KFKA 1ZYQA 3PMNA 2KSOB 3HWTA 3SV3A 4TQRA 4Q44A 3Q8LA 4DL7A 1D9DA 2XIDA 3WU2U 1NJZA 3G6YA 2C2RA 4F5NA 5ALXA 4TUPA 3ZDBA 2FDRA 1A77A 4KMUA 1B0XA 2YQEA 4RQMA 5EWFA 5KFZA 3KOOA 2A3VA 3H4DA 4KN4A 3LVVA 1NK8A 3GU3A 1IXRA 4CCHA 2QB0B 3O0FA 4Y2YA 5J0WA 2XY6A 2P6UA 1COOA 4B9TA 2HHSA 2W9MA 3B0XA 1ED1A 2YMPA 2W9CA 1ZQUA 2KKPA 3V6JA 5KL1B 1K1QA 2F76X 7ICPA 1ZQBA 5AKXA 2DKZA 1MC8A 2LKYA 2W9BA 4UB6U 2Y0SF 4F72A 1F5SA 4Y2JA 2EZYA 5A0LA 5KFYA 1JIHA 5AKZA 3MR3A 8ICMA 2E1FA 2HHXA 3RR8A 2YN4A 3RJJA 2W9BB 2JRZA 5KAIU 4NJ8A 4O3RA 2W11A 2PI4A 3C28A 5KT6A 2P35A 1DRGA 4UATA 1GO3F 2B21A 4XQ8A 4RZRA 3F2CA 3BQ2A 5CA7A 3KHHA 4LZDA 4DL5A 5EOZA 2LI6A 2J6UA 2XVTA 7ICSA 8ICTA 2DGZA 1D8BA 4M6WB 3M9NB 4OCZA 1KEJA 1KBUA 3RJIA 3LVWA 5J0UA 2ZIXA 4C0ZA 4EYHB 4DS5A 3FAHA 4AP9A 5DQGA 3SI8A 5GTIU 3GV5B 4F50A 4KLHA 3FDSA 4YQWA 2BPFA 3M6KA 4PHAA 4RNOA 2H3VA 4GXJA 1L3UA 9ICSA 4B9VA 1TE2A 9ICNA 1NKEA 4Q8EA 4Q8FA 3CNHA 4UAYA 5F9NA 4ECQA 5KG6A 4PJ0U 4F91B 2LYHA 1KFSA 1SL0A 3HX0A 1ZQDA 4KLUA 2ISPA 2JZBA 4XUSA 2JEFA 4CRXA 1KDHA 1UA0A 4EBEA 3AUOA 3I76A 5J0PA 1PVRA 1TAUA 1A6SA 2W54A 2K8BB 3ZDAA 1B43A 1U47A 3IN5A 3EZ5A 2JEIA 1TVAA 4TQSA 4UAUA 3QUTA 3RFAA 1X2IA 4I29A 3RTVA 3RH4A 1LKYB 5KFMA 2JEGA 3CRXA 1AROP 2K4PA 4DQRA 4QZAA 1XS9D 2I9GA 4M9JA 4K4HA 3M9MB 5KFOA 2KK0A 1ZD3A 3K75D 5JU5A 4KLLA 4GIBA 3PVXA 2XO7A 3AU2A 2LYBA 1X9XA 2DQNB 2BQ3A 9ICHA 4F5OA 4NLZA 4J9MA 7ICQA 1ZQSA 4AYBC 4M9GA 2F44A 5J2AA 1JXEA 5AKGA 2AQ4A 4UB1A 3E2EA 1BPBA 3IRUA 1SWVA 2FPKA 4MF2A 5HHIA 4JV1A 4IRDA 3T5KA 5DDMA 4M9NA 2NRZA 2ZIWA 1S10A 5E79U 1ZQWA 2AU0A 2BGWA 1HJPA 1KRPA 1ZQOA 4FZNA 4I2CA 2MUTA 5DBAA 4B9NA 1NJWA 5HNKA 7ICRA 4RQ1A 2YMMA 5KFXA 1PVPA 1SZPA 1NNLA 2ZUBA 3NTUA 2EQYA 3RJHA 3WKEA 2C28A 2HMXA 1SXDA 2G5IB 5KFWA 2Y1JA 2V4RA 3A0BU 5AK5A 4ECSA 8ICHA 4EELA 1N60A 3T79A 3AL0B 3V7KA 9ICFA 5F3XB 5IIMA 3S6JA 5B66U 1NZPA 1WCLA 1C7YA 4QWDA 5J2IA 4R63A 4EEKA 4DFKA 3E0FA 4GXKA 3M6ZA 3IDWA 3C5GA 7ICHA 5L1KA 3TQ1A 3PX0A 3MFHA 2DBYA 1O03A 2W9CB 3NVZA 4NWIA 8ICAA 5J2HA 3D2NA 4F92B 4P0PA 8ICLA 4MEYA 2KN7A 2PI5A 4TUSA 1VDVA 2G08A 1QCKA 3Q8MA 4O5KA 1WUDA 2DF4B 4CGZA 3DV9A 1JALA 2K8AA 5D46A 4ECZA 2BCRA 8ICEA 5KFQA 2FMSA 1Q3VA 4C7YA 5KFNA 5G5GA 2FLPA 2UVRA 3HKZC 1MQ2A 3L5KA 4UBBA 3A0HU 1U48A 4FZMA 3SV4A 2PMZF 5AK6A 2HOIA 2KG5A 9ICIA 2JMGA 2KTQA 1L7PA 1Z1VA 5ALYA 1SKRA 2IOFA 1S5LU 5ALJA 3JPSA 2QARB 1YT3A 1KL9A 5TZVA 2C22A 2WAQF 1ZQAA 2ASLA 4O9MA 2NRWA 4UB8U 3HILA 1QSSA 3PR4A 5L1LA 1Q8KA 1JN3A 2ZIWB 9ICGA 1ZQGA 5HR7A 3F2BA 3ZDCA 2RLTA 2G09A 1UPHA 1TK8A 4JV2A 5D49A 8ICZA 3QU4A 1C20A 4Y2QA 1JI7A 4BGDA 3RB0A 2W7PA 4BWMA 3MDCA 3ONNA 1QQ6A 3GV7B 1PVQA 1ZQCA 5FP0A 5KG2A 2LHTA 2I1QA 8ICXA 1BPEA 2KHQA 4PHEA 2D6FC 3PO5A 1M6YA 2NRVA 3HP6A 4QZCA 7ICJA 3QUCA 2I5HA 5KFBA 5KFIA 1ZQ1C 1WYGA 4PH5A 4YP3A 2ISOA 3RJGA 5KT5A 1KQQA 4O5CA 3QE9Y 4R65A 3SENA 2P6RA 7ICNA 3MR5A 2I6XA 3ORYA 1ZXIA 3MR6A 1RYSA 3GZFA 2EH9A 4PL1A 2HDOA 3N97B 3TACB 4NY8A 4F4XA 3N4MB 4FE3A 3H7IA 3JPNA 1BNOA 4FS2A 4KX5A 1OW5A 1AQ6A 3C23A 3V6HA 3SQIA 4DSKA 4P0QA 3QEBZ 1T3NA 2VIXA 4DQSA 5J2FA 2K89A 5JTIA 2E8MA 1IIPA 2ESEA 3ISBA 3UQ0A 2B0CA 2XY5A 4UB3A 1SL1A 2YX8A 4RU9A 2XY7A 4DL2A 8ICNA 2E8NA 3OJUA 1N2XA 2F3NA 5KFTA 2K60A 2Y1IA 4US8A 9ICTA 4IC9A 3T5JA 4Z6FA 2L5YA 2V4QA 3C2LA 2KZZA 1SL2A 5KFEA 3Q8PB 1F44A 4C7ZA 4KTQA 4P0PB 3KHRA 2BCUA 2F2AB 4EZ6A 1RZTA 1SV0C 2YMLA 3V6KA 5J2JA 5DGAA 3UXOA 4NM1A 4Y2VA 3H8SA 5G5HA 1DK3A 4I2HA 3KFUF 