2LYAA

Structure of hiv-1 myr(-) matrix protein in complex with 1,2-dioctanoyl-sn-phosphatidylcholine
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
131
Chain Sequence
b'GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein p17
publication title Trio engagement via plasma membrane phospholipids and the myristoyl moiety governs HIV-1 matrix binding to bilayers.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 36
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lyaA00
4ICAA 1ECWA 2LYAA 2K4IA 2H3IA 1L6NA 1TAMA 2LYBA 4IC9A 2N1RA 2K4EA 1HIWA 1A6SA 2HMXA 2H3FA 1UPHA 2K4HA 2GOLA 2JMGA 2H3QA 2H3VA 1HEKA 2H3ZA 1ED1A 2NV3A 4JMUA
chains in the Genus database with same CATH superfamily
1P7DA 5AKXA 1C20A 3TARA 1Z3EB 3B0YA 1RPLA 3RJEA 4AYBF 3GIJA 5KFPA 4J03A 4F93B 5KFLA 2JEFA 1A0PA 4EELA 2HHUA 1DK3A 1ZQTA 2QKQA 1SKRA 1L7PA 1JUDA 4J9LA 3CP8A 2XY7A 1BPXA 1NI3A 3AU6A 4ECSA 4M2YA 2KICA 3TANA 5KFKA 1NKEA 2YB1A 5CP2A 2FPKA 4FBTA 3TADA 1D8BA 3ETRA 2PFQA 4NLBA 2E5SA 1J2MA 2ZTDA 2KP7A 5F3XB 4YXJA 4DL5A 5ALZA 5JRTA 2EZXA 4NLGA 3TFSA 3JPOA 9ICJA 1WCLA 4DFJA 4FZLA 3M7DA 3UQ2A 1PK1B 1DOQA 2WHEA 4TURA 2M9NA 5ALSA 5AK6A 4ED2A 4DL4A 1NNLA 4QNLA 3SEIA 2OM6A 4I2BA 4UB8U 5KT3A 2P35A 4PL2A 2RRDA 2NRWA 4C80A 1KFSA 3C1ZA 3G6VA 3UQ0A 1IV8A 1V9PA 1NJZA 1X66A 3PO4A 3QNMA 1TK0A 1SL2A 2BR0A 2RP5A 4KLHA 1RDFA 2LMRA 1JXLA 2OCEA 3K1RB 1UQVA 4B6JA 4QJFB 2ZUCA 2WF5A 3UMGA 4RT3A 7ICOA 2JZBA 3ZDDA 4ICAA 1QSLA 1ZQNA 3RTVA 5EE0A 2BGWA 2NRZA 4EX6A 5HNKA 2BPFA 3MGVA 2C2EA 3MR2A 4FZMA 4GIBA 4LJXA 4F91B 1S97A 2MU2A 3AEVA 2J6TA 4ED3A 4Q45A 4F4XA 1A76A 8ICAA 4PHEA 9ICXA 1PVQA 4C8LA 2MA1A 1Y88A 3BQTA 4J9OA 2W3RA 4Y2JA 4YCXA 4QZGA 3RFAA 5KFDA 2E1EA 8ICHA 2ZIWA 2NO4A 1BNPA 5TISU 2F1JA 2C2RA 1UA1A 1UPHA 5DQHA 2HHVA 4UASA 1LB2B 4R65A 5ALUA 3QU7A 2ZJAA 5ALOA 2QB0B 3ETLA 8ICRA 4FFDA 3HT3A 8ICXA 3PNCA 4DWIA 4PHDA 8ICPA 5AI8A 4J9NA 4EBCA 4M9GA 2K4EA 9ICWA 2XIDA 9ICRA 2LM4A 5HHIA 5IIMA 1ZQZA 3QU9A 2AU0A 3BQ7A 3QUTA 2YMQA 4IRDA 2ZUBA 4O3QA 4JV1A 2YTUA 3BDPA 4EENA 3BJYA 1ZYQA 5KFTA 1RYRA 1COOA 4HAIA 4RPXA 5KFNA 5CRXA 4KLEA 4ECUA 1S0NA 1BPYA 4O9MA 3L4PA 2W3SA 3KZXA 4PJ0U 4YD1A 2XGQA 3RAQA 2ZUDA 4TUPA 1KRPA 4R8UA 4XQ8A 4I2IA 4ECQA 5EE9A 1N61A 3F5AA 5AIBA 4C8OA 8ICMA 1BPBA 1DGSA 1Z4OA 3NUQA 2KHVA 4DS5A 3N4MB 4IRCA 4YG2A 4F72A 4ELTA 3I1YA 4UAWA 2I1QA 2C2DA 3RJHA 7ICNA 3KOOA 3NASA 9ICQA 1UA0A 2PXIA 1TV9A 2ZIWB 7ICFA 4Q8EA 2XI9A 2C22A 1VLBA 3C1YA 7ICLA 5DBCA 4ECYA 4ECWA 5GTHU 3B0XA 4J9SA 4OO1J 2UVUA 1PVRA 4MHVA 4FBUA 4B9MA 4QZEA 3SQIA 2LPEA 3JPSA 3JPTA 1KEJA 2K4HA 5ALRA 1SV0A 1AQ6A 2G09A 5KFJA 2ALZA 4KLQA 3QU4A 1S76D 3TADC 8ICLA 8ICWA 1S8OA 3F2CA 4I2AA 2NYVA 4DOBA 4UAUA 1U47A 2PMZF 2ZG6A 1HIWA 2FPLA 4GXJA 2G08A 1A6SA 2GWSA 3V7LA 4CNQA 3OHAA 3TACB 3H8SA 5DG9A 3AUOA 8ICSA 7ICRA 1Q3VA 3PMNA 3RR8A 4QZAA 3SI8A 1WUDA 4XUSA 1TAQA 1IXRA 3LK9A 5L1IA 2BDUA 1MQ2A 4BWJA 7ICVA 1JN3A 2RLTA 4NLZA 3V6JA 4M0AA 4IC9A 2LKYA 5ALFA 3PSFA 4BXOA 1KDHA 9ICSA 1IG6A 4YN4A 4R64A 9ICGA 2HHQA 1QH9A 4CE6A 4C4SA 5ALXA 3H40A 7ICJA 2FMPA 2DPIA 2EZYA 3QUCA 4M9NA 4GFJA 1JX4A 4K4IA 5H2FU 4F5OA 1JMSA 5GTIU 3GV7B 2D3DA 1QSSA 3VCBA 3T5KA 1NJYA 3IN5A 3OTQA 4DQQA 3RJFA 1ZD2P 3H4DA 2KN7A 1PUZA 4Z6DA 2P6UA 4MEXA 1L7NA 4UARA 3RB3A 5D46A 5KFIA 1EXNA 4KLGA 3OPXA 1BPZA 4RU9A 3WK5A 3TFRA 3WK9A 3GV8B 4IQUA 2K8AA 4YR2A 4DFKA 5HR7A 5L1MA 5EE3A 5DB9A 1XNSA 1T94A 4NV0A 5IIKA 4NXZA 4KLIA 1JI7A 3IDWA 4XRHA 4O3SA 4DSLA 1FFUA 4KLMA 1LKYA 2HHSA 4E0DA 4Q43A 1KL9A 2ESEA 1ZQWA 5AI6A 5EWEA 2L5YA 1DRGA 4F50A 3PW4A 9ICNA 3WKBA 4BXOB 1SKWA 8ICIA 1WG8A 1WCNA 4RQ6A 3WKEA 3F53A 4P4OA 4GXKA 3HPOA 1COKA 4C8KA 4QWEA 2AJQA 4ZH4A 5ALIA 5KFXA 1SKSA 1NZBA 3JPPA 3NVWA 3PMLA 3MGHA 2HI0A 7ICSA 5AKYA 4B9LA 4UB3A 5ALEA 5KFSA 3ALRA 4G9BA 1BGXT 2GH1A 3SENA 3EYZA 3SZ2A 3KHLA 2BQ3A 2IMWP 7ICIA 4KLDA 5J29A 2V4RA 4B9NA 1V97A 2VJ4A 2BCUA 2W04A 4DO9A 4UQGA 4J9MA 3PO5A 1RXVA 2H3FA 2W11A 4ECRA 4YMNA 2YX8A 9ICIA 2BHNA 5ALTA 4USAA 1NKCA 4QZHA 4MF8A 3MABA 4I2EA 2DUYA 1BPDA 2IOFA 4IQTA 3T5JA 2KG5A 5DDMA 1LKYB 2FMSA 2LM1A 3NVVA 4P2HA 2MRLA 3D6JA 5AKJA 2CRXA 3T5HA 5B66U 7ICEA 2XY5A 9ICKA 1CI4A 3ZDCA 3QZ8A 5DG8A 1TK8A 4KLOA 2B6GA 1Z00A 5DB8A 4G3IA 2ASJA 4ECTA 9ICCA 4B9TA 1X9MA 5IILA 5J0XA 5CB1A 2G5HB 3ZDAA 