2LYBA

Structure of hiv-1 myr(-) matrix protein in complex with 1,2-dioctanoyl-sn-phosphatidyl-l-serine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trio engagement via plasma membrane phospholipids and the myristoyl moiety governs HIV-1 matrix binding to bilayers.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
molecule keywords Matrix protein p17
total genus 35
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lybA01
1ECWA 1ED1A 4IC9A 2H3FA 2H3ZA 2NV3A 2H3QA 1L6NA 2HMXA 1TAMA 1HIWA 2H3VA 2JMGA 1HEKA 1UPHA 2K4HA 2K4EA 2GOLA 2H3IA 4ICAA 2K4IA 2LYBA 2N1RA 4JMUA 2LYAA 1A6SA
chains in the Genus database with same CATH superfamily
1WCLA 4XA5A 1B43A 1C7YA 2IHMA 2HVHA 4F4XA 5DBCA 4I2DA 4C8MA 1MQ3A 2KJ5A 2W54A 8ICGA 1Y88A 3QYPA 9ICTA 2ASDA 1Q3VA 3BZKA 5ALEA 5GTHU 9ICKA 4J9QA 3H0LB 4E0DA 1D8BA 4C80A 2BPGA 3T3FA 1DK3A 1JALA 2K8AA 4EBCA 2WF5A 3WKBA 4PZNA 5AKGA 5AKIA 5ALKA 1YT3A 2NRZA 2MAXA 1RYSA 8ICBA 2HHVA 3PO5A 1JROA 1ZQGA 1XSPA 1L7MA 1XO1A 2K89A 5BOMA 3SAFA 1KFSA 5CRXA 3FM9A 1WWUA 1RPLA 9ICSA 3M7DA 4B9LA 3ONNA 2YY6A 5KFJA 4M2YA 3ZDBA 3A0HU 1IV8A 2ESEA 4Z6DA 1ZQIA 5ALNA 2JMGA 2HW3A 4ECRA 2AQ4A 3RRHA 4C8NA 2E8OA 2AQ0A 4UB1A 8ICSA 3SR6A 4DSEA 1PK1A 4JMUA 4PH5A 4EYHB 3M9NB 3ZD8A 2LBOA 2R8JA 5J29A 3NVZA 5IIOA 3RFAA 4NWIA 2MSNA 1PVQA 2AGPA 2IOHA 4NLBA 3WK6A 3KTQA 4KX3A 4RPZA 2L5YA 3ZD9A 1ZQHA 4B9TA 5KG3A 1J2NA 4BWJA 4IC9A 2A1JB 2ODGA 3NASA 2KZ3A 1BVSA 1S76D 1CI4A 1TV9A 1ZQRA 4P0PB 2AXTU 3QU7A 3M9MB 3MR5A 3G6YA 4K4IA 5JTIA 1QLNA 2KD1A 3EW9A 5AKYA 1S9FA 3KHHA 8ICIA 4KN7A 1KDHA 4F2SA 4DSJA 2G0AA 5TZVA 3UXOA 4CF3A 3BZCA 1BNOA 5IINA 2ZJAA 3GIIA 1OW5A 1VLBA 2ZIUB 3AEVA 2VA3A 3ETLA 5IILA 1ZD2P 4Q45A 1SGGA 3WU2U 4GFJA 1YZ6A 5AI8A 3RB4A 2DUYA 4PGQA 4UAYA 1JMSA 3N7PD 1V97A 4RQ0A 2BCSA 4RQ8A 1XC9A 3GIJA 1SV0A 2UVWA 5DLGA 4OO1J 3C2LA 1ZQVA 4TUQA 3JPSA 9ICWA 5HHHA 5T14A 3M6ZA 5AKJA 2BKEA 3A0BU 1JIHA 4FFDA 2DWQA 4PHPA 3ICXA 1TAMA 5HP4A 9ICXA 3PSIA 1TAUA 2ZUCA 3AMZA 3KFUF 4PGYA 5E79U 8ICMA 2FLLA 4ICAA 3CW2C 5J2BA 4TUSA 2W43A 3QU5A 3QU4A 