3HRDD 5ALLA 1NI3A 4RT3A 4I2JA 2K4IA 2LPEA 4GC7A 4DSIA 1XSNA 3N7PD 4Q45A 1LB2B 4J9RA 2F1HA 2RQ5A 1ZD5A 5L1IA 2VA3A 4USAA 1WWVA 5ALHA 2Y9UA 4US9A 4ZH4A 4IS7A 4EX6A 1IM4A 4O3QA 1F0MA 1LKYA 2H5XA 2J6TA 5ALDA 2WHEA 4FFDA 5BOLA 4EYIB 4P4OA 4B6JA 4Y2SA 3MFIA 4ECTA 1BVSA 4CNQA 1PZNA 1RM6C 2KD1A 3MGIA 4RPZA 3IP4B 9ICMA 3BDPA 1TAMA 5J0TA 2BQRA 4M9LA 4C8MA 5F9LA 3RH6A 2Y0SC 4I2EA 9ICJA 5KFJA 2EANA 4BUGA 5J0RA 4DL4A 2ZXHA 5L1MA 4YCXA 2ZTCA 2ZUCA 3PV8A 5AKIA 3LWMA 3GIIA 2V9WA 5ALMA 2WFAA 1ZQFA 4NL9A 3MR2A 2ZIUA 4MF8A 3TFSA 3ZD8A 8ICWA 1KFDA 2AXTU 3CW2C 3SYZA 5T14A 3HW8A 2XICA 3NS1A 4KLMA 1ZQZA 2C2EA 1TK0A 4RQ3A 5CP2A 4MFCA 1RDFA 2JXJA 4NL9C 2B6GA 1N63A 2OEHA 2GWSA 2ZJ5A 2YB4A 2PFPA 4DQIA 4UARA 1QSYA 2VKQA 1HUZA 3BQ1A 1XSPA 2A1JA 2MRLA 4DL6A 1XSLA 3K1RB 3WKAA 4J9LA 4UB5A 4UBCA 2F8LA 9ICCA 5AHXA 7ICIA 7ICVA 2R8IA 3UMCA 5AM3A 3TFRA 3N28A 5AKLA 4ELUA 1JMSA 1U9LA 4ED2A 5CR0A 4OJ5A 1NJXA 2AGQA 2G5HB 3C29A 2KJ8A 1S0VA 2PFQA 2KMDA 5DG8A 3BQ0A 1NZBA 2HHWA 2ZUDA 2MU2A 2F77X 5AI0A 8ICYA 2GOLA 3WK6A 1Q3UA 1TK5A 1ZQJA 2IOHA 2XI9A 4KMOB 1TV9A 2KSOA 3RRHA 2IA6A 4C8NA 1SV4A 5AKEA 2E8PA 2ATLA 5ALRA 1URJA 3IG5A 4RQ2A 4IQTA 4Z6EA 1T3QA 5ALIA 3CP8A 1Z3EB 3TAQA 1Z1BA 2IOFK 2KJ9A 2NYVA 5DLGA 4OJPA 2NV3A 5KG5A 3KZIU 3QZ8A 1ZRMA 4G3IA 1ZQEA 3C1ZA 4F71A 3KHGA 4ICAA 4DLEA 4OJOA 2RHFA 5KFFA 4KLIA 3WK8A 3I1YA 2KKVA 4C4TA 4O0IA 2IHNA 1T4GA 2QARA 1A76A 1KW4A 4RQ5A 4DWIA 2ZJAA 1X66A 1L3VA 4RNNA 2W03A 3MBYA 4QWBA 3GIJA 3PX4A 1SGGA 3HKZF 4PHPA 1IG6A 5EE0A 1KLNA 5ALVA 5KFRA 4I2BA 4PHDA 3JPTA 5CEHA 5KG7A 2HHTA 3V7LA 1L3TA 1S8OA 2Q0ZX 5AKJA 5J2CA 1T8EA 1DK2A 1ZQXA 5CB1A 5C0YA 3BS7A 5AI8A 2DL0A 1J97A 3WK7A 9ICWA 2RDJA 2YTUA 3QU2A 2FLNA 5J8YC 4AYBF 3IHQB 3GV8B 2FMQA 4P4MA 4QJFB 3PW0A 3SD7A 5EE3A 1CRXA 1JRPA 4QW8A 4M0AA 4DS4A 2H3QA 2QKQA 4J9SA 5J8YA 3OJSA 2DKXA 4LZGA 2CPRA 3TANA 4FBTA 4KLTA 2FLLA 1S76D 2VA8A 1MQ3A 4OJ6A 1ZRNA 3F53A 4ECWA 4KLDA 9ICAA 4ECYA 5KFAA 3H8WA 5C5JA 2RRDA 5J2BA 3PNCA 9ICPA 5KAFU 4R8UB 7ICUA 4O3SA 2HW3A 4WJ3B 2KVSA
chains in the Genus database with same CATH topology
2G5IB 3PSFA 3SAGA 3PSTA 2KKPA 4ICAA 4OJOA 2RHFA 5KL1B 2KEYA 2HOQA 2ZIWB 2F76X 2WB1C 3AQFA 4ACOA 3VC8A 4JMUA 2KOBA 3F2BA 3T79A 2ZIUA 3D2QA 2KKVA 4CRXA 2LKYA 5HR7A 3N7RC 4IC9A 2KVCA 1PVRA 3D2SA 2G09A 2Y0SF 1A6SA 3AQEA 1UPHA 5T14A 3F5EA 2K8BB 3H0LB 2CRXA 2XICA 3IG8A 4NLCA 3AL0B 4FZLA 1ECWA 2LBOA 4BJQA 5A0LA 1F44A 4P0PB 2W03A 2F2AB 3IN5A 3E0FA 2H3ZA 3RFAA 2HBJA 2ZG6A 2KIWA 2W7PA 2RP5A 3M6ZA 3M7DA 2Z7JA 4A8EA 1P7DA 2E1FA 3ONNA 3KFUF 2ZIVA 3K1ZA 2ZIUB 3CRXA 2YB4A 3HKZF 3H0RB 3F5AA 1PVQA 2K4IA 2OYYA 3SAHA 3N7SC 3NRWA 2VKQA 2LHTA 1XNSA 4NWIA 2KHQA 3L3FX 2HBMA 2JGAA 2MA1A 1HIWA 2MRLA 3D2NA 5KL8B 4U6PA 2D6FC 2OM6A 3N7PD 2HOFA 4QNLA 4P0PA 2KNJA 4GFJA 1DRGA 2WB1F 2ZIXB 1T94A 2F8LA 3MGVA 1GO3F 2VJ5A 1ZQ1C 2OXOA 3F2CA 2G08A 2GH1A 2LYBA 5CRXA 3RF9A 4PL2A 2DQNB 4OJLA 1OUQA 2Q4TA 5HR6A 1WUDA 2LYAA 4BX9C 2DF4B 5C0YA 4CGZA 3ALRA 3LYSA 4OJ5A 2H3FA 2XVTA 1A0PA 2W7OA 2G5HB 3C29A 2DGZA 2KJ8A 4NLBA 4AYBC 2K8AA 4QIWC 3C28A 4O3MA 2JH7A 1D8BA 4KX3A 3PSPA 2E5SA 2KHVA 1Q3VA 2E1EA 3PSIA 3ICXA 2BDUA 3H0MB 1NZBA 1KBUA 2W04A 3LVWA 2F77X 4AYBF 2ZIXA 2GOLA 4C0ZA 1Q3UA 3GZFA 3HKZC 4PL1A 1SZHA 4QJFB 2XI9A 4KMOB 2K4HA 4FE3A 3SAFA 2KICA 3OPXA 2M0NA 2KD1A 2XIDA 4FZMA 1HEKA 2PMZF 2R18A 4KX5A 3IP4B 2N1RA 1CRXA 2HOIA 4OO1J 2JHDA 3NUQA 2H3QA 1L6NA 2JMGA 3M6KA 2ZIWA 1TAMA 3SQIA 1URJA 2KV2A 