4DSKA 3GV5B 2V4QA 4EBEA 1ZD4A 3QU5A 3LDAA 4A8EA 5G5HA 4DL2A 4Y2UA 4FO6A 3QYPA 2UVWA 5J0SA 2KZ3A 1L3UA 4TUQA 3C2LA 5ALLA 2C28A 4QWDA 4UATA 2WF6A 2AXTU 2ZIUA 2VA8A 8ICNA 3H4BA 8ICOA 4RQ4A 1S10A 1KFTA 4J9RA 1ZRMA 3HJEA 1NK6A 2NV3A 3D2QA 1S0OA 1Z1BA 3GDXA 1URJA 1XSPA 4QZ9A 2LYBA 4QZIA 3M8RA 2HBMA 2KZMA 3HILA 3MDAA 1CUKA 4RPYA 3HX0A 1MQ3A 2AHOB 5EOZA 4RQMA 5D4BA 3RJJA 4CDGA 9ICBA 1RQLA 3CW2C 3E0FA 4KMOB 5AK4A 8ICEA 2W8KA 2XVTA 1QLNA 1X6IA 4F3OA 4I28A 1Z00B 2HVHA 2CPRA 2BPGA 1RG6A 3ZD8A 3GQCA 3C5GA 1ZQRA 1V85A 2VA2A 9ICFA 4JV0A 1KKXA 3RJIA 2Y1IA 3Q8RB 2WB1F 1RZTA 1HUOA 2ZIUB 3CYMA 1CRXA 4RUAA 2F76X 1YZ7A 5CR0A 4BUGA 2FPMA 4RPZA 5AK5A 3FYHA 1B22A 3KTQA 4YR0A 3RBEA 3F2DA 3Q8LA 4ELUA 4KLFA 4PGXA 1V38A 2QB0A 2UVVA 4PHAA 3FDSA 3C28A 3A0BU 1F5SA 1ZQQA 4I2DA 3EPGA 9ICVA 4JMUA 3QXGA 5ALDA 5J2AA 1NJXA 3JPQA 4B9VA 4LVSA 1NK4A 4QIWC 4PL1A 2KVSA 2HHWA 4NJ8A 2WAQF 2HOIA 4KLLA 3NTUA 3DEEA 7ICQA 3NGDA 1J2NA 5DGBA 1T7PA 1ED1A 5AKEA 5KFOA 2JXJA 3OJUA 4KN7A 2OHFA 3UXPA 4ED8A 3PV8A 2G0AA 2Z7JA 1N2XA 2E8PA 4DOAA 3HWTA 2KMDA 3UPQA 2ASDA 2Y0SF 3E2EA 1BNOA 2Q4TA 2KVCA 2A1AA 5DB7A 4UBCA 3AL0B 4MF2A 5HP4A 2M0NA 3BQ1A 5J0WA 1ZJMA 3H7IA 2G06A 1KW4A 3QEAZ 5BOMA 5ALWA 1AROP 1RYUA 1T4GA 5J2FA 3ZDBA 3RB6A 1ZQBA 4TUSA 4YQWA 3K1ZA 2W54A 3UXNA 5F9NA 1MSWD 4RQ0A 3DDHA 1X9SA 2DFLA 4DS4A 3NRWA 1UHUA 5IIIA 4DEZA 4O3NA 2YB4A 4JWNA 4JB3A 4OD0A 2V9WA 3BS5B 2YMPA 1Q46A 5KAIU 1IM4A 4NL9C 4DF8A 1RM6C 3UM9A 4GXIA 4Z6EA 4GC7A 5B5EU 4ZOHC 5DBAA 4I2FA 2KIVA 5KFWA 4F8RA 2HBLA 2KJ9A 7ICKA 3F5EA 2ISOA 9ICUA 4R66A 1NKBA 4F2SA 4O3MA 2I9GA 2IHNA 2JGAA 5KG5A 5TZVA 3OJSA 4F5PA 1KLNA 3C21A 3T3FA 1ZQAA 3AQEA 2KFZA 4EZ6A 4I2CA 1JROA 1ZOLA 5DKWA 5AI9A 3OHBA 3EZ5A 5AKKA 3HP6A 4O5CA 2A3VA 3C2KA 1ZD3A 5JU5A 3MR5A 1O03A 2YMLA 4DOCA 4BJQA 3AU2A 3NRZA 1S0VA 5ALQA 3KD3A 4J9KA 3SAHA 1OXJA 2PI4A 2EQYA 5DQIA 4F4KA 3C23A 3H8JA 4RUCA 1TE2A 5KFYA 3M9OB 2WF7A 2ZXIA 3Q8PB 4UAZA 7ICHA 2K8BB 3Q8QB 2W9AA 1S5LU 4P4PA 5J2IA 3SAGA 2ASLA 1ZQFA 2IOHA 3O0FA 1FIQA 1ZQYA 3C29A 3MFIA 3D2SA 3BZCA 2FLLA 5DG7A 2NRTA 4O3OA 4O5KA 2BKEA 2HBKA 5J0QA 3MDCA 3SV4A 4LZGA 2LBOA 5KT4A 3M8SA 4RQNA 1CEZA 3LYSA 1ZQGA 7ICMA 5DBBA 3N97B 5KFEA 1Q3UA 4F71A 2E1FA 2AGOA 5E79U 2AGPA 8ICBA 3OSNA 4IQWA 2KE7A 4ED6A 1U48A 5L1KA 1SZPA 5F9LA 5KG7A 4UAVA 4QIWF 1L5UA 3IM1A 2W43A 4C8NA 1ZQXA 4DL3A 5J2KA 3QUQA 4EBDA 8ICQA 1WYGA 5KG1A 5KT2A 3PR4A 5CEHA 1DGJA 3LVVA 4RQ8A 1TFRA 4U7CA 5ALGA 4NM1A 2OYYA 3AMZA 2XGPA 3TQ1A 1NJWA 5JTIA 1D8LA 3FM9A 5CHGA 4DQIA 1QQ6A 3ISBA 2XCPA 4MFAA 4MFFA 4MEYA 5J0UA 2YMMA 4YMOA 1ZQSA 2RDIA 1KQQA 2W9BA 1UT5A 4KX3A 5EE1A 2R8IA 2F8LA 1TAUA 2R8KA 4M6WA 3N7RC 1T8EA 2HBJA 5ALJA 2H3ZA 4O3RA 4FS1A 2VA3A 3UMCA 1ZQOA 3M9MB 2E3TA 3LWLA 4FS2A 1ZQLA 2VJ5A 3VC8A 1XWLA 3THVA 3JPRA 1YZ6A 2K60A 1QQ5A 2KKPA 2JHDA 3ISCA 3GIIA 2FE9A 2K89A 2F3NA 2W9CA 5KFUA 1NOMA 5ALYA 4K4HA 3AM9A 1NZPA 2J6UA 4ED7A 3R9KA 2KZZA 3EW9A 5JUMA 5AI0A 1U45A 2MAXA 4O5EA 4XA5A 1K5OA 4KLSA 1ZQEA 3MR3A 3RJKA 4AYBC 4QW8A 3H0LB 5AKLA 4ELVA 4J9PA 4EYHB 4QZDA 4C4TA 9ICMA 5CA7A 2NRXA 9ICAA 4JV2A 2JEGA 5J2GA 5ALKA 4OJ6A 4F92B 2QARB 1S9FA 2HMXA 3C5FA 1B4FA 4I2GA 3ZI4A 2G5IB 3PR5B 5AKIA 7ICGA 2W9BB 3QU2A 3JPNA 5BOLA 2F1IA 5J8YA 5J0RA 4M6WB 3TAQA 4F2RA 4IR9A 1JXEA 4PZNA 3NS1A 8ICKA 1O08A 4Y2QA 2EANA 4F5RA 2BPCA 5J0TA 5KFAA 2F2AB 5J0YA 4IR1A 4KN4A 2GLEA 2JV3A 2JR5A 4PZOA 2DL0A 4DSFA 2OEHA 3KHRA 1KTQA 3RF9A 1XU4A 3M1YA 1N60A 5KT7A 3QE9Y 4M9HA 2W9CB 1RYSA 5J2BA 2MSNA 2BCRA 3CRXA 1FO4A 3WK7A 1HUZA 2W7PA 2BCSA 2HCFA 4CF5A 2ZIVB 2JMGA 5AM5A 3RH5A 4O0IA 5HR6A 2A1JA 2KFNA 5A0LA 7ICUA 3V72A 4BDPA 2R8JA 5ALMA 4UBBA 2VANA 4DSJA 4JWMA 2HOQA 3WU2U 3RBDA 3IRUA 2EDUA 3FAHA 2CN1A 4Y2SA 2BQUA 2KKVA 1UT8A 3PSPA 1OUQA 3K4GA 3PW2A 1K1SA 3UMBA 1RXWA 1JALA 4NL9A 2OWOA 5AM3A 3RRHA 1NK7A 5J2CA 3PY8A 2QB1A 4F4WA 3OSPA 3TAPA 1L8OA 3V6HA 2PI5A 2UVRA 4DQRA 2HVIA 2NRVA 4Z6CA 2VIXA 1HEKA 2XCAA 1L8LA 4J9QA 2JEIA 1KSPA 2IHMA 1WWVA 2H5XA 3KHGA 3DV9A 4RQ1A 3GILA 3AN1A 2W8LA 9ICTA 3GIKA 3RH4A 4X5VA 5J2HA 3BQ2A 5CWRA 1RQNA 1ZQUA 3LVWA 2Q0ZX 5KFFA 3ZD9A 5ALNA 2W03A 2A1JB 2OH2A 2ES6A 4C7YA 4DLEA 2R8GA 5ALVA 4QZBA 1ZD5A 3RB4A 3Q8KA 1N63A 1ZRNA 2JRZA 3L5KA 3ICXA 1ZQKA 2KIWA 3HRDD 2DQNB 2MUTB 1QQ7A 1UCVA 4U6PA 3SD7A 2RHFA 3IHQB 2F8KA 2FLNA 1H38A 