8ICVA 4PHDA 2LPEA 4ED2A 2WB1C 5KG1A 8ICYA 2H3QA 3GV8B 8ICHA 3OHAA 4DF8A 3QX7A 3H8WA 5ALUA 2VJ4A 4DQRA 4BJQA 3V6HA 2ZTEA 3U26A 2BCQA 3ED5A 3E0FA 3N4MB 1COOA 7ICMA 1Z00A 2DKZA 4I27A 4O9MA 4FZMA 1AQ6A 4FS1A 4ECVA 2WF6A 4UB8U 3HW8A 7ICFA 2QB1A 4M47A 4OJLA 4J9RA 1QQ7A 1UT8A 5KFFA 4OD0A 2RDJA 3RB6A 5AHXA 2XO7A 3WK4A 8ICZA 4O3NA 1TKDA 4M9NA 1SZHA 4R8UB 2I9GA 1KL9A 4QZCA 4OJOA 1Z4OA 3Q8LA 3RH6A 2JHDA 3LWLA 2G06A 1L3TA 4F5QA 5J0QA 5KT7A 4MFCA 5KFRA 4F4WA 2E8NA 4DFKA 2C28A 2F1JA 2IBKA 4CNQA 4F5NA 5KTQA 3D2NA 4DS5A 5IIMA 4DSKA 4NLGA 2V4RA 3MDCA 4QZ9A 2I5HA 1Z4NA 4NM1A 4YN4A 4IQWA 4G9BA 4F4KA 3BS5A 2E1FA 4Y2TA 3CRXA 2WHEA 3PSPA 4I2AA 4RU9A 8ICLA 5ALLA 2B0CA 1B4FA 3ALRA 5AKLA 1A6SA 1NJZA 2HOIA 9ICCA 2BPFA 5C0YA 5KFAA 1NZPA 2XVTA 1XSNA 2W8KA 2DQNB 4UASA 1BNPA 4CE6A 1NI3A 2ZXIA 3PMNA 2GO7A 3MFIA 3SENA 4UBBA 4MFAA 1SV0C 1SL0A 1SXDA 4DQQA 1HUZA 3TANA 3OHBA 3IG5A 4NM2A 3M1YA 2ZTDA 5G5GA 2M9NA 2WFAA 3TFSA 2KSOB 9ICMA 3SI8A 4KTQA 5J0XA 5KAIU 1ZETA 2OWOA 9ICHA 2OCEA 2YB1A 5AIAA 2W3SA 4YD2A 3ISDA 9ICFA 4I2GA 3KHGA 4JK1A 4FBTA 4QWBA 4AYBF 4LVSA 4EZ9A 1N60A 4BWMA 1OUQA 5EWEA 3SZ2A 1N48A 4KMOB 5J2HA 3E58A 4RT3A 1NZBA 1DRGA 2HHWA 4ECXA 1Z00B 3KKAC 4DLGA 1WWVA 4BUGA 1UHUA 5D46A 4EZ6A 1L7PA 4JUZA 1QCKA 3NVWA 4HYKA 4YQWA 1J2MA 2KP7A 4RQ5A 2KK0A 2LYBA 4BX9C 1WCNA 4ELUA 4QNLA 1BPYA 4DFJA 1KBUA 5HR6A 2KICA 5KFTA 5L1JA 4DL2A 4B9NA 1RXVA 3Q8PB 1K5OA 1FFUA 2XICA 4QZAA 3F5AA 3RAQA 5KFHA 9ICNA 2ASLA 2YQEA 4NY8A 2KMDA 1TAQA 2YMMA 5KG5A 3SV3A 1X6IA 4GIBA 3MFHA 3IRUA 4GXJA 4PL1A 2W04A 2BPCA 4YR2A 4BGDA 1UA1A 2RDIA 3BDPA 5HMMA 2G5IB 1NK0A 4KN4A 2CN1A 4B9MA 4YMNA 3Q8MA 4RZRA 2UVUA 3OJUA 1P7DA 4I28A 2JH7A 3RB0A 3H40A 1KW4A 7ICOA 3PSFA 2K8BB 4QZHA 2PFPA 7ICJA 5KFCA 7ICGA 2F3NA 4DEZA 5HMLA 3RJEA 4GLXA 8ICOA 2K60A 4KLLA 4TUPA 2VANA 1M6YA 5ALIA 4Y2UA 5AIBA 4RUAA 4O5KA 3JPOA 4Q8EA 2NO5A 1ZQFA 1ZQSA 2HHTA 3M8SA 3H8JA 3BQ0A 5JU5A 4TQRA 3AUOA 1N5XA 2W9AA 1DK2A 5KFSA 4DQIA 3MBYA 4YMOA 5EE9A 5DG7A 1ZQWA 3RH4A 1TE2A 3CYMA 1CRXA 3IM1A 4F72A 5AM4A 4ELVA 2AGQA 4U6PA 3RJGA 2A1JA 