3IG5A 2CPRA 4P0QA 2VJ4A 3F2DA 2H3VA 4OJ6A 3F53A 4FZNA 2K4EA 2OH2A 2VIXA 2G06A 2A3VA 2K89A 2Y0SC 3LVVA 2WAQC 3CP8A 3SMVA 3VCBA 2H3IA 1XO0A 3PZPA 3GU3A 2JH1A 2HBKA 1Z19A 1IIPA 1PVPA 1Z1BA 2RRDA 2CN1A 3DEEA 1YT3A 2KJ5A 3O0FA 1MA7A 4NV0A 2KJ9A 2YB1A 2WAQF 3KZXA 4BUGA 2G07A 2K8CB 3CYMA 2ZXIA 4OJPA 2ZXHA 2G0AA 2NV3A 4U7CA 4CDGA 2HBLA 2HMXA 2YX8A 2PMZC 2ZIVB 4P0QB 4QIWF 1ED1A 4WJ3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TAM A;  4ICA A;  2H3V A;  2K4I A;  2K4E A;  4JMU A;  4IC9 A;  1HIW A;  2GOL A;  1A6S A;  1UPH A;  2H3I A;  1ECW A;  2K4H A;  2LYB A;  1HEK A;  2H3Z A;  2N1R A;  2NV3 A;  2HMX A;  2LYA A;  2H3Q A;  1L6N A;  2JMG A;  1ED1 A;  2H3F A; 
#chains in the Genus database with same CATH topology
 5CJ7 A;  4JK1 A;  5L9X A;  3MDA A;  2PXI A;  4NLN A;  5ALE A;  2EAP A;  4DOC A;  2KVC A;  5ALZ A;  4K4I A;  3AQE A;  5TIS U;  1KTQ A;  3EYZ A;  3PO4 A;  4LVS A;  4GXI A;  4KLO A;  2E3T A;  1V97 A;  4Y2U A;  5IIN A;  1YZ7 A;  4NLK A;  2W8K A;  5KG4 A;  3WKB A;  3BZC A;  3T3F A;  2JEJ A;  3SAH A;  2D8C A;  3L3F X;  2JGA A;  2R8K A;  1XC9 A;  4DF8 A;  4ECX A;  2WB1 F;  2EAO A;  5AI4 A;  8ICB A;  2JV3 A;  2HHV A;  4F5R A;  3PY8 A;  2F8K A;  1WWU A;  3QNM A;  2D3D A;  4MHV A;  4F4Z A;  1BPX A;  2WF7 A;  2ZTD A;  5J29 A;  3EPI A;  4KLG A;  4MEX A;  4RQ8 A;  1IV8 A;  4J9O A;  4PZO A;  3RB6 A;  3TAD A;  1NK0 A;  3C1Y A;  5HML A;  5KFU A;  5DBC A;  1XO1 A;  2PFO A;  1X42 A;  2BHN A;  1ZQP A;  3SMV A;  2H3I A;  2M9N A;  3SEI A;  1Z19 A;  5DG7 A;  4I2F A;  3THV A;  1ZJN A;  2LMR A;  4YXM A;  2YB1 A;  3QEA Z;  2ZXI A;  1SKW A;  2KZM A;  2JZB B;  2DUY A;  4I27 A;  2XCP A;  2F1I A;  5DB8 A;  3AQF A;  3F2D A;  4ACO A;  4EEN A;  3EPG A;  3D2S A;  1Z4O A;  2HHU A;  2VAN A;  1L5U A;  4NLC A;  2KFZ A;  4J9N A;  4MFF A;  9ICU A;  2ZG6 A;  1L7M A;  4ELT A;  5IIO A;  4UW9 A;  2W43 A;  2AHO B;  4Y2R A;  4YVZ A;  1NK9 A;  4IR9 A;  1U49 A;  3SR6 A;  2A19 A;  1HIW A;  5KL8 B;  1RG6 A;  3QU9 A;  4GFJ A;  4CF5 A;  5KFC A;  3QX7 A;  4UAV A;  1CUK A;  2VJ5 A;  4C8O A;  1BPY A;  3ZDE A;  3RF9 A;  2R8G A;  7ICO A;  4RUC A;  4PZN A;  2DPJ A;  4FBU A;  4O5E A;  3GIM A;  4RQ6 A;  3PR5 B;  3RAX A;  2YY6 A;  3WK9 A;  3H0M B;  4B9M A;  4RQN A;  1ZD4 A;  2QB0 A;  4DF4 A;  4DQP A;  1X6J A;  3K4G A;  5AK4 A;  1L7N A;  3GFK B;  2JHD A;  8ICK A;  2W9A A;  1L3S A;  4I2A A;  4BDP A;  3BJY A;  5AI5 A;  3NGD A;  5EE9 A;  3OHA A;  4R8U A;  3MGH A;  5AK3 A;  2KIV A;  2RDI A;  1ZD2 P;  2JH1 A;  2CN1 A;  3DEE A;  8ICI A;  5ALG A;  1D8Y A;  2K8C B;  8ICS A;  5HHH A;  1VLB A;  3R9K A;  5DB7 A;  7ICL A;  4O3P A;  5IIK A;  4QWC A;  3G6X A;  4JMU A;  3ISD A;  3ETR A;  3ZDD A;  4PGQ A;  1KSP A;  3ETL A;  2Y9T A;  5AKH A;  2MUT B;  5HP4 A;  3PW4 A;  3MAB A;  2ZTE A;  5K4L A;  3M1Y A;  1L8L A;  1L8O A;  1Q46 A;  4NXZ A;  5AI9 A;  2FPL A;  5AM4 A;  4KN7 A;  1H38 A;  4BWJ A;  5J0Y A;  1ZJM A;  2BCV A;  3TAP A;  1JX4 A;  1Z00 B;  2QLT A;  2AH5 A;  2OM6 A;  2KNJ A;  3IV6 A;  1OUQ A;  5J0Q A;  1KKX A;  3PW2 A;  2HHQ A;  1ZQN A;  2R8H A;  4O3M A;  4KX3 A;  2EDU A;  3PSI A;  4QZ8 A;  4F4Y A;  2OWO A;  1K1S A;  3H4B A;  3NVW A;  1KN5 A;  1ZQH A;  1U45 A;  5KG3 A;  1UT5 A;  3L4P A;  1SZH A;  4PGX A;  3SAF A;  2KIC A;  5ALU A;  2DWQ A;  2IMW P;  9ICQ A;  1L6N A;  2NO4 A;  4TUR A;  4DFM A;  4UAZ A;  2EAM A;  3C21 A;  4DFJ A;  4YMN A;  3H40 A;  1XO0 