2KSOB 3QZ7A 4P0QB 2FDRA 5AKGA 1SL1A 1Z19A 1TVAA 1BVSA 1ZQHA 1Z1VA 2EH9A 3IV6A 5J2DA 4Y2VA 5IINA 2GO7A 3U26A 4DQSA 3NVYA 2FI1A 1T3QA 4DFDA 2WF8A 4IL6U 2W9MA 4R63A 5AHXA 3RAXA 5KG3A 4B9SA 3BS5A 1X9WA 4RQ5A 2JEJA 3ZDEA 5ALHA 1PVPA 2WFAA 3HKZC 3N7SC 1N56A 3QX7A 3MC1A 3G6XA 5J8YC 8ICFA 1HJPA 2ZIXA 3N28A 3TI0A 3IG5A 3EPIA 2BDPA 2EAMA 3KBBA 3WKAA 5L1JA 2PFOA 1NK0A 4DLGA 2PMZC 4C0ZA 3NVZA 1YT3A 4BWMA 4ED0A 3M9NB 4KMUA 5DLFA 1SXDA 4UB2A 2AH5A 5HHHA 3T79A 1M6YA 1ZQIA 4YFKA 1SXEA 8ICCA 5AM2A 4I27A 2XO7A 3KKAC 3KZIU 2DGZA 1JRPA 3QEBZ 1B43A 4IS7A 1MN8A 4BX9C 3BQ0A 2RDJA 5AK3A 1NK5A 1XO1A 1D9DA 1DK2A 2EZZA 2BCQA 5DQGA 4OJOA 1SB3C 3A0HU 3BZKA 4NWIA 3GIMA 1OW5A 8ICVA 3KFUF 4Q8FA 4GC6A 5AM4A 4FZNA 2K4IA 3H0RB 3Q8SB 3EWAA 3WK6A 5KG2A 4C8MA 2EAPA 2KNJA 2KTQA 2W55A 2CXYA 1ZQCA 1D9FA 1KFDA 4Y2PA 5J2EA 1X9XA 2K4PA 5DLGA 2HHTA 1GO3F 1FEZA 5KFHA 1X42A 8ICZA 3PX6A 2DKZA 8ICUA 2ZIXB 2VKQA 3AQFA 4OJLA 3PX4A 4RQ3A 2YQEA 1LVHA 1TAMA 2LI6A 2LYHA 1X6JA 5T14A 4QW9A 4OJ5A 5KL1B 7ICPA 1ZQMA 4Q44A 4RZRA 3EUB2 1K1QA 1XS9D 4DSIA 2G07A 2XICA 5AIAA 2HW3A 4Y2YA 5AI4A 3Q8MA 3J81j 1A77A 4DCCA 4PH5A 2JZBB 2I5HA 1XC9A 4B9UA 4YR3A 4FE3A 3N7PD 1TKDA 1D8YA 4M9LA 2DBYA 5C0YA 1N5WA 4PGYA 3WK8A 4O3PA 3SYZA 2F44A 3T5LA 3CNHA 4EEYA 3MGIA 3MBYA 3SR6A 4Y2RA 5J2JA 4I29A 4KTQA 3L3FX 3ISDA 4PGQA 2ZTEA 2AGQA 2N1RA 3V7JA 4DSEA 4RNNA 2DKXA 5J0OA 1F0MA 3RJGA 5KG6A 4UB6U 3WK4A 3SAFA 2KV2A 4UB4A 1L6NA 4UAYA 2QLTA 5IIOA 5KFRA 4P0PA 5KAFU 8ICJA 4M47A 2LHTA 4ED1A 1ZETA 2YY6A 1T3NA 3HKZF 2D6FC 4DL6A 5ALPA 4EX7A 3IP4B 4OCZA 4F5QA 3ONNA 1S77D 9ICEA 4KITB 3D2NA 5KFVA 2E8MA 1C7YA 3PVXA 1SWVA 5CJ7A 1L3VA 1J97A 2DF4B 3SV3A 4R8UB 3QUBA 4C7ZA 4NM2A 5EWFA 2IOFK 3WKCA 2QARA 2ZJ5A 4YXMA 1ZQJA 5AICA 1L7OA 4K4GA 4QZ8A 3H8MA 4QZFA 4YVZA 1ZQVA 2F1HA 5AM1A 1PZNA 2GOLA 5C5JA 4RT2A 4QWCA 4MFCA 5KFMA 5HMLA 4EZ9A 3RB0A 2HHXA 2PFPA 2DWQA 3GZFA 5AI5A 4CGZA 2KJ8A 4UW9A 2ATLA 3MFHA 2ODGA 5J0PA 2BCVA 2KD1A 4IQVA 4YD2A 2XY6A 3KHHA 4NLNA 3HW8A 3UXOA 1U49A 1SIJA 2KJ5A 3C2MA 2Y9TA 1U4BA 1SL0A 1B0XA 5KFQA 1ZJNA 4DL7A 5AKZA 4TQSA 4P0PB 1X40A 3PW5A 1N5XA 4NY8A 2K8CB 4I2JA 4PHPA 5KT6A 4RQ2A 5DB6A 1L7MA 2ZIVA 1L3SA 3PW7A 2ZXHA 5K4LA 7ICTA 2WF9A 1XO0A 1SGGA 5AM0A 8ICGA 9ICHA 4US9A 4CCHA 4F4YA 4M04A 3SMVA 2JH1A 1XSNA 1XSLA 2OXOA 3TKAA 5EWGA 1ECWA 1MC8A 1ZXIA 3H0MB 2YN4A 3PZPA 4KLJA 4P4MA 1L3TA 8ICTA 5KFCA 4F5NA 2KHQA 2HDOA 2I6XA 2F77X 2Y1JA 2HSZA 2PKEA 3V7KA 2R18A 4Y2XA 1Q8KA 3FC4A 3MR6A 2B0CA 1SV4A 1LV5A 2WB1C 4PPXA 2B21A 2W7OA 4GLXA 4IRKA 5KT5A 1WWUA 3OGUA 4DFMA 3ORYA 3E58A 5KL8B 4KX5A 5G5GA 2FMQA 2ZJ8A 5KFBA 4CRXA 5HMMA 2P66A 3H8WA 1FFVA 1QSYA 2AQ4A 2H3QA 3GFKB 5L1LA 2NO5A 3M6ZA 2XC9A 4US8A 1NK9A 3I28A 2RQ5A 2KOBA 1X2IA 1F44A 5DDYA 4C4RA 4CF4A 1TK5A 4F4ZA 1QTMA 3KKAA 2D8CA 3RR7A 1NK8A 1ZQ1C 5L9XA 4Y2TA 4RQ7A 5KG0A 3B9JA 4EYIB 4ECVA 3K75D 1PK3A 4M9JA 3PSTA 1S0MA 4OJPA 4UB5A 3LWMA 2WAQC 2ISPA 1N62A 1SZHA 5AKHA 2H3IA 2KEYA 1BPEA 2E8NA 3PSIA 2PFNA 3RH6A 4RNOA 1JIHA 4YMMA 2DPJA 1QCKA 4JK1A 3IG8A 2P6RA 9ICLA 2Y9UA 4UB1A 2BQRA 4BGDA 1U9LA 4QWBA 1IIPA 4QWAA 4QZCA 3F2BA 2MUTA 1DXSA 8ICYA 1SV0C 4DQPA 1MA7A 4JUZA 4TQRA 2KK0A 4RNMA 4AP9A 2LYAA 4DFPA 2Y0SC 3BS7A 2A19A 2O6KA 3RRGA 2ZTCA 1N48A 4CF3A 1VJ5A 3I76A 2AQ0A 2HOFA 5BPCA 4ACOA 2KSOA 5IIJA 2FJ6A 2JH7A 3PW0A 5DGAA 4P0QA 4LZDA 3S6JA 1SWWA 4ECXA 2EAOA 3M6KA 1KBUA 5KTQA 5KFGA 4WJ3B 2WTFA 3V6KA 2E8OA 3G6YA 4NLCA 2IBKA 4YP3A 2R8HA 3GU3A 4HYKA 4DF4A 3PX0A 1Z4NA 2H3VA 1VDVA 4NLKA 3ED5A 2J6SA 1PK1A 4KLUA 4KLTA 4I2HA 1ZQDA 9ICOA 5KNIA 9ICPA 5KG4A 2IA6A 5KFZA 4ECZA 1KN5A 3WKDA 2BZFA 4EEKA 4Z6FA 5FP0A 5D49A 1ZQPA 2FLPA
chains in the Genus database with same CATH topology