1SB3C 4EX7A 1L3VA 3RJJA 3DEEA 3LVVA 5ALTA 1L3SA 2LM4A 4ACOA 4AP9A 3JPPA 4F5RA 4UATA 3PZPA 4PGXA 5ALSA 4M9LA 5JRTA 5AK5A 2ALZA 4F4ZA 4F8RA 1ZRNA 5DBAA 4O3QA 2DBYA 2KEYA 9ICQA 1ZQXA 1JX4A 3LVWA 3PW2A 2CRXA 4JB3A 4FBUA 4MF8A 4Y2JA 3C1YA 4PHAA 4XRHA 1KQQA 1S0NA 3UMCA 1XNSA 4Q43A 4M9GA 4NV0A 4I2CA 4UW9A 3Q8KA 4KMUA 4Z6FA 2M0NA 3ZDCA 5AK6A 1MN8A 1BPEA 4UB3A 1KFDA 4X5VA 2BDUA 2HBKA 4RQ6A 4JV1A 4TQSA 1X40A 2ZXHA 3UQ2A 4IL6U 1DGJA 2PI5A 1SL2A 2FMQA 1KKXA 1X9MA 1KSPA 4RUCA 2HMXA 3BQ2A 1UA0A 4IRDA 2OHFA 2XCPA 4Y2SA 1RG6A 5KAFU 1ZQQA 8ICUA 7ICLA 1V9PA 3NTUA 1KLNA 1NK6A 3FYHA 3RJKA 2F2AB 3IN5A 1F0MA 5KT6A 2R8IA 1PZNA 4MHVA 3IHQB 2W9BA 4KLFA 3KZXA 4J03A 4O5CA 4KLQA 4DOCA 2MUTB 2FE9A 3PW7A 3OSNA 4R65A 3PR5B 2KHQA 4I2HA 2OEHA 4DSLA 1ZQNA 3BS7A 3JPQA 3WK9A 3C23A 3ISBA 3MR6A 2FMSA 4O3PA 2HHUA 2V4QA 2QLTA 4F71A 1T4GA 4MEXA 1X6JA 3LYSA 1SKWA 5B66U 3V7KA 4NJ8A 2ZIWA 4F93B 2QB0A 4PHEA 3I76A 5AK4A 3LWMA 2BGWA 7ICRA 1D8LA 5ALVA 1URJA 2JEGA 3AU2A 5KNIA 2LYHA 3TAPA 4QZIA 1ZJNA 3SMVA 3PX0A 4C7YA 3RBEA 3WKAA 2KG5A 1D9FA 5KFLA 7ICSA 4DOAA 2XGPA 4KLDA 4C8KA 1PK3A 4YVZA 2BCRA 1RZTA 1Q3UA 2HVIA 4O3RA 2NRVA 1L3UA 3N97B 9ICBA 3I28A 5ALGA 2HBMA 2PFNA 5ALFA 2J6SA 4M0AA 3M6KA 2AU0A 1BPBA 1S10A 3C5FA 2C2DA 4J9KA 1TK5A 3SEIA 3RB3A 2LYAA 1U48A 5ALOA 4RPYA 9ICLA 1WUDA 1S8OA 5HNKA 1QQ6A 5J2DA 3QU9A 3QUCA 8ICQA 1VDVA 1FO4A 4EEKA 4KLJA 2EQYA 3K1RB 4QWDA 3JPTA 2QB0B 3PW5A 2XY5A 2V9WA 3F2CA 5AM5A 2C22A 4IR1A 1YZ7A 2LI6A 2E3TA 2JEJA 3K1ZA 2EAOA 3HILA 5J0OA 1NJWA 1WG8A 5KT4A 2HI0A 8ICKA 1L7NA 1NK7A 2J6UA 4AYBC 2C2EA 7ICHA 5KL8B 5KFZA 1TFRA 4QIWC 1QTMA 2PMZF 4NLCA 2Y1IA 3GV7B 3ORYA 2LM1A 3MDAA 2PXIA 4BDPA 2XY7A 1ECWA 2JH1A 4DL6A 2AGOA 1X9SA 1KRPA 3TFRA 4NLZA 2EAPA 8ICFA 1KN5A 1PVRA 4PL2A 4ECWA 3HRDD 3WK8A 2F1HA 4Y2YA 5ALXA 4CF4A 2O6KA 4GXKA 1ZQJA 1JI7A 4ZOHC 3PX6A 4DL3A 3RTVA 3RJHA 9ICEA 4EYIB 3WKCA 4IR9A 3F2DA 4CF5A 2OM6A 4B9SA 4CRXA 2E8MA 4MFFA 4ECSA 4I2IA 1SKRA 4B9UA 4UB2A 5DGAA 5L1KA 4F50A 5KFXA 2FPMA 1HIWA 8ICWA 3NRWA 3GILA 2VA8A 3L5KA 8ICEA 1Z19A 1NK4A 4YCXA 2KJ9A 