A;  3H8J A;  3JPR A;  3ZI4 A;  4UAS A;  5KFD A;  2HSZ A;  1PK1 B;  5D4B A;  2BQU A;  4UB2 A;  3QU5 A;  4CDG A;  1D9F A;  3RBE A;  2CXY A;  4YR0 A;  3C2K A;  3TAD C;  4F2S A;  3PSF A;  3NVY A;  3E58 A;  7ICM A;  4KLF A;  2KEY A;  2MSN A;  3D2Q A;  2AQ0 A;  4YR2 A;  4EZ9 A;  3RH5 A;  1ECW A;  1NK4 A;  4JWN A;  5DBB A;  4RNM A;  5J0S A;  5EE1 A;  3KKA C;  1V9P A;  4DOB A;  4FO6 A;  2HBJ A;  2RP5 A;  4J9Q A;  2Z7J A;  3AM9 A;  5AKK A;  5CHG A;  2WF5 A;  4YR3 A;  1BNP A;  4F93 B;  3WKC A;  2OYY A;  4QZG A;  1X6I A;  3D6J A;  4KLS A;  3KKA A;  1MSW D;  4F5Q A;  2OCE A;  1TFR A;  4F4W A;  4M2Y A;  4QZF A;  1T94 A;  1NOM A;  1SB3 C;  4F8R A;  2UVV A;  2A1J B;  5KFP A;  9ICV A;  5GTH U;  3RJF A;  4I28 A;  2LYA A;  2EZZ A;  1WCN A;  4P4P A;  4ED8 A;  2PKE A;  2JH7 A;  2HI0 A;  5KG1 A;  2P66 A;  3RJE A;  2FPM A;  2W04 A;  1ZQQ A;  3GIL A;  5BPC A;  4ED0 A;  3HT3 A;  1COK A;  4ED3 A;  3UXN A;  1XU4 A;  1RXV A;  4QWA A;  2N1R A;  3QUB A;  5ALF A;  4Z6C A;  1D8L A;  1QQ7 A;  4YFK A;  3ZD9 A;  2NRX A;  5DKW A;  3RJK A;  4UAW A;  2G06 A;  8ICV A;  5ALP A;  1N5W A;  3NAS A;  4EEY A;  2KJ5 A;  4NV0 A;  3PX6 A;  4E0D A;  4EX7 A;  4ED6 A;  2G07 A;  7ICG A;  1CEZ A;  3LWL A;  2G0A A;  3WKD A;  2ZIV B;  2PMZ C;  5JUM A;  3JPQ A;  5KT3 A;  4QIW F;  1RQN A;  4YN4 A;  2BR0 A;  3RAQ A;  1K5O A;  2WB1 C;  2UVU A;  4M9H A;  4RT2 A;  3T5H A;  9ICR A;  5DLF A;  3UMB A;  2LM1 A;  1YZ6 A;  2LM4 A;  4JB3 A;  2R8J A;  1NKB A;  4GC6 A;  1UQV A;  4DSJ A;  1XWL A;  2H3Z A;  4ZOH C;  1DGS A;  5III A;  3T5L A;  2XGQ A;  5J0O A;  3RB3 A;  1HUO A;  1XNS A;  1RYR A;  1SKS A;  4C4S A;  2HCF A;  4U6P A;  2HOF A;  1ZET A;  1VJ5 A;  2FMP A;  3MGV A;  2OXO A;  4Z6D A;  2GH1 A;  3SZ2 A;  2YMQ A;  5KFL A;  4J03 A;  3ALR A;  3PW7 A;  2H3F A;  2GLE A;  3OTQ A;  3GIK A;  1T7P A;  4XA5 A;  2ASD A;  4C8K A;  3OSP A;  2ALZ A;  3AEV A;  2WF9 A;  5ALW A;  4IRK A;  4OD0 A;  3QUQ A;  3JPO A;  1L7O A;  3C2M A;  4F2R A;  1QH9 A;  1FO4 A;  5ALT A;  4DOA A;  3OPX A;  3DDH A;  1X9S A;  4OO1 J;  5ALO A;  4X5V A;  2QB1 A;  4B9L A;  4YG2 A;  2KV2 A;  1QTM A;  4YD2 A;  4HAI A;  4QWE A;  5DGB A;  1O08 A;  1TAQ A;  2W3S A;  2F1J A;  5AIA A;  1N48 A;  2WTF A;  2XC9 A;  5KG0 A;  5KT7 A;  4JV0 A;  4CF4 A;  2AGP A;  1ZOL A;  4KLQ A;  1ZQY A;  3PZP A;  1NK7 A;  5DB9 A;  2E8O A;  2BPC A;  1MA7 A;  3OGU A;  1FFU A;  2NRT A;  4U7C A;  2HBL A;  2KFN A;  4TUQ A;  3FC4 A;  4QZH A;  2HOQ A;  4R66 A;  3VC8 A;  9ICO A;  3FYH A;  2ASJ A;  1FIQ A;  2CRX A;  8ICG A;  3F5E A;  3BS5 B;  5KT2 A;  4QZB A;  4BJQ A;  3HPO A;  2KIW A;  5EWG A;  3Q8K A;  5J0X A;  4DO9 A;  1V85 A;  1DOQ A;  9ICL A;  1BPD A;  3QXG A;  2WF6 A;  4DCC A;  3LDA A;  2GO7 A;  2KE7 A;  4QNL A;  2AGO A;  4M47 A;  1RXW A;  5CRX A;  3RB4 A;  5HR6 A;  5AKY A;  1ZQK A;  4F4K A;  4QZD A;  1A0P A;  1UCV A;  3B9J A;  3PSP A;  1DGJ A;  1ZQM A;  4JWM A;  4M04 A;  2EZX A;  2W3R A;  4Q43 A;  2J6S A;  4F5P A;  2E1E A;  4C8L A;  3V72 A;  2BDU A;  4ED7 A;  2O6K A;  2HVI A;  3AN1 A;  1RQL A;  1OXJ A;  4MFA A;  3KTQ A;  3PW5 A;  5L1J A;  8ICP A;  1HEK A;  5J2K A;  8ICR A;  1N62 A;  4QZ9 A;  1ZQR A;  5BOM A;  1S97 A;  5DQI A;  2BZF A;  4FS1 A;  1N56 A;  5ALN A;  2K4E A;  3AU6 A;  1QSL A;  2OH2 A;  5J2D A;  4O3O A;  3WK5 A;  1UA1 A;  3C5F A;  4Y2T A;  1JUD A;  2HBK A;  4LJX A;  3Q8R B;  3RBD A;  4ECU A;  4RPX A;  2UVW