3D2QA 1P7DA 3SAFA 4P0QB 2KV2A 4GFJA 4ICAA 3KFUF 2WAQC 1Z1BA 4O3MA 4FZNA 1SZHA 1URJA 2K4IA 2H3IA 2VJ4A 3H0RB 4AYBF 2JGAA 2KEYA 2ZIVA 4PL1A 4QIWC 2ZXHA 2W04A 2LYBA 4OJ6A 3PSIA 3VCBA 3LVVA 2HBMA 1Z19A 4U7CA 3MGVA 4P0PA 1A0PA 2HMXA 2KNJA 2H3FA 4FZMA 3IN5A 2OYYA 2WAQF 1XO0A 2HOIA 3AQEA 2LHTA 3DEEA 2G5IB 2YX8A 3IG8A 3HKZF 2ZIWB 2D6FC 2VIXA 1HEKA 2XI9A 1IIPA 3CP8A 1GO3F 1ED1A 3SMVA 2JH1A 3IP4B 2OXOA 3OPXA 3F2BA 1PVQA 2ZIXB 2A3VA 2MA1A 2VKQA 3ONNA 4CDGA 2KICA 3AQFA 4OJLA 1ECWA 1MA7A 4OO1J 1PVRA 3E0FA 4KMOB 2YB1A 2LYAA 3RFAA 1PVPA 2Y0SC 2E1EA 2K8AA 1TAMA 3H0MB 5HR7A 3D2NA 2XVTA 3SQIA 3HKZC 2G0AA 2Z7JA 2ZIWA 3N7SC 2F2AB 1D8BA 4BJQA 3PZPA 2MRLA 1XNSA 1T94A 4NV0A 3SAHA 1UPHA 4KX3A 5T14A 2K4HA 2F8LA 2HOFA 4NLBA 2CPRA 2DF4B 2E5SA 4OJ5A 2CRXA 4ACOA 2Y0SF 5KL1B 2ZIXA 2G09A 2KHQA 2JH7A 2Q4TA 3IG5A 3N7RC 2KVCA 4P0QA 2F77X 2HBJA 2ZXIA 3AL0B 2K8BB 2H3ZA 2G07A 3RF9A 2PMZC 3LVWA 2M0NA 2R18A 4C0ZA 3F2CA 2XICA 3M6KA 2G06A 1YT3A 1KBUA 2WB1C 4WJ3B 2W7OA 2W03A 4FZLA 3SAGA 3M7DA 2VJ5A 3VC8A 3CRXA 3O0FA 2OH2A 3C29A 2PMZF 2ZG6A 2K4EA 1HIWA 4NLCA 2W7PA 4FE3A 3T79A 2XIDA 2G08A 4KX5A 5KL8B 1A6SA 3D2SA 2WB1F 3K1ZA 3N7PD 2KKPA 4CRXA 2ZIVB 2G5HB 2GOLA 1DRGA 5C0YA 2JMGA 3GU3A 2JHDA 3NRWA 2H3QA 2HBKA 2K89A 2H3VA 2ZIUB 3CYMA 4QNLA 1CRXA 1L6NA 2LBOA 2OM6A 1Q3VA 3LYSA 3M6ZA 4A8EA 5HR6A 2DGZA 2YB4A 2KOBA 2F76X 3GZFA 3ICXA 1Q3UA 1WUDA 4PL2A 3F53A 1F44A 4CGZA 2KIWA 2RRDA 2BDUA 5A0LA 2KJ8A 4BUGA 3L3FX 4BX9C 2DQNB 5CRXA 2E1FA 2KD1A 1NZBA 4IC9A 2N1RA 2HOQA 2LKYA 4U6PA 3KZXA 2ZIUA 3PSFA 3F2DA 2RHFA 2RP5A 1ZQ1C 2CN1A 2KJ5A 4QIWF 2KKVA 3F5AA 3ALRA 3PSPA 4OJOA 1OUQA 3C28A 2GH1A 4QJFB 4P0PB 4AYBC 3PSTA 2NV3A 4NWIA 2HBLA 3NUQA 4JMUA 2KJ9A 4OJPA 3F5EA 2KHVA 3H0LB 2K8CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ICA A;  1ECW A;  2LYA A;  2K4I A;  2H3I A;  1L6N A;  1TAM A;  2LYB A;  4IC9 A;  2N1R A;  2K4E A;  1HIW A;  1A6S A;  2HMX A;  2H3F A;  1UPH A;  2K4H A;  2GOL A;  2JMG A;  2H3Q A;  2H3V A;  1HEK A;  2H3Z A;  1ED1 A;  2NV3 A;  4JMU A; 
#chains in the Genus database with same CATH topology
 1P7D A;  5AKX A;  1C20 A;  3TAR A;  1Z3E B;  3B0Y A;  1RPL A;  3RJE A;  4AYB F;  3GIJ A;  5KFP A;  4J03 A;  4F93 B;  5KFL A;  2JEF A;  1A0P A;  4EEL A;  2HHU A;  1DK3 A;  1ZQT A;  2QKQ A;  1SKR A;  1L7P A;  1JUD A;  4J9L A;  3CP8 A;  2XY7 A;  1BPX A;  1NI3 A;  3AU6 A;  4ECS A;  4M2Y A;  2KIC A;  3TAN A;  5KFK A;  1NKE A;  2YB1 A;  5CP2 A;  2FPK A;  4FBT A;  3TAD A;  1D8B A;  3ETR A;  2PFQ A;  4NLB A;  2E5S A;  1J2M A;  2ZTD A;  2KP7 A;  5F3X B;  4YXJ A;  4DL5 A;  5ALZ A;  5JRT A;  2EZX A;  4NLG A;  3TFS A;  3JPO A;  9ICJ A;  1WCL A;  4DFJ A;  4FZL A;  3M7D A;  3UQ2 A;  1PK1 B;  1DOQ A;  2WHE A;  4TUR A;  2M9N A;  5ALS A;  5AK6 A;  4ED2 A;  4DL4 A;  1NNL A;  4QNL A;  3SEI A;  2OM6 A;  4I2B A;  4UB8 U;  5KT3 A;  2P35 A;  4PL2 A;  2RRD A;  2NRW A;  4C80 A;  1KFS A;  3C1Z A;  3G6V A;  3UQ0 A;  1IV8 A;  1V9P A;  1NJZ A;  1X66 A;  3PO4 A;  3QNM A;  1TK0 A;  1SL2 A;  2BR0 A;  2RP5 A;  4KLH A;  1RDF A;  2LMR A;  1JXL A;  2OCE A;  3K1R B;  1UQV A;  4B6J A;  4QJF B;  2ZUC A;  2WF5 A;  3UMG A;  4RT3 A;  7ICO A;  2JZB A;  3ZDD A;  4ICA A;  1QSL A;  1ZQN A;  3RTV A;  5EE0 A;  2BGW A;  2NRZ A;  4EX6 A;  5HNK A;  2BPF A;  3MGV A;  2C2E A;  3MR2 A;  4FZM A;  4GIB A;  4LJX A;  4F91 B;  1S97 A;  2MU2 A;  3AEV A;  2J6T A;  4ED3 A;  4Q45 A;  4F4X A;  1A76 A;  8ICA A;  4PHE A;  9ICX A;  1PVQ A;  4C8L A;  2MA1 A;  1Y88 A;  3BQT A;  4J9O A;  2W3R A;  4Y2J A;  4YCX A;  4QZG A;  3RFA A;  5KFD A;  2E1E A;  8ICH A;  2ZIW A;  2NO4 A;  1BNP A;  5TIS U;  2F1J A;  2C2R A;  1UA1 A;  1UPH A;  5DQH A;  2HHV A;  4UAS A;  1LB2 B;  4R65 A;  5ALU A;  3QU7 A;  2ZJA A;  5ALO A;  2QB0 B;  3ETL A;  8ICR A;  4FFD A;  3HT3 A;  8ICX A;  3PNC A;  4DWI A;  4PHD A;  8ICP A;  5AI8 A;  4J9N A;  4EBC A;  4M9G A;  2K4E A;  9ICW A;  2XID A;  9ICR A;  2LM4 A;  5HHI A;  5IIM A;  1ZQZ A;  3QU9 A;  2AU0 A;  3BQ7 A;  3QUT A;  2YMQ A;  4IRD A;  2ZUB A;  4O3Q A;  4JV1 A;  2YTU A;  3BDP A;  4EEN A;  3BJY A;  1ZYQ A;  5KFT A;  1RYR A;  1COO A;  4HAI A;  4RPX A;  5KFN A;  5CRX A;  4KLE A;  4ECU A;  1S0N A;  1BPY A;  4O9M A;  3L4P A;  2W3S A;  3KZX A;  4PJ0 U;  4YD1 A;  2XGQ A;  3RAQ A;  2ZUD A;  4TUP A;  1KRP A;  4R8U A;  4XQ8 A;  4I2I A;  4ECQ A;  5EE9 A;  1N61 A;  3F5A A;  5AIB A;  4C8O A;  8ICM A;  1BPB A;  1DGS A;  1Z4O A;  3NUQ A;  2KHV A;  4DS5 A;  3N4M B;  4IRC A;  4YG2 A;  4F72 A;  4ELT A;  3I1Y A;  4UAW A;  2I1Q A;  2C2D A;  3RJH A;  7ICN A;  3KOO A;  3NAS A;  9ICQ A;  1UA0 A;  2PXI A;  1TV9 A;  2ZIW B;  7ICF A;  4Q8E A;  2XI9 A;  2C22 A;  1VLB A;  3C1Y A;  7ICL A;  5DBC A;  4ECY A;  4ECW A;  5GTH U;  3B0X A;  4J9S A;  4OO1 J;  2UVU A;  1PVR A;  4MHV A;  4FBU A;  4B9M A;  4QZE A;  3SQI A;  2LPE A;  3JPS A;  3JPT A;  