4M9JA 3BS5B 5KL1B 3SD7A 4C8LA 5FP0A 2BZFA 2KVSA 3S6JA 2MUTA 2W3RA 4UAUA 3N7RC 5G5HA 2Y0SF 5J0WA 7ICNA 4IS7A 4UQGA 3F5EA 2PI4A 2KZMA 3H8SA 4C4RA 2JGAA 1T3NA 1Z3EB 3N7SC 1ZQUA 4DL7A 4UB4A 5KFPA 2YB4A 4YXMA 5DG9A 5AKKA 3I1YA 3V72A 5KFEA 3VC8A 4KLTA 1FIQA 1HEKA 4R8UA 2GOLA 5AKHA 4F5PA 3SQIA 2DPIA 3PW4A 3QEAZ 2HOFA 2HBLA 4O3MA 4EELA 5DKWA 2IOFK 1NKCA 4RQ1A 3QNMA 3H4DA 3H0RB 5DLFA 1Q8KA 2GWSA 4UAVA 8ICPA 4YP3A 1B0XA 4F4YA 5KFQA 2ZJ8A 2W9CA 5DBBA 1ZD3A 2JZBB 3F2BA 3ISCA 4R63A 2N1RA 4I29A 3ETRA 3PY8A 3EZ5A 2F76X 1ZXIA 4RPXA 1OXJA 1XU4A 9ICUA 3C2MA 3PX4A 5J2AA 2ZG6A 5KG6A 3GIMA 2I6XA 2MA1A 3NVYA 4JWNA 9ICPA 2XY6A 3NGDA 2Y0SC 1J97A 4DSIA 4BXOA 9ICAA 4NL9C 2Q4TA 3Q8SB 5JUMA 3HKZF 5J2KA 3RJFA 1ZQAA 3KHRA 3C29A 2H3VA 3TARA 3RAXA 1NJXA 3AU6A 4P4PA 2EDUA 5J2CA 4KX5A 5KFKA 1K1QA 3QZ7A 1V38A 2RP5A 2KSOA 1ZQDA 2NRTA 4M04A 4O0IA 3THVA 2RQ5A 8ICCA 3D6JA 4MF2A 4DS4A 2H3ZA 1ZD5A 2KIWA 3QE9Y 1ZQKA 1L8OA 1NK8A 2QKQA 4NLNA 3EUB2 2ZJ5A 2YMPA 1ZJMA 1LV5A 2R8KA 8ICNA 3DDHA 3UXNA 3ZDDA 1T3QA 2FMPA 3EYZA 1S0OA 4PPXA 1FEZA 4NXZA 1TVAA 1C20A 3B9JA 4F92B 4EEYA 2KFZA 1U49A 5KT3A 1SL1A 1MQ2A 1PVPA 2KHVA 3PR4A 2YMQA 2W8LA 3EWAA 2H3IA 1CUKA 3MGVA 4QWAA 4J9SA 2UVVA 1NK5A 4GXIA 1N2XA 2HHQA 2KVCA 3IP4B 4P0PA 2HHSA 2HCFA 1RYRA 4F5OA 1H38A 2DGZA 1DOQA 2R8GA 1LB2B 2OH2A 3IV6A 4YXJA 2AJQA 5ALJA 4R64A 1N5WA 2KV2A 4J9OA 4C8OA 5ALDA 3PO4A 1COKA 1RXWA 1BPDA 2CPRA 1XO0A 2F1IA 1U47A 1S0MA 4EBEA 4R66A 2RHFA 3KZIU 2OYYA 5ALWA 1RM6C 2G09A 3HT3A 2XC9A 3FDSA 7ICKA 2BQUA 1X9WA 1N62A 3PV8A 3AN1A 3GV5B 1NK9A 2KFNA 2A19A 2P35A 4F3OA 1X66A 2R18A 2JEFA 4DWIA 4DFMA 5KT2A 8ICRA 3UPQA 4O5EA 3C28A 4ELTA 4CDGA 2HOQA 3OPXA 2K4PA 5KG2A 5AKXA 5J0RA 5ALRA 3H7IA 5AM3A 4QZEA 2KZZA 4RQNA 1MSWD 3DV9A 3GDXA 2K4EA 1RQLA 3IG8A 5ALQA 1D8YA 3NS1A 4YMMA 2FJ6A 2PMZC 5KFIA 4CCHA 5BOLA 1Q46A 4ECUA 4P0QA 4DCCA 2ZUBA 2EH9A 4C0ZA 4RQ3A 1TK0A 4US8A 2ZIVA 2AHOB 7ICIA 2D3DA 4ECZA 1WYGA 4C7ZA 2WB1F 5EE1A 4RT2A 3UMGA 5K4LA 1IG6A 1ZQZA 3HPOA 4QZGA 4DSFA 3RF9A 1L7OA 2PFOA 4YR3A 5HHIA 1UQVA 3FAHA 4QWCA 3BJYA 5DG8A 