A;  4DEZ A;  3WK4 A;  1RYU A;  1EXN A;  1V38 A;  4JUZ A;  3SAG A;  4YMO A;  3UXP A;  3MC1 A;  5KFV A;  2OHF A;  1BPZ A;  2JR5 A;  3IM1 A;  3UMG A;  2KOB A;  5KT4 A;  2AJQ A;  3N7R C;  1RPL A;  4QZE A;  3H0L B;  5KFS A;  9ICX A;  3M8S A;  1FEZ A;  4YMM A;  3J81 j;  8ICF A;  2W8L A;  5IIJ A;  5DQH A;  5CWR A;  3ISC A;  4A8E A;  3KHL A;  4HYK A;  4NLG A;  2ZIV A;  3K1Z A;  2ZIU B;  8ICO A;  4IQU A;  3H0R B;  1SV0 A;  1TKD A;  3N7S C;  3NRW A;  4YXJ A;  4DSE A;  5KNI A;  4DLG A;  4C4R A;  9ICE A;  2HBM A;  2BKE A;  4O3N A;  4IL6 U;  3GDX A;  4R64 A;  1J2M A;  4IR1 A;  3BQ7 A;  3AMZ A;  4PGY A;  3EW9 A;  2A1A A;  2Q4T A;  4BX9 C;  4DSL A;  3LYS A;  4KLJ A;  9ICB A;  4RUA A;  5H2F U;  4QIW C;  1J2N A;  1WG8 A;  2IHM A;  2KP7 A;  4CE6 A;  1NK5 A;  2KHV A;  4YD1 A;  5AM2 A;  1X9W A;  4UB4 A;  3RRG A;  4EBC A;  3LK9 A;  3UQ2 A;  1DXS A;  3HJE A;  2K4H A;  4QW9 A;  4G9B A;  2M0N A;  5J2G A;  4BXO B;  4GLX A;  1S9F A;  4PPX A;  4ELV A;  3TAR A;  5KTQ A;  1JRO A;  7ICE A;  2VJ4 A;  3QZ7 A;  5AI6 A;  5DG9 A;  4ECV A;  5AIC A;  4P2H A;  2WAQ C;  2BCS A;  8ICC A;  1ZQT A;  4B9U A;  2DFL A;  4IRC A;  2HVH A;  1X9M A;  3M9O B;  3TKA A;  2VA2 A;  1CI4 A;  4DL3 A;  2BDP A;  4Y2X A;  4P0Q B;  5EWE A;  3KBB A;  7ICF A;  1N5X A;  5ALQ A;  3PST A;  1JXL A;  4Y2P A;  1QQ5 A;  2KZ3 A;  5DB6 A;  8ICJ A;  4RQ7 A;  1U4B A;  3IG8 A;  2WF8 A;  7ICK A;  2LBO A;  1SXE A;  3B0Y A;  4KIT B;  1UHU A;  4DFD A;  1N61 A;  2FI1 A;  3JPP A;  2IBK A;  9ICK A;  4UQG A;  3NRZ A;  4ED1 A;  2BPG A;  5JRT A;  4CF3 A;  2NO5 A;  1ZQV A;  3TI0 A;  2MAX A;  3ED5 A;  2ZIX B;  5ALK A;  1MN8 A;  1Z00 A;  5HMM A;  1NJY A;  4PL2 A;  4OJL A;  2PFN A;  5J2E A;  2BCQ A;  2W7O A;  4QZI A;  4ECR A;  1B4F A;  3GQC A;  2E5S A;  3H8M A;  4DSF A;  3ICX A;  5B5E U;  5KFH A;  3UPQ A;  1PK1 A;  5IIL A;  1S0M A;  3V7J A;  4DQQ A;  2R18 A;  1QLN A;  3G6V A;  4DFP A;  4I2G A;  3NUQ A;  1S77 D;  1ZQI A;  1KFT A;  2XGP A;  5DDY A;  2FE9 A;  2ODG A;  4NM2 A;  3VCB A;  4BXO A;  3KD3 A;  1SWW A;  4XRH A;  2DPI A;  1S0N A;  2ZJ8 A;  3KZX A;  3CYM A;  4C80 A;  1Y88 A;  3RR7 A;  4K4G A;  1NK6 A;  3QU7 A;  2XCA A;  4RQ4 A;  4B9S A;  5AM1 A;  4J9K A;  1LV5 A;  3BZK A;  3U26 A;  8ICU A;  5AIB A;  5KFG A;  4IQV A;  1S0O A;  5AM0 A;  1PK3 A;  3OHB A;  1X40 A;  4FZL A;  4RPY A;  8ICQ A;  4I2I A;  3UM9 A;  3QYP A;  1BGX T;  1LVH A;  3EUB 2;  3M7D A;  1UT8 A;  4M6W A;  2C2D A;  1P7D A;  3M8R A;  3F5A A;  3EWA A;  2W55 A;  4KLE A;  1Z4N A;  2MA1 A;  1B22 A;  2ES6 A;  3Q8S B;  7ICT A;  4EBD A;  3BS5 A;  3OSN A;  1FFV A;  3FM9 A;  1PUZ A;  2FJ6 A;  4I2D A;  1NKC A;  3Q8Q B;  1SIJ A;  3I28 A;  3NVV A;  3PML A;  4J9P A;  4NLB A;  5ALS A;  1ZQL A;  4IQW A;  3BQT A;  5AM5 A;  4F3O A;  4RQ0 A;  5KFK A;  1ZYQ A;  3PMN A;  2KSO B;  3HWT A;  3SV3 A;  4TQR A;  4Q44 A;  3Q8L A;  4DL7 A;  1D9D A;  2XID A;  3WU2 U;  1NJZ A;  3G6Y A;  2C2R A;  4F5N A;  5ALX A;  4TUP A;  3ZDB A;  2FDR A;  1A77 A;  4KMU A;  1B0X A;  2YQE A;  4RQM A;  5EWF A;  5KFZ A;  3KOO A;  2A3V A;  3H4D A;  4KN4 A;  3LVV A;  1NK8 A;  3GU3 A;  1IXR A;  4CCH A;  2QB0 B;  3O0F A;  4Y2Y A;  5J0W A;  2XY6 A;  2P6U A;  1COO A;  4B9T A;  2HHS A;  2W9M A;  3B0X A;  1ED1 A;  2YMP A;  2W9C A;  1ZQU A;  2KKP A;  3V6J A;  5KL1 B;  1K1Q A;  2F76 X;  7ICP A;  1ZQB A;  5AKX A;  2DKZ A;  1MC8 A;  2LKY A;  2W9B A;  4UB6 U;  2Y0S