1KEJ A;  2K4H A;  5ALR A;  1SV0 A;  1AQ6 A;  2G09 A;  5KFJ A;  2ALZ A;  4KLQ A;  3QU4 A;  1S76 D;  3TAD C;  8ICL A;  8ICW A;  1S8O A;  3F2C A;  4I2A A;  2NYV A;  4DOB A;  4UAU A;  1U47 A;  2PMZ F;  2ZG6 A;  1HIW A;  2FPL A;  4GXJ A;  2G08 A;  1A6S A;  2GWS A;  3V7L A;  4CNQ A;  3OHA A;  3TAC B;  3H8S A;  5DG9 A;  3AUO A;  8ICS A;  7ICR A;  1Q3V A;  3PMN A;  3RR8 A;  4QZA A;  3SI8 A;  1WUD A;  4XUS A;  1TAQ A;  1IXR A;  3LK9 A;  5L1I A;  2BDU A;  1MQ2 A;  4BWJ A;  7ICV A;  1JN3 A;  2RLT A;  4NLZ A;  3V6J A;  4M0A A;  4IC9 A;  2LKY A;  5ALF A;  3PSF A;  4BXO A;  1KDH A;  9ICS A;  1IG6 A;  4YN4 A;  4R64 A;  9ICG A;  2HHQ A;  1QH9 A;  4CE6 A;  4C4S A;  5ALX A;  3H40 A;  7ICJ A;  2FMP A;  2DPI A;  2EZY A;  3QUC A;  4M9N A;  4GFJ A;  1JX4 A;  4K4I A;  5H2F U;  4F5O A;  1JMS A;  5GTI U;  3GV7 B;  2D3D A;  1QSS A;  3VCB A;  3T5K A;  1NJY A;  3IN5 A;  3OTQ A;  4DQQ A;  3RJF A;  1ZD2 P;  3H4D A;  2KN7 A;  1PUZ A;  4Z6D A;  2P6U A;  4MEX A;  1L7N A;  4UAR A;  3RB3 A;  5D46 A;  5KFI A;  1EXN A;  4KLG A;  3OPX A;  1BPZ A;  4RU9 A;  3WK5 A;  3TFR A;  3WK9 A;  3GV8 B;  4IQU A;  2K8A A;  4YR2 A;  4DFK A;  5HR7 A;  5L1M A;  5EE3 A;  5DB9 A;  1XNS A;  1T94 A;  4NV0 A;  5IIK A;  4NXZ A;  4KLI A;  1JI7 A;  3IDW A;  4XRH A;  4O3S A;  4DSL A;  1FFU A;  4KLM A;  1LKY A;  2HHS A;  4E0D A;  4Q43 A;  1KL9 A;  2ESE A;  1ZQW A;  5AI6 A;  5EWE A;  2L5Y A;  1DRG A;  4F50 A;  3PW4 A;  9ICN A;  3WKB A;  4BXO B;  1SKW A;  8ICI A;  1WG8 A;  1WCN A;  4RQ6 A;  3WKE A;  3F53 A;  4P4O A;  4GXK A;  3HPO A;  1COK A;  4C8K A;  4QWE A;  2AJQ A;  4ZH4 A;  5ALI A;  5KFX A;  1SKS A;  1NZB A;  3JPP A;  3NVW A;  3PML A;  3MGH A;  2HI0 A;  7ICS A;  5AKY A;  4B9L A;  4UB3 A;  5ALE A;  5KFS A;  3ALR A;  4G9B A;  1BGX T;  2GH1 A;  3SEN A;  3EYZ A;  3SZ2 A;  3KHL A;  2BQ3 A;  2IMW P;  7ICI A;  4KLD A;  5J29 A;  2V4R A;  4B9N A;  1V97 A;  2VJ4 A;  2BCU A;  2W04 A;  4DO9 A;  4UQG A;  4J9M A;  3PO5 A;  1RXV A;  2H3F A;  2W11 A;  4ECR A;  4YMN A;  2YX8 A;  9ICI A;  2BHN A;  5ALT A;  4USA A;  1NKC A;  4QZH A;  4MF8 A;  3MAB A;  4I2E A;  2DUY A;  1BPD A;  2IOF A;  4IQT A;  3T5J A;  2KG5 A;  5DDM A;  1LKY B;  2FMS A;  2LM1 A;  3NVV A;  4P2H A;  2MRL A;  3D6J A;  5AKJ A;  2CRX A;  3T5H A;  5B66 U;  7ICE A;  2XY5 A;  9ICK A;  1CI4 A;  3ZDC A;  3QZ8 A;  5DG8 A;  1TK8 A;  4KLO A;  2B6G A;  1Z00 A;  5DB8 A;  4G3I A;  2ASJ A;  4ECT A;  9ICC A;  4B9T A;  1X9M A;  5IIL A;  5J0X A;  5CB1 A;  2G5H B;  3ZDA A;  4DSK A;  3GV5 B;  2V4Q A;  4EBE A;  1ZD4 A;  3QU5 A;  3LDA A;  4A8E A;  5G5H A;  4DL2 A;  4Y2U A;  4FO6 A;  3QYP A;  2UVW A;  5J0S A;  2KZ3 A;  1L3U A;  4TUQ A;  3C2L A;  5ALL A;  2C28 A;  4QWD A;  4UAT A;  2WF6 A;  2AXT U;  2ZIU A;  2VA8 A;  8ICN A;  3H4B A;  8ICO A;  4RQ4 A;  1S10 A;  1KFT A;  4J9R A;  1ZRM A;  3HJE A;  1NK6 A;  2NV3 A;  3D2Q A;  1S0O A;  1Z1B A;  3GDX A;  1URJ A;  1XSP A;  4QZ9 A;  2LYB A;  4QZI A;  3M8R A;  2HBM A;  2KZM A;  3HIL A;  3MDA A;  1CUK A;  4RPY A;  3HX0 A;  1MQ3 A;  2AHO B;  5EOZ A;  4RQM A;  5D4B A;  3RJJ A;  4CDG A;  9ICB A;  1RQL A;  3CW2 C;  3E0F A;  4KMO B;  5AK4 A;  8ICE A;  2W8K A;  2XVT A;  1QLN A;  1X6I A;  4F3O A;  4I28 A;  1Z00 B;  2HVH A;  2CPR A;  2BPG A;  1RG6 A;  3ZD8 A;  3GQC A;  3C5G A;  1ZQR A;  1V85 A;  2VA2 A;  9ICF A;  4JV0 A;  1KKX A;  3RJI A;  2Y1I A;  3Q8R B;  2WB1 F;  1RZT A;  1HUO A;  2ZIU B;  3CYM A;  1CRX A;  4RUA A;  2F76 X;  1YZ7 A;  5CR0 A;  4BUG A;  2FPM A;  4RPZ A;  5AK5 A;  3FYH A;  1B22 A;  3KTQ A;  4YR0 A;  3RBE A;  3F2D A;  3Q8L A;  4ELU A;  4KLF A;  4PGX A;  1V38 A;  2QB0 A;  2UVV A;  4PHA A;  3FDS A;  3C28 A;  3A0B U;  1F5S A;  1ZQQ A;  4I2D A;  3EPG A;  9ICV A;  4JMU A;  3QXG A;  5ALD A;  5J2A A;  1NJX A;  3JPQ A;  4B9V A;  4LVS A;  1NK4 A;  4QIW C;  4PL1 A;  2KVS A;  2HHW A;  4NJ8 A;  2WAQ F;  2HOI A;  4KLL A;  3NTU A;  3DEE A;  7ICQ A;  3NGD A;  1J2N A;  5DGB A;  1T7P A;  1ED1 A;  5AKE A;  5KFO A;  2JXJ A;  3OJU A;  4KN7 A;  2OHF A;  3UXP A;  4ED8 A;  3PV8 A;  2G0A A;  2Z7J A;  1N2X A;  2E8P A;  4DOA A;  3HWT A;  2KMD A;  3UPQ A;  2ASD A;  2Y0S F;  3E2E A;  1BNO A;  2Q4T A;  2KVC A;  2A1A A;  5DB7 A;  4UBC A;  3AL0 B;  4MF2 A;  5HP4 A;  2M0N