1DXSA 1X42A 2DF4B 2VKQA 3CP8A 1SZPA 4I2EA 8ICXA 1S97A 2Q0ZX 2ZIWB 2VIXA 4UAWA 1RDFA 3GZFA 4RNOA 4EENA 3D2SA 3ZI4A 3QUQA 3H4BA 3RRGA 4NL9A 5C5JA 3L3FX 3QXGA 5ALZA 5H2FU 7ICEA 3GIKA 4UB5A 2HHXA 3B0XA 4GC6A 4FZNA 5AI6A 2XIDA 4RNMA 3RJIA 2G07A 3C1ZA 2NO4A 9ICIA 2KKPA 4YG2A 3HP6A 1O03A 2GLEA 5KFUA 3G6XA 4YFKA 2IA6A 4NLKA 5AK3A 1F5SA 4US9A 4GC7A 1SXEA 1IXRA 4RQ4A 2KKVA 3K75D 2W03A 4C4TA 3TADA 4G3IA 1Z1VA 5IIKA 1HJPA 5ALPA 1X9XA 2EZYA 5AM0A 2LKYA 2K4HA 3QUBA 1MC8A 4PZOA 3E2EA 1ZYQA 1PK1B 1UCVA 2WAQF 2KTQA 3KD3A 4U7CA 4Y2PA 1JUDA 3WKDA 2G08A 1QH9A 1PUZA 3M9OB 2EZZA 3LK9A 2F8KA 7ICPA 2MU2A 4QZDA 5CB1A 5J0UA 5L1MA 4XUSA 4KLMA 1ZQCA 1XSLA 4KLUA 1KFTA 3K4GA 3C2KA 4ED3A 5J0PA 2BQ3A 4F2RA 2B6GA 2Z7JA 5EE3A 5AKEA 3L4PA 4OJPA 5KFGA 3BQ1A 4ED1A 4J9PA 4DL4A 2NRWA 4B9VA 5KFWA 2NYVA 2Y1JA 5DQIA 4DF4A 3JPRA 5J0SA 3AL0B 3WK7A 2XCAA 3HWTA 4EBDA 4XQ8A 2KN7A 2FLPA 4UAZA 5CJ7A 5ALMA 1L6NA 2NRXA 9ICJA 4UARA 1QSSA 4CGZA 4IQTA 2HDOA 3ZDEA 4C4SA 1LKYB 1ZQLA 1BPZA 1N56A 4M6WA 4M9HA 4K4GA 5F9NA 7ICQA 1IM4A 4IQUA 2EANA 2KE7A 3MR3A 5J0YA 1N63A 3T5HA 3EPGA 4F91B 1ZQ1C 9ICRA 1NNLA 2PKEA 3EPIA 4YR0A 2ISOA 2ZIXB 4UB6U 5ALYA 2FPLA 2WAQC 4KITB 3WK5A 1NJYA 2KNJA 5EWFA 1FFVA 3TACB 2JR5A 1ZQOA 2K8CB 1IIPA 2YX8A 4KLGA 2GH1A 2HBJA 3KBBA 3OTQA 4JV2A 2BQRA 1A76A 2JV3A 1T8EA 2W9MA 4OJ5A 2VJ5A 5J2IA 3RBDA 2XGQA 4QWEA 4ZH4A 5GTIU 1TK8A 2KIVA 2Y9TA 3NVVA 1RQNA 2C2RA 3V7JA 4ED7A 4Y2QA 5AI9A 3QUTA 2QARB 2UVRA 3LDAA 2FPKA 4JWMA 1QQ5A 3FC4A 4IRKA 3QZ8A 4LZDA 1B22A 2W9CB 5AI0A 1T94A 1V85A 2BR0A 5J2GA 3KOOA 9ICVA 5KFYA 3PSTA 2P6UA 4OCZA 5KFVA 3TKAA 2DFLA 1F44A 3AM9A 1ZQMA 3C21A 1BPXA 4P4OA 4ED8A 4ECQA 4DO9A 3RH5A 3GQCA 2I1QA 3V6JA 2YN4A 1GO3F 1U4BA 9ICOA 5EE0A 2WTFA 4HAIA 5CP2A 3SYZA 5DB7A 4JV0A 1S77D 1KTQA 2CXYA 1NKBA 2MRLA 3N28A 1ZQEA 3UM9A 2BCUA 2D8CA 3D2QA 5L1IA 2ZTCA 4TURA 1NKEA 8ICTA 2RLTA 1ZQPA 2IOFA 1T7PA 5J8YA 4QZFA 3V7LA 5CHGA 4I2FA 3PMLA 2H5XA 1ZOLA 2VA2A 4KLOA 4Y2VA 1XS9D 5AM2A 3PNCA 3TAQA 3KKAA 4WJ3B 4Z6EA 1S0VA 1KEJA 4I2JA 3T79A 5DQGA 5F9LA 1JXEA 1L5UA 4I2BA 4USAA 