F;  4F72 A;  1F5S A;  4Y2J A;  2EZY A;  5A0L A;  5KFY A;  1JIH A;  5AKZ A;  3MR3 A;  8ICM A;  2E1F A;  2HHX A;  3RR8 A;  2YN4 A;  3RJJ A;  2W9B B;  2JRZ A;  5KAI U;  4NJ8 A;  4O3R A;  2W11 A;  2PI4 A;  3C28 A;  5KT6 A;  2P35 A;  1DRG A;  4UAT A;  1GO3 F;  2B21 A;  4XQ8 A;  4RZR A;  3F2C A;  3BQ2 A;  5CA7 A;  3KHH A;  4LZD A;  4DL5 A;  5EOZ A;  2LI6 A;  2J6U A;  2XVT A;  7ICS A;  8ICT A;  2DGZ A;  1D8B A;  4M6W B;  3M9N B;  4OCZ A;  1KEJ A;  1KBU A;  3RJI A;  3LVW A;  5J0U A;  2ZIX A;  4C0Z A;  4EYH B;  4DS5 A;  3FAH A;  4AP9 A;  5DQG A;  3SI8 A;  5GTI U;  3GV5 B;  4F50 A;  4KLH A;  3FDS A;  4YQW A;  2BPF A;  3M6K A;  4PHA A;  4RNO A;  2H3V A;  4GXJ A;  1L3U A;  9ICS A;  4B9V A;  1TE2 A;  9ICN A;  1NKE A;  4Q8E A;  4Q8F A;  3CNH A;  4UAY A;  5F9N A;  4ECQ A;  5KG6 A;  4PJ0 U;  4F91 B;  2LYH A;  1KFS A;  1SL0 A;  3HX0 A;  1ZQD A;  4KLU A;  2ISP A;  2JZB A;  4XUS A;  2JEF A;  4CRX A;  1KDH A;  1UA0 A;  4EBE A;  3AUO A;  3I76 A;  5J0P A;  1PVR A;  1TAU A;  1A6S A;  2W54 A;  2K8B B;  3ZDA A;  1B43 A;  1U47 A;  3IN5 A;  3EZ5 A;  2JEI A;  1TVA A;  4TQS A;  4UAU A;  3QUT A;  3RFA A;  1X2I A;  4I29 A;  3RTV A;  3RH4 A;  1LKY B;  5KFM A;  2JEG A;  3CRX A;  1ARO P;  2K4P A;  4DQR A;  4QZA A;  1XS9 D;  2I9G A;  4M9J A;  4K4H A;  3M9M B;  5KFO A;  2KK0 A;  1ZD3 A;  3K75 D;  5JU5 A;  4KLL A;  4GIB A;  3PVX A;  2XO7 A;  3AU2 A;  2LYB A;  1X9X A;  2DQN B;  2BQ3 A;  9ICH A;  4F5O A;  4NLZ A;  4J9M A;  7ICQ A;  1ZQS A;  4AYB C;  4M9G A;  2F44 A;  5J2A A;  1JXE A;  5AKG A;  2AQ4 A;  4UB1 A;  3E2E A;  1BPB A;  3IRU A;  1SWV A;  2FPK A;  4MF2 A;  5HHI A;  4JV1 A;  4IRD A;  3T5K A;  5DDM A;  4M9N A;  2NRZ A;  2ZIW A;  1S10 A;  5E79 U;  1ZQW A;  2AU0 A;  2BGW A;  1HJP A;  1KRP A;  1ZQO A;  4FZN A;  4I2C A;  2MUT A;  5DBA A;  4B9N A;  1NJW A;  5HNK A;  7ICR A;  4RQ1 A;  2YMM A;  5KFX A;  1PVP A;  1SZP A;  1NNL A;  2ZUB A;  3NTU A;  2EQY A;  3RJH A;  3WKE A;  2C28 A;  2HMX A;  1SXD A;  2G5I B;  5KFW A;  2Y1J A;  2V4R A;  3A0B U;  5AK5 A;  4ECS A;  8ICH A;  4EEL A;  1N60 A;  3T79 A;  3AL0 B;  3V7K A;  9ICF A;  5F3X B;  5IIM A;  3S6J A;  5B66 U;  1NZP A;  1WCL A;  1C7Y A;  4QWD A;  5J2I A;  4R63 A;  4EEK A;  4DFK A;  3E0F A;  4GXK A;  3M6Z A;  3IDW A;  3C5G A;  7ICH A;  5L1K A;  3TQ1 A;  3PX0 A;  3MFH A;  2DBY A;  1O03 A;  2W9C B;  3NVZ A;  4NWI A;  8ICA A;  5J2H A;  3D2N A;  4F92 B;  4P0P A;  8ICL A;  4MEY A;  2KN7 A;  2PI5 A;  4TUS A;  1VDV A;  2G08 A;  1QCK A;  3Q8M A;  4O5K A;  1WUD A;  2DF4 B;  4CGZ A;  3DV9 A;  1JAL A;  2K8A A;  5D46 A;  4ECZ A;  2BCR A;  8ICE A;  5KFQ A;  2FMS A;  1Q3V A;  4C7Y A;  5KFN A;  5G5G A;  2FLP A;  2UVR A;  3HKZ C;  1MQ2 A;  3L5K A;  4UBB A;  3A0H U;  1U48 A;  4FZM A;  3SV4 A;  2PMZ F;  5AK6 A;  2HOI A;  2KG5 A;  9ICI A;  2JMG A;  2KTQ A;  1L7P A;  1Z1V A;  5ALY A;  1SKR A;  2IOF A;  1S5L U;  5ALJ A;  3JPS A;  2QAR B;  1YT3 A;  1KL9 A;  5TZV A;  2C22 A;  2WAQ F;  1ZQA A;  2ASL A;  4O9M A;  2NRW A;  4UB8 U;  3HIL A;  1QSS A;  3PR4 A;  5L1L A;  1Q8K A;  1JN3 A;  2ZIW B;  9ICG A;  1ZQG A;  5HR7 A;  3F2B A;  3ZDC A;  2RLT A;  2G09 A;  1UPH A;  1TK8 A;  4JV2 A;  5D49 A;  8ICZ A;  3QU4 A;  1C20 A;  4Y2Q A;  1JI7 A;  4BGD A;  3RB0 A;  2W7P A;  4BWM A;  3MDC A;  3ONN A;  1QQ6 A;  3GV7 B;  1PVQ A;  1ZQC A;  5FP0 A;  5KG2 A;  2LHT A;  2I1Q A;  8ICX A;  1BPE A;  2KHQ A;  4PHE A;  2D6F