A;  3BQ1 A;  5J0W A;  1ZJM A;  3H7I A;  2G06 A;  1KW4 A;  3QEA Z;  5BOM A;  5ALW A;  1ARO P;  1RYU A;  1T4G A;  5J2F A;  3ZDB A;  3RB6 A;  1ZQB A;  4TUS A;  4YQW A;  3K1Z A;  2W54 A;  3UXN A;  5F9N A;  1MSW D;  4RQ0 A;  3DDH A;  1X9S A;  2DFL A;  4DS4 A;  3NRW A;  1UHU A;  5III A;  4DEZ A;  4O3N A;  2YB4 A;  4JWN A;  4JB3 A;  4OD0 A;  2V9W A;  3BS5 B;  2YMP A;  1Q46 A;  5KAI U;  1IM4 A;  4NL9 C;  4DF8 A;  1RM6 C;  3UM9 A;  4GXI A;  4Z6E A;  4GC7 A;  5B5E U;  4ZOH C;  5DBA A;  4I2F A;  2KIV A;  5KFW A;  4F8R A;  2HBL A;  2KJ9 A;  7ICK A;  3F5E A;  2ISO A;  9ICU A;  4R66 A;  1NKB A;  4F2S A;  4O3M A;  2I9G A;  2IHN A;  2JGA A;  5KG5 A;  5TZV A;  3OJS A;  4F5P A;  1KLN A;  3C21 A;  3T3F A;  1ZQA A;  3AQE A;  2KFZ A;  4EZ6 A;  4I2C A;  1JRO A;  1ZOL A;  5DKW A;  5AI9 A;  3OHB A;  3EZ5 A;  5AKK A;  3HP6 A;  4O5C A;  2A3V A;  3C2K A;  1ZD3 A;  5JU5 A;  3MR5 A;  1O03 A;  2YML A;  4DOC A;  4BJQ A;  3AU2 A;  3NRZ A;  1S0V A;  5ALQ A;  3KD3 A;  4J9K A;  3SAH A;  1OXJ A;  2PI4 A;  2EQY A;  5DQI A;  4F4K A;  3C23 A;  3H8J A;  4RUC A;  1TE2 A;  5KFY A;  3M9O B;  2WF7 A;  2ZXI A;  3Q8P B;  4UAZ A;  7ICH A;  2K8B B;  3Q8Q B;  2W9A A;  1S5L U;  4P4P A;  5J2I A;  3SAG A;  2ASL A;  1ZQF A;  2IOH A;  3O0F A;  1FIQ A;  1ZQY A;  3C29 A;  3MFI A;  3D2S A;  3BZC A;  2FLL A;  5DG7 A;  2NRT A;  4O3O A;  4O5K A;  2BKE A;  2HBK A;  5J0Q A;  3MDC A;  3SV4 A;  4LZG A;  2LBO A;  5KT4 A;  3M8S A;  4RQN A;  1CEZ A;  3LYS A;  1ZQG A;  7ICM A;  5DBB A;  3N97 B;  5KFE A;  1Q3U A;  4F71 A;  2E1F A;  2AGO A;  5E79 U;  2AGP A;  8ICB A;  3OSN A;  4IQW A;  2KE7 A;  4ED6 A;  1U48 A;  5L1K A;  1SZP A;  5F9L A;  5KG7 A;  4UAV A;  4QIW F;  1L5U A;  3IM1 A;  2W43 A;  4C8N A;  1ZQX A;  4DL3 A;  5J2K A;  3QUQ A;  4EBD A;  8ICQ A;  1WYG A;  5KG1 A;  5KT2 A;  3PR4 A;  5CEH A;  1DGJ A;  3LVV A;  4RQ8 A;  1TFR A;  4U7C A;  5ALG A;  4NM1 A;  2OYY A;  3AMZ A;  2XGP A;  3TQ1 A;  1NJW A;  5JTI A;  1D8L A;  3FM9 A;  5CHG A;  4DQI A;  1QQ6 A;  3ISB A;  2XCP A;  4MFA A;  4MFF A;  4MEY A;  5J0U A;  2YMM A;  4YMO A;  1ZQS A;  2RDI A;  1KQQ A;  2W9B A;  1UT5 A;  4KX3 A;  5EE1 A;  2R8I A;  2F8L A;  1TAU A;  2R8K A;  4M6W A;  3N7R C;  1T8E A;  2HBJ A;  5ALJ A;  2H3Z A;  4O3R A;  4FS1 A;  2VA3 A;  3UMC A;  1ZQO A;  3M9M B;  2E3T A;  3LWL A;  4FS2 A;  1ZQL A;  2VJ5 A;  3VC8 A;  1XWL A;  3THV A;  3JPR A;  1YZ6 A;  2K60 A;  1QQ5 A;  2KKP A;  2JHD A;  3ISC A;  3GII A;  2FE9 A;  2K89 A;  2F3N A;  2W9C A;  5KFU A;  1NOM A;  5ALY A;  4K4H A;  3AM9 A;  1NZP A;  2J6U A;  4ED7 A;  3R9K A;  2KZZ A;  3EW9 A;  5JUM A;  5AI0 A;  1U45 A;  2MAX A;  4O5E A;  4XA5 A;  1K5O A;  4KLS A;  1ZQE A;  3MR3 A;  3RJK A;  4AYB C;  4QW8 A;  3H0L B;  5AKL A;  4ELV A;  4J9P A;  4EYH B;  4QZD A;  4C4T A;  9ICM A;  5CA7 A;  2NRX A;  9ICA A;  4JV2 A;  2JEG A;  5J2G A;  5ALK A;  4OJ6 A;  4F92 B;  2QAR B;  1S9F A;  2HMX A;  3C5F A;  1B4F A;  4I2G A;  3ZI4 A;  2G5I B;  3PR5 B;  5AKI A;  7ICG A;  2W9B B;  3QU2 A;  3JPN A;  5BOL A;  2F1I A;  5J8Y A;  5J0R A;  4M6W B;  3TAQ A;  4F2R A;  4IR9 A;  1JXE A;  4PZN A;  3NS1 A;  8ICK A;  1O08 A;  4Y2Q A;  2EAN A;  4F5R A;  2BPC A;  5J0T A;  5KFA A;  2F2A B;  5J0Y A;  4IR1 A;  4KN4 A;  2GLE A;  2JV3 A;  2JR5 A;  4PZO A;  2DL0 A;  4DSF A;  2OEH A;  3KHR A;  1KTQ A;  3RF9 A;  1XU4 A;  3M1Y A;  1N60 A;  5KT7 A;  3QE9 Y;  4M9H A;  2W9C B;  1RYS A;  5J2B A;  2MSN A;  2BCR A;  3CRX A;  1FO4 A;  3WK7 A;  1HUZ A;  2W7P A;  2BCS A;  2HCF A;  4CF5 A;  2ZIV B;  2JMG A;  5AM5 A;  3RH5 A;  4O0I A;  5HR6 A;  2A1J A;  2KFN A;  5A0L A;  7ICU A;  3V72 A;  4BDP A;  2R8J A;  5ALM A;  4UBB A;  2VAN A;  4DSJ A;  4JWM A;  2HOQ A;  3WU2 U;  3RBD A;  3IRU A;  2EDU A;  3FAH A;  2CN1 A;  4Y2S A;  2BQU A;  2KKV A;  1UT8 A;  3PSP A;  1OUQ A;  3K4G A;  3PW2 A;  1K1S A;  3UMB A;  1RXW A;  1JAL A;  4NL9 A;  2OWO A;  5AM3 A;  3RRH A;  1NK7 A;  5J2C A;  3PY8 A;  2QB1 A;  4F4W A;  3OSP A;  3TAP A;  1L8O A;  3V6H A;  2PI5 A;  2UVR A;  4DQR A;  2HVI A;  2NRV A;  4Z6C A;  2VIX A;  1HEK A;  2XCA A;  1L8L A;  4J9Q A;  2JEI A;  1KSP A;  2IHM A;  1WWV A;  2H5X A;  3KHG A;  3DV9 A;  4RQ1 A;  3GIL A;  3AN1 A;  2W8L A;  9ICT A;  3GIK A;  3RH4 A;  4X5V A;  5J2H