4KLSA 2ASJA 3OSPA 3OJSA 2YMLA 3PW0A 4P2HA 1ED1A 2W55A 5HR7A 1A77A 2WF7A 5CEHA 1LVHA 5KFMA 3G6VA 3M8RA 3UXPA 4IQVA 7ICTA 5AI4A 2JZBA 2FLNA 4Z6CA 3Q8QB 2A3VA 3H8MA 3MC1A 4O3OA 2F8LA 1O08A 2H3FA 4ECYA 1L8LA 2NV3A 3BQ7A 3OGUA 3C5GA 2WF8A 7ICUA 3T5JA 1CEZA 2BCVA 5AI5A 2QARA 4QW8A 4K4HA 4FE3A 1JXLA 2ES6A 1U9LA 5J0TA 3RR7A 1D9DA 2IMWP 4PJ0U 4QIWF 1SWVA 5CR0A 3TI0A 1SKSA 5J2JA 3MGIA 4Y2RA 5DB8A 4J9NA 4QZBA 3TADC 3HJEA 4IRCA 1A0PA 4ED0A 2P6RA 5BPCA 2DL0A 5EOZA 1ZD4A 3PVXA 3T5LA 2F44A 1HUOA 3F53A 2P66A 3IDWA 5L1LA 1ZQBA 3GU3A 5D49A 2YTUA 4ECTA 4KLIA 4YD1A 5DDMA 4DFPA 1RYUA 2KJ8A 1UPHA 3O0FA 4RQ7A 5KFNA 1ZQYA 4P0QB 4M6WB 5DGBA 3HX0A 1LKYA 4DFDA 1Z1BA 1UT5A 2W7PA 2LMRA 5AICA 5J2EA 4LZGA 5EWGA 3NRZA 2LHTA 1SIJA 5L9XA 5KFDA 5IIJA 4QZ8A 3B0YA 2ZUDA 4UBCA 3WKEA 3AQEA 4DLEA 4J9MA 5DDYA 3T5KA 4A8EA 3QU2A 4DQSA 1QSYA 1JRPA 5AM1A 5DQHA 5KFOA 7ICVA 4Q44A 5D4BA 4RNNA 3ZDAA 2E8PA 5KG4A 2HSZA 4FZLA 4ED6A 2B21A 2Y9UA 1SWWA 2BHNA 2F77X 4Y2XA 5J8YC 2ISPA 1NOMA 4QW9A 3H0MB 4J9LA 3HKZC 2FDRA 2J6TA 2KOBA 2ZIVB 2DPJA 4OJ6A 4RQ2A 2W9BB 3SAGA 2JXJA 3SV4A 3UQ0A 5KG0A 3KHLA 1ZQTA 4O3SA 2ZIUA 9ICGA 5J2FA 5A0LA 8ICAA 5AKZA 1XWLA 2RRDA 1SV4A 2PFQA 1JN3A 1U45A 2A1AA 5KG7A 5IIIA 2W7OA 1BGXT 2DKXA 5TISU 4QJFB 5KT5A 1DGSA 4P4MA 2D6FC 4LJXA 4MEYA 3TQ1A 8ICJA 1ZRMA 2IHNA 3QEBZ 1K1SA 1QSLA 2EAMA 4BXOB 5B5EU 1X2IA 2W11A 4EX6A 2E5SA 5CA7A 5DB9A 1EXNA 3BQTA 1S5LU 5ALHA 2XI9A 4DOBA 2G5HB 5DB6A 1MA7A 3MR2A 2ATLA 4DL5A 3CNHA 2FI1A 2EZXA 4FO6A 4B6JA 3V6KA 3Q8RB 2WF9A 2AH5A 2K4IA 3GFKB 1VJ5A 3MABA 3AQFA 5KFBA 4FS2A 4KLEA 1AROP 4RQMA 2BDPA 3UMBA 4DQPA 3RR8A 2JRZA 2E1EA 3SAHA 4KLHA 3NUQA 2ZIXA 2OXOA 5CWRA 2JEIA 4Q8FA 5F3XB 2R8HA 3JPNA 3VCBA 3MGHA 3R9KA 3J81j 1N61A
chains in the Genus database with same CATH topology