C;  3PO5 A;  1M6Y A;  2NRV A;  3HP6 A;  4QZC A;  7ICJ A;  3QUC A;  2I5H A;  5KFB A;  5KFI A;  1ZQ1 C;  1WYG A;  4PH5 A;  4YP3 A;  2ISO A;  3RJG A;  5KT5 A;  1KQQ A;  4O5C A;  3QE9 Y;  4R65 A;  3SEN A;  2P6R A;  7ICN A;  3MR5 A;  2I6X A;  3ORY A;  1ZXI A;  3MR6 A;  1RYS A;  3GZF A;  2EH9 A;  4PL1 A;  2HDO A;  3N97 B;  3TAC B;  4NY8 A;  4F4X A;  3N4M B;  4FE3 A;  3H7I A;  3JPN A;  1BNO A;  4FS2 A;  4KX5 A;  1OW5 A;  1AQ6 A;  3C23 A;  3V6H A;  3SQI A;  4DSK A;  4P0Q A;  3QEB Z;  1T3N A;  2VIX A;  4DQS A;  5J2F A;  2K89 A;  5JTI A;  2E8M A;  1IIP A;  2ESE A;  3ISB A;  3UQ0 A;  2B0C A;  2XY5 A;  4UB3 A;  1SL1 A;  2YX8 A;  4RU9 A;  2XY7 A;  4DL2 A;  8ICN A;  2E8N A;  3OJU A;  1N2X A;  2F3N A;  5KFT A;  2K60 A;  2Y1I A;  4US8 A;  9ICT A;  4IC9 A;  3T5J A;  4Z6F A;  2L5Y A;  2V4Q A;  3C2L A;  2KZZ A;  1SL2 A;  5KFE A;  3Q8P B;  1F44 A;  4C7Z A;  4KTQ A;  4P0P B;  3KHR A;  2BCU A;  2F2A B;  4EZ6 A;  1RZT A;  1SV0 C;  2YML A;  3V6K A;  5J2J A;  5DGA A;  3UXO A;  4NM1 A;  4Y2V A;  3H8S A;  5G5H A;  1DK3 A;  4I2H A;  3KFU F;  3HRD D;  5ALL A;  1NI3 A;  4RT3 A;  4I2J A;  2K4I A;  2LPE A;  4GC7 A;  4DSI A;  1XSN A;  3N7P D;  4Q45 A;  1LB2 B;  4J9R A;  2F1H A;  2RQ5 A;  1ZD5 A;  5L1I A;  2VA3 A;  4USA A;  1WWV A;  5ALH A;  2Y9U A;  4US9 A;  4ZH4 A;  4IS7 A;  4EX6 A;  1IM4 A;  4O3Q A;  1F0M A;  1LKY A;  2H5X A;  2J6T A;  5ALD A;  2WHE A;  4FFD A;  5BOL A;  4EYI B;  4P4O A;  4B6J A;  4Y2S A;  3MFI A;  4ECT A;  1BVS A;  4CNQ A;  1PZN A;  1RM6 C;  2KD1 A;  3MGI A;  4RPZ A;  3IP4 B;  9ICM A;  3BDP A;  1TAM A;  5J0T A;  2BQR A;  4M9L A;  4C8M A;  5F9L A;  3RH6 A;  2Y0S C;  4I2E A;  9ICJ A;  5KFJ A;  2EAN A;  4BUG A;  5J0R A;  4DL4 A;  2ZXH A;  5L1M A;  4YCX A;  2ZTC A;  2ZUC A;  3PV8 A;  5AKI A;  3LWM A;  3GII A;  2V9W A;  5ALM A;  2WFA A;  1ZQF A;  4NL9 A;  3MR2 A;  2ZIU A;  4MF8 A;  3TFS A;  3ZD8 A;  8ICW A;  1KFD A;  2AXT U;  3CW2 C;  3SYZ A;  5T14 A;  3HW8 A;  2XIC A;  3NS1 A;  4KLM A;  1ZQZ A;  2C2E A;  1TK0 A;  4RQ3 A;  5CP2 A;  4MFC A;  1RDF A;  2JXJ A;  4NL9 C;  2B6G A;  1N63 A;  2OEH A;  2GWS A;  2ZJ5 A;  2YB4 A;  2PFP A;  4DQI A;  4UAR A;  1QSY A;  2VKQ A;  1HUZ A;  3BQ1 A;  1XSP A;  2A1J A;  2MRL A;  4DL6 A;  1XSL A;  3K1R B;  3WKA A;  4J9L A;  4UB5 A;  4UBC A;  2F8L A;  9ICC A;  5AHX A;  7ICI A;  7ICV A;  2R8I A;  3UMC A;  5AM3 A;  3TFR A;  3N28 A;  5AKL A;  4ELU A;  1JMS A;  1U9L A;  4ED2 A;  5CR0 A;  4OJ5 A;  1NJX A;  2AGQ A;  2G5H B;  3C29 A;  2KJ8 A;  1S0V A;  2PFQ A;  2KMD A;  5DG8 A;  3BQ0 A;  1NZB A;  2HHW A;  2ZUD A;  2MU2 A;  2F77 X;  5AI0 A;  8ICY A;  2GOL A;  3WK6 A;  1Q3U A;  1TK5 A;  1ZQJ A;  2IOH A;  2XI9 A;  4KMO B;  1TV9 A;  2KSO A;  3RRH A;  2IA6 A;  4C8N A;  1SV4 A;  5AKE A;  2E8P A;  2ATL A;  5ALR A;  1URJ A;  3IG5 A;  4RQ2 A;  4IQT A;  4Z6E A;  1T3Q A;  5ALI A;  3CP8 A;  1Z3E B;  3TAQ A;  1Z1B A;  2IOF K;  2KJ9 A;  2NYV A;  5DLG A;  4OJP A;  2NV3 A;  5KG5 A;  3KZI U;  3QZ8 A;  1ZRM A;  4G3I A;  1ZQE A;  3C1Z A;  4F71 A;  3KHG A;  4ICA A;  4DLE A;  4OJO A;  2RHF A;  5KFF A;  4KLI A;  3WK8 A;  3I1Y A;  2KKV A;  4C4T A;  4O0I A;  2IHN A;  1T4G A;  2QAR A;  1A76 A;  1KW4 A;  4RQ5 A;  4DWI A;  2ZJA A;  1X66 A;  1L3V A;  4RNN A;  2W03 A;  3MBY A;  4QWB A;  3GIJ A;  3PX4 A;  1SGG A;  3HKZ F;  4PHP A;  1IG6 A;  5EE0 A;  1KLN A;  5ALV A;  5KFR A;  4I2B A;  4PHD A;  3JPT A;  5CEH