A;  3BQ2 A;  5CWR A;  1RQN A;  1ZQU A;  3LVW A;  2Q0Z X;  5KFF A;  3ZD9 A;  5ALN A;  2W03 A;  2A1J B;  2OH2 A;  2ES6 A;  4C7Y A;  4DLE A;  2R8G A;  5ALV A;  4QZB A;  1ZD5 A;  3RB4 A;  3Q8K A;  1N63 A;  1ZRN A;  2JRZ A;  3L5K A;  3ICX A;  1ZQK A;  2KIW A;  3HRD D;  2DQN B;  2MUT B;  1QQ7 A;  1UCV A;  4U6P A;  3SD7 A;  2RHF A;  3IHQ B;  2F8K A;  2FLN A;  1H38 A;  2KSO B;  3QZ7 A;  4P0Q B;  2FDR A;  5AKG A;  1SL1 A;  1Z19 A;  1TVA A;  1BVS A;  1ZQH A;  1Z1V A;  2EH9 A;  3IV6 A;  5J2D A;  4Y2V A;  5IIN A;  2GO7 A;  3U26 A;  4DQS A;  3NVY A;  2FI1 A;  1T3Q A;  4DFD A;  2WF8 A;  4IL6 U;  2W9M A;  4R63 A;  5AHX A;  3RAX A;  5KG3 A;  4B9S A;  3BS5 A;  1X9W A;  4RQ5 A;  2JEJ A;  3ZDE A;  5ALH A;  1PVP A;  2WFA A;  3HKZ C;  3N7S C;  1N56 A;  3QX7 A;  3MC1 A;  3G6X A;  5J8Y C;  8ICF A;  1HJP A;  2ZIX A;  3N28 A;  3TI0 A;  3IG5 A;  3EPI A;  2BDP A;  2EAM A;  3KBB A;  3WKA A;  5L1J A;  2PFO A;  1NK0 A;  4DLG A;  2PMZ C;  4C0Z A;  3NVZ A;  1YT3 A;  4BWM A;  4ED0 A;  3M9N B;  4KMU A;  5DLF A;  1SXD A;  4UB2 A;  2AH5 A;  5HHH A;  3T79 A;  1M6Y A;  1ZQI A;  4YFK A;  1SXE A;  8ICC A;  5AM2 A;  4I27 A;  2XO7 A;  3KKA C;  3KZI U;  2DGZ A;  1JRP A;  3QEB Z;  1B43 A;  4IS7 A;  1MN8 A;  4BX9 C;  3BQ0 A;  2RDJ A;  5AK3 A;  1NK5 A;  1XO1 A;  1D9D A;  1DK2 A;  2EZZ A;  2BCQ A;  5DQG A;  4OJO A;  1SB3 C;  3A0H U;  3BZK A;  4NWI A;  3GIM A;  1OW5 A;  8ICV A;  3KFU F;  4Q8F A;  4GC6 A;  5AM4 A;  4FZN A;  2K4I A;  3H0R B;  3Q8S B;  3EWA A;  3WK6 A;  5KG2 A;  4C8M A;  2EAP A;  2KNJ A;  2KTQ A;  2W55 A;  2CXY A;  1ZQC A;  1D9F A;  1KFD A;  4Y2P A;  5J2E A;  1X9X A;  2K4P A;  5DLG A;  2HHT A;  1GO3 F;  1FEZ A;  5KFH A;  1X42 A;  8ICZ A;  3PX6 A;  2DKZ A;  8ICU A;  2ZIX B;  2VKQ A;  3AQF A;  4OJL A;  3PX4 A;  4RQ3 A;  2YQE A;  1LVH A;  1TAM A;  2LI6 A;  2LYH A;  1X6J A;  5T14 A;  4QW9 A;  4OJ5 A;  5KL1 B;  7ICP A;  1ZQM A;  4Q44 A;  4RZR A;  3EUB 2;  1K1Q A;  1XS9 D;  4DSI A;  2G07 A;  2XIC A;  5AIA A;  2HW3 A;  4Y2Y A;  5AI4 A;  3Q8M A;  3J81 j;  1A77 A;  4DCC A;  4PH5 A;  2JZB B;  2I5H A;  1XC9 A;  4B9U A;  4YR3 A;  4FE3 A;  3N7P D;  1TKD A;  1D8Y A;  4M9L A;  2DBY A;  5C0Y A;  1N5W A;  4PGY A;  3WK8 A;  4O3P A;  3SYZ A;  2F44 A;  3T5L A;  3CNH A;  4EEY A;  3MGI A;  3MBY A;  3SR6 A;  4Y2R A;  5J2J A;  4I29 A;  4KTQ A;  3L3F X;  3ISD A;  4PGQ A;  2ZTE A;  2AGQ A;  2N1R A;  3V7J A;  4DSE A;  4RNN A;  2DKX A;  5J0O A;  1F0M A;  3RJG A;  5KG6 A;  4UB6 U;  3WK4 A;  3SAF A;  2KV2 A;  4UB4 A;  1L6N A;  4UAY A;  2QLT A;  5IIO A;  5KFR A;  4P0P A;  5KAF U;  8ICJ A;  4M47 A;  2LHT A;  4ED1 A;  1ZET A;  2YY6 A;  1T3N A;  3HKZ F;  2D6F C;  4DL6 A;  5ALP A;  4EX7 A;  3IP4 B;  4OCZ A;  4F5Q A;  3ONN A;  1S77 D;  9ICE A;  4KIT B;  3D2N A;  5KFV A;  2E8M A;  1C7Y A;  3PVX A;  1SWV A;  5CJ7 A;  1L3V A;  1J97 A;  2DF4 B;  3SV3 A;  4R8U B;  3QUB A;  4C7Z A;  4NM2 A;  5EWF A;  2IOF K;  3WKC A;  2QAR A;  2ZJ5 A;  4YXM A;  1ZQJ A;  5AIC A;  1L7O A;  4K4G A;  4QZ8 A;  3H8M A;  4QZF A;  4YVZ A;  1ZQV A;  2F1H A;  5AM1 A;  1PZN A;  2GOL A;  5C5J A;  4RT2 A;  4QWC A;  4MFC A;  5KFM A;  5HML A;  4EZ9 A;  3RB0 A;  2HHX A;  2PFP A;  2DWQ A;  3GZF A;  5AI5 A;  4CGZ A;  2KJ8 A;  4UW9 A;  2ATL A;  3MFH A;  2ODG A;  5J0P A;  2BCV A;  2KD1 A;  4IQV A;  4YD2 A;  2XY6 A;  3KHH A;  4NLN A;  3HW8 A;  3UXO A;  1U49 A;  1SIJ A;  2KJ5 A;  3C2M A;  2Y9T A;  1U4B A;  1SL0 A;  1B0X A;  5KFQ A;  1ZJN A;  4DL7 A;  5AKZ A;  4TQS A;  4P0P B;  1X40 A;  3PW5 A;  1N5X A;  4NY8 A;  2K8C B;  4I2J A;  4PHP A;  5KT6 A;  4RQ2 A;  5DB6 A;  1L7M A;  2ZIV A;  1L3S A;  3PW7 A;  2ZXH A;  5K4L A;  7ICT A;  2WF9 A;  1XO0 A;  1SGG A;  5AM0 A;  8ICG A;  9ICH A;  4US9 A;  4CCH A;  4F4Y A;  4M04 A;  3SMV A;  2JH1 A;  1XSN A;  1XSL A;  2OXO A;  3TKA A;  5EWG A;  1ECW A;  1MC8 A;  1ZXI A;  3H0M B;  2YN4 A;  3PZP A;  4KLJ A;  4P4M A;  1L3T A;  8ICT A;  5KFC A;  4F5N A;  2KHQ A;  2HDO A;  2I6X A;  2F77 X;  2Y1J A;  2HSZ A;  2PKE A;  3V7K A;  2R18 A;  4Y2X A;  1Q8K A;  3FC4 A;  3MR6 A;  2B0C A;  1SV4 A;  1LV5 A;  2WB1 C;  4PPX A;  2B21 A;  2W7O A;  4GLX A;  4IRK A;  5KT5 A;  1WWU A;  3OGU A;  4DFM A;  3ORY A;  3E58 A;  5KL8 B;  4KX5 A;  5G5G A;  2FMQ A;  