1ZQ1C 1ECWA 2JH1A 2MRLA 1A6SA 4QIWF 5C0YA 4IC9A 2XVTA 2KOBA 2ZIVB 4PL1A 3D2QA 2KKVA 2W04A 2WB1C 2DQNB 2ZIXB 1URJA 4OJ6A 2H3QA 1PVRA 2W03A 3H0RB 4PL2A 3SAGA 2KEYA 2ZXIA 2WAQC 2G5IB 2VJ4A 2KJ5A 4P0PB 4BJQA 3LVWA 1PVPA 2CRXA 2LKYA 2K4HA 2K4EA 2KHVA 3SMVA 2CN1A 3E0FA 2H3IA 2ZIUA 2KNJA 3F2BA 1A0PA 3MGVA 1Q3VA 2KD1A 3IG8A 2N1RA 3IG5A 5A0LA 1P7DA 3F2DA 2OM6A 2K8CB 1XNSA 2JH7A 1IIPA 2YX8A 1Q3UA 2F76X 4CRXA 4WJ3B 2PMZC 2KVCA 3H0LB 3IP4B 2GH1A 2RRDA 3F53A 2HBJA 2WAQF 2K8BB 3PSFA 4FZMA 4P0PA 1D8BA 2M0NA 3T79A 2K8AA 4U7CA 2DGZA 2G08A 3GU3A 4P0QA 2W7OA 2G0AA 2OH2A 4QJFB 2D6FC 2HBMA 1HIWA 4C0ZA 1YT3A 2BDUA 2ZIVA 4OJLA 2HBKA 2VJ5A 3NRWA 2YB1A 2KJ8A 4OJ5A 3M6KA 2ZG6A 1UPHA 2KV2A 2ZIUB 3O0FA 2ZXHA 2MA1A 1Z19A 2K89A 4AYBF 2WB1F 3SAFA 5CRXA 4NV0A 2LYAA 4P0QB 4GFJA 2KJ9A 2E5SA 1SZHA 1OUQA 2Y0SC 2Z7JA 4KMOB 1WUDA 1ED1A 3RF9A 1Z1BA 3N7PD 4OJOA 2CPRA 5HR7A 1DRGA 1NZBA 2W7PA 1XO0A 3M7DA 5KL1B 4OJPA 2JHDA 2LHTA 2Q4TA 2DF4B 2VKQA 2XI9A 3CP8A 2HMXA 2G5HB 3ONNA 3HKZF 1MA7A 4BUGA 2G06A 2ZIWB 2RHFA 2VIXA 3C29A 3F2CA 4OO1J 2OYYA 2H3VA 2JMGA 1T94A 3GZFA 3CYMA 3N7RC 2G09A 2Y0SF 3D2SA 2A3VA 3AQEA 3PSTA 4KX5A 5T14A 1CRXA 3M6ZA 2K4IA 2RP5A 2LYBA 2F2AB 4BX9C 3IN5A 4JMUA 3F5EA 1F44A 4A8EA 3AQFA 3K1ZA 3AL0B 4QNLA 3KZXA 3L3FX 4U6PA 1KBUA 2JGAA 3D2NA 2F8LA 5HR6A 2KICA 3N7SC 2H3FA 2H3ZA 2NV3A 2KHQA 2LBOA 3DEEA 3LVVA 2R18A 2KIWA 4AYBC 3ICXA 1L6NA 1TAMA 3RFAA 4FZNA 2YB4A 5KL8B 2XICA 1GO3F 2PMZF 4QIWC 2XIDA 3PSIA 4NWIA 4FZLA 4CGZA 3KFUF 2E1EA 3F5AA 3SAHA 4NLCA 2G07A 1PVQA 4NLBA 2E1FA 3NUQA 3VC8A 1HEKA 4ACOA 3C28A 2ZIXA 2KKPA 3CRXA 2GOLA 2OXOA 4CDGA 3PSPA 4FE3A 3SQIA 4ICAA 4KX3A 3LYSA 2F77X 3VCBA 3PZPA 3ALRA 2HOFA 2HBLA 2ZIWA 2HOQA 4O3MA 3OPXA 2HOIA 3H0MB 3HKZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ECW A;  1ED1 A;  4IC9 A;  2H3F A;  2H3Z A;  2NV3 A;  2H3Q A;  1L6N A;  2HMX A;  1TAM A;  1HIW A;  2H3V A;  2JMG A;  1HEK A;  1UPH A;  2K4H A;  2K4E A;  2GOL A;  2H3I A;  4ICA A;  2K4I A;  2LYB A;  2N1R A;  4JMU A;  2LYA A;  1A6S A; 
#chains in the Genus database with same CATH topology