A;  5KG7 A;  2HHT A;  3V7L A;  1L3T A;  1S8O A;  2Q0Z X;  5AKJ A;  5J2C A;  1T8E A;  1DK2 A;  1ZQX A;  5CB1 A;  5C0Y A;  3BS7 A;  5AI8 A;  2DL0 A;  1J97 A;  3WK7 A;  9ICW A;  2RDJ A;  2YTU A;  3QU2 A;  2FLN A;  5J8Y C;  4AYB F;  3IHQ B;  3GV8 B;  2FMQ A;  4P4M A;  4QJF B;  3PW0 A;  3SD7 A;  5EE3 A;  1CRX A;  1JRP A;  4QW8 A;  4M0A A;  4DS4 A;  2H3Q A;  2QKQ A;  4J9S A;  5J8Y A;  3OJS A;  2DKX A;  4LZG A;  2CPR A;  3TAN A;  4FBT A;  4KLT A;  2FLL A;  1S76 D;  2VA8 A;  1MQ3 A;  4OJ6 A;  1ZRN A;  3F53 A;  4ECW A;  4KLD A;  9ICA A;  4ECY A;  5KFA A;  3H8W A;  5C5J A;  2RRD A;  5J2B A;  3PNC A;  9ICP A;  5KAF U;  4R8U B;  7ICU A;  4O3S A;  2HW3 A;  4WJ3 B;  2KVS A; 
#chains in the Genus database with same CATH homology
 2G5I B;  3PSF A;  3SAG A;  3PST A;  2KKP A;  4ICA A;  4OJO A;  2RHF A;  5KL1 B;  2KEY A;  2HOQ A;  2ZIW B;  2F76 X;  2WB1 C;  3AQF A;  4ACO A;  3VC8 A;  4JMU A;  2KOB A;  3F2B A;  3T79 A;  2ZIU A;  3D2Q A;  2KKV A;  4CRX A;  2LKY A;  5HR7 A;  3N7R C;  4IC9 A;  2KVC A;  1PVR A;  3D2S A;  2G09 A;  2Y0S F;  1A6S A;  3AQE A;  1UPH A;  5T14 A;  3F5E A;  2K8B B;  3H0L B;  2CRX A;  2XIC A;  3IG8 A;  4NLC A;  3AL0 B;  4FZL A;  1ECW A;  2LBO A;  4BJQ A;  5A0L A;  1F44 A;  4P0P B;  2W03 A;  2F2A B;  3IN5 A;  3E0F A;  2H3Z A;  3RFA A;  2HBJ A;  2ZG6 A;  2KIW A;  2W7P A;  2RP5 A;  3M6Z A;  3M7D A;  2Z7J A;  4A8E A;  1P7D A;  2E1F A;  3ONN A;  3KFU F;  2ZIV A;  3K1Z A;  2ZIU B;  3CRX A;  2YB4 A;  3HKZ F;  3H0R B;  3F5A A;  1PVQ A;  2K4I A;  2OYY A;  3SAH A;  3N7S C;  3NRW A;  2VKQ A;  2LHT A;  1XNS A;  4NWI A;  2KHQ A;  3L3F X;  2HBM A;  2JGA A;  2MA1 A;  1HIW A;  2MRL A;  3D2N A;  5KL8 B;  4U6P A;  2D6F C;  2OM6 A;  3N7P D;  2HOF A;  4QNL A;  4P0P A;  2KNJ A;  4GFJ A;  1DRG A;  2WB1 F;  2ZIX B;  1T94 A;  2F8L A;  3MGV A;  1GO3 F;  2VJ5 A;  1ZQ1 C;  2OXO A;  3F2C A;  2G08 A;  2GH1 A;  2LYB A;  5CRX A;  3RF9 A;  4PL2 A;  2DQN B;  4OJL A;  1OUQ A;  2Q4T A;  5HR6 A;  1WUD A;  2LYA A;  4BX9 C;  2DF4 B;  5C0Y A;  4CGZ A;  3ALR A;  3LYS A;  4OJ5 A;  2H3F A;  2XVT A;  1A0P A;  2W7O A;  2G5H B;  3C29 A;  2DGZ A;  2KJ8 A;  4NLB A;  4AYB C;  2K8A A;  4QIW C;  3C28 A;  4O3M A;  2JH7 A;  1D8B A;  4KX3 A;  3PSP A;  2E5S A;  2KHV A;  1Q3V A;  2E1E A;  3PSI A;  3ICX A;  2BDU A;  3H0M B;  1NZB A;  1KBU A;  2W04 A;  3LVW A;  2F77 X;  4AYB F;  2ZIX A;  2GOL A;  4C0Z A;  1Q3U A;  3GZF A;  3HKZ C;  4PL1 A;  1SZH A;  4QJF B;  2XI9 A;  4KMO B;  2K4H A;  4FE3 A;  3SAF A;  2KIC A;  3OPX A;  2M0N A;  2KD1 A;  2XID A;  4FZM A;  1HEK A;  2PMZ F;  2R18 A;  4KX5 A;  3IP4 B;  2N1R A;  1CRX A;  2HOI A;  4OO1 J;  2JHD A;  3NUQ A;  2H3Q A;  1L6N A;  2JMG A;  3M6K A;  2ZIW A;  1TAM A;  3SQI A;  1URJ A;  2KV2 A;  3IG5 A;  2CPR A;  4P0Q A;  2VJ4 A;  3F2D A;  2H3V A;  4OJ6 A;  3F53 A;  4FZN A;  2K4E A;  2OH2 A;  2VIX A;  2G06 A;  2A3V A;  2K89 A;  2Y0S C;  3LVV A;  2WAQ C;  3CP8 A;  3SMV A;  3VCB A;  2H3I A;  1XO0 A;  3PZP A;  3GU3 A;  2JH1 A;  2HBK A;  1Z19 A;  1IIP A;  1PVP A;  1Z1B A;  2RRD A;  2CN1 A;  3DEE A;  1YT3 A;  2KJ5 A;  3O0F A;  1MA7 A;  4NV0 A;  2KJ9 A;  2YB1 A;  2WAQ F;  3KZX A;  4BUG A;  2G07 A;  2K8C B;  3CYM A;  2ZXI A;  4OJP A;  2ZXH A;  2G0A A;  2NV3 A;  4U7C A;  4CDG A;  2HBL A;  2HMX A;  2YX8 A;  2PMZ C;  2ZIV B;  4P0Q B;  4QIW F;  1ED1 A;  4WJ3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...