2ZJ8 A;  5KFB A;  4CRX A;  5HMM A;  2P66 A;  3H8W A;  1FFV A;  1QSY A;  2AQ4 A;  2H3Q A;  3GFK B;  5L1L A;  2NO5 A;  3M6Z A;  2XC9 A;  4US8 A;  1NK9 A;  3I28 A;  2RQ5 A;  2KOB A;  1X2I A;  1F44 A;  5DDY A;  4C4R A;  4CF4 A;  1TK5 A;  4F4Z A;  1QTM A;  3KKA A;  2D8C A;  3RR7 A;  1NK8 A;  1ZQ1 C;  5L9X A;  4Y2T A;  4RQ7 A;  5KG0 A;  3B9J A;  4EYI B;  4ECV A;  3K75 D;  1PK3 A;  4M9J A;  3PST A;  1S0M A;  4OJP A;  4UB5 A;  3LWM A;  2WAQ C;  2ISP A;  1N62 A;  1SZH A;  5AKH A;  2H3I A;  2KEY A;  1BPE A;  2E8N A;  3PSI A;  2PFN A;  3RH6 A;  4RNO A;  1JIH A;  4YMM A;  2DPJ A;  1QCK A;  4JK1 A;  3IG8 A;  2P6R A;  9ICL A;  2Y9U A;  4UB1 A;  2BQR A;  4BGD A;  1U9L A;  4QWB A;  1IIP A;  4QWA A;  4QZC A;  3F2B A;  2MUT A;  1DXS A;  8ICY A;  1SV0 C;  4DQP A;  1MA7 A;  4JUZ A;  4TQR A;  2KK0 A;  4RNM A;  4AP9 A;  2LYA A;  4DFP A;  2Y0S C;  3BS7 A;  2A19 A;  2O6K A;  3RRG A;  2ZTC A;  1N48 A;  4CF3 A;  1VJ5 A;  3I76 A;  2AQ0 A;  2HOF A;  5BPC A;  4ACO A;  2KSO A;  5IIJ A;  2FJ6 A;  2JH7 A;  3PW0 A;  5DGA A;  4P0Q A;  4LZD A;  3S6J A;  1SWW A;  4ECX A;  2EAO A;  3M6K A;  1KBU A;  5KTQ A;  5KFG A;  4WJ3 B;  2WTF A;  3V6K A;  2E8O A;  3G6Y A;  4NLC A;  2IBK A;  4YP3 A;  2R8H A;  3GU3 A;  4HYK A;  4DF4 A;  3PX0 A;  1Z4N A;  2H3V A;  1VDV A;  4NLK A;  3ED5 A;  2J6S A;  1PK1 A;  4KLU A;  4KLT A;  4I2H A;  1ZQD A;  9ICO A;  5KNI A;  9ICP A;  5KG4 A;  2IA6 A;  5KFZ A;  4ECZ A;  1KN5 A;  3WKD A;  2BZF A;  4EEK A;  4Z6F A;  5FP0 A;  5D49 A;  1ZQP A;  2FLP A; 
#chains in the Genus database with same CATH homology
 3D2Q A;  1P7D A;  3SAF A;  4P0Q B;  2KV2 A;  4GFJ A;  4ICA A;  3KFU F;  2WAQ C;  1Z1B A;  4O3M A;  4FZN A;  1SZH A;  1URJ A;  2K4I A;  2H3I A;  2VJ4 A;  3H0R B;  4AYB F;  2JGA A;  2KEY A;  2ZIV A;  4PL1 A;  4QIW C;  2ZXH A;  2W04 A;  2LYB A;  4OJ6 A;  3PSI A;  3VCB A;  3LVV A;  2HBM A;  1Z19 A;  4U7C A;  3MGV A;  4P0P A;  1A0P A;  2HMX A;  2KNJ A;  2H3F A;  4FZM A;  3IN5 A;  2OYY A;  2WAQ F;  1XO0 A;  2HOI A;  3AQE A;  2LHT A;  3DEE A;  2G5I B;  2YX8 A;  3IG8 A;  3HKZ F;  2ZIW B;  2D6F C;  2VIX A;  1HEK A;  2XI9 A;  1IIP A;  3CP8 A;  1GO3 F;  1ED1 A;  3SMV A;  2JH1 A;  3IP4 B;  2OXO A;  3OPX A;  3F2B A;  1PVQ A;  2ZIX B;  2A3V A;  2MA1 A;  2VKQ A;  3ONN A;  4CDG A;  2KIC A;  3AQF A;  4OJL A;  1ECW A;  1MA7 A;  4OO1 J;  1PVR A;  3E0F A;  4KMO B;  2YB1 A;  2LYA A;  3RFA A;  1PVP A;  2Y0S C;  2E1E A;  2K8A A;  1TAM A;  3H0M B;  5HR7 A;  3D2N A;  2XVT A;  3SQI A;  3HKZ C;  2G0A A;  2Z7J A;  2ZIW A;  3N7S C;  2F2A B;  1D8B A;  4BJQ A;  3PZP A;  2MRL A;  1XNS A;  1T94 A;  4NV0 A;  3SAH A;  1UPH A;  4KX3 A;  5T14 A;  2K4H A;  2F8L A;  2HOF A;  4NLB A;  2CPR A;  2DF4 B;  2E5S A;  4OJ5 A;  2CRX A;  4ACO A;  2Y0S F;  5KL1 B;  2ZIX A;  2G09 A;  2KHQ A;  2JH7 A;  2Q4T A;  3IG5 A;  3N7R C;  2KVC A;  4P0Q A;  2F77 X;  2HBJ A;  2ZXI A;  3AL0 B;  2K8B B;  2H3Z A;  2G07 A;  3RF9 A;  2PMZ C;  3LVW A;  2M0N A;  2R18 A;  4C0Z A;  3F2C A;  2XIC A;  3M6K A;  2G06 A;  1YT3 A;  1KBU A;  2WB1 C;  4WJ3 B;  2W7O A;  2W03 A;  4FZL A;  3SAG A;  3M7D A;  2VJ5 A;  3VC8 A;  3CRX A;  3O0F A;  2OH2 A;  3C29 A;  2PMZ F;  2ZG6 A;  2K4E A;  1HIW A;  4NLC A;  2W7P A;  4FE3 A;  3T79 A;  2XID A;  2G08 A;  4KX5 A;  5KL8 B;  1A6S A;  3D2S A;  2WB1 F;  3K1Z A;  3N7P D;  2KKP A;  4CRX A;  2ZIV B;  2G5H B;  2GOL A;  1DRG A;  5C0Y A;  2JMG A;  3GU3 A;  2JHD A;  3NRW A;  2H3Q A;  2HBK A;  2K89 A;  2H3V A;  2ZIU B;  3CYM A;  4QNL A;  1CRX A;  1L6N A;  2LBO A;  2OM6 A;  1Q3V A;  3LYS A;  3M6Z A;  4A8E A;  5HR6 A;  2DGZ A;  2YB4 A;  2KOB A;  2F76 X;  3GZF A;  3ICX A;  1Q3U A;  1WUD A;  4PL2 A;  3F53 A;  1F44 A;  4CGZ A;  2KIW A;  2RRD A;  2BDU A;  5A0L A;  2KJ8 A;  4BUG A;  3L3F X;  4BX9 C;  2DQN B;  5CRX A;  2E1F A;  2KD1 A;  1NZB A;  4IC9 A;  2N1R A;  2HOQ A;  2LKY A;  4U6P A;  3KZX A;  2ZIU A;  3PSF A;  3F2D A;  2RHF A;  2RP5 A;  1ZQ1 C;  2CN1 A;  2KJ5 A;  4QIW F;  2KKV A;  3F5A A;  3ALR A;  3PSP A;  4OJO A;  1OUQ A;  3C28 A;  2GH1 A;  4QJF B;  4P0P B;  4AYB C;  3PST A;  2NV3 A;  4NWI A;  2HBL A;  3NUQ A;  4JMU A;  2KJ9 A;  4OJP A;  3F5E A;  2KHV A;  3H0L B;  2K8C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...