 1WCL A;  4XA5 A;  1B43 A;  1C7Y A;  2IHM A;  2HVH A;  4F4X A;  5DBC A;  4I2D A;  4C8M A;  1MQ3 A;  2KJ5 A;  2W54 A;  8ICG A;  1Y88 A;  3QYP A;  9ICT A;  2ASD A;  1Q3V A;  3BZK A;  5ALE A;  5GTH U;  9ICK A;  4J9Q A;  3H0L B;  4E0D A;  1D8B A;  4C80 A;  2BPG A;  3T3F A;  1DK3 A;  1JAL A;  2K8A A;  4EBC A;  2WF5 A;  3WKB A;  4PZN A;  5AKG A;  5AKI A;  5ALK A;  1YT3 A;  2NRZ A;  2MAX A;  1RYS A;  8ICB A;  2HHV A;  3PO5 A;  1JRO A;  1ZQG A;  1XSP A;  1L7M A;  1XO1 A;  2K89 A;  5BOM A;  3SAF A;  1KFS A;  5CRX A;  3FM9 A;  1WWU A;  1RPL A;  9ICS A;  3M7D A;  4B9L A;  3ONN A;  2YY6 A;  5KFJ A;  4M2Y A;  3ZDB A;  3A0H U;  1IV8 A;  2ESE A;  4Z6D A;  1ZQI A;  5ALN A;  2JMG A;  2HW3 A;  4ECR A;  2AQ4 A;  3RRH A;  4C8N A;  2E8O A;  2AQ0 A;  4UB1 A;  8ICS A;  3SR6 A;  4DSE A;  1PK1 A;  4JMU A;  4PH5 A;  4EYH B;  3M9N B;  3ZD8 A;  2LBO A;  2R8J A;  5J29 A;  3NVZ A;  5IIO A;  3RFA A;  4NWI A;  2MSN A;  1PVQ A;  2AGP A;  2IOH A;  4NLB A;  3WK6 A;  3KTQ A;  4KX3 A;  4RPZ A;  2L5Y A;  3ZD9 A;  1ZQH A;  4B9T A;  5KG3 A;  1J2N A;  4BWJ A;  4IC9 A;  2A1J B;  2ODG A;  3NAS A;  2KZ3 A;  1BVS A;  1S76 D;  1CI4 A;  1TV9 A;  1ZQR A;  4P0P B;  2AXT U;  3QU7 A;  3M9M B;  3MR5 A;  3G6Y A;  4K4I A;  5JTI A;  1QLN A;  2KD1 A;  3EW9 A;  5AKY A;  1S9F A;  3KHH A;  8ICI A;  4KN7 A;  1KDH A;  4F2S A;  4DSJ A;  2G0A A;  5TZV A;  3UXO A;  4CF3 A;  3BZC A;  1BNO A;  5IIN A;  2ZJA A;  3GII A;  1OW5 A;  1VLB A;  2ZIU B;  3AEV A;  2VA3 A;  3ETL A;  5IIL A;  1ZD2 P;  4Q45 A;  1SGG A;  3WU2 U;  4GFJ A;  1YZ6 A;  5AI8 A;  3RB4 A;  2DUY A;  4PGQ A;  4UAY A;  1JMS A;  3N7P D;  1V97 A;  4RQ0 A;  2BCS A;  4RQ8 A;  1XC9 A;  3GIJ A;  1SV0 A;  2UVW A;  5DLG A;  4OO1 J;  3C2L A;  1ZQV A;  4TUQ A;  3JPS A;  9ICW A;  5HHH A;  5T14 A;  3M6Z A;  5AKJ A;  2BKE A;  3A0B U;  1JIH A;  4FFD A;  2DWQ A;  4PHP A;  3ICX A;  1TAM A;  5HP4 A;  9ICX A;  3PSI A;  1TAU A;  2ZUC A;  3AMZ A;  3KFU F;  4PGY A;  5E79 U;  8ICM A;  2FLL A;  4ICA A;  3CW2 C;  5J2B A;  4TUS A;  2W43 A;  3QU5 A;  3QU4 A;  8ICV A;  4PHD A;  2LPE A;  4ED2 A;  2WB1 C;  5KG1 A;  8ICY A;  2H3Q A;  3GV8 B;  8ICH A;  3OHA A;  4DF8 A;  3QX7 A;  3H8W A;  5ALU A;  2VJ4 A;  4DQR A;  4BJQ A;  3V6H A;  2ZTE A;  3U26 A;  2BCQ A;  3ED5 A;  3E0F A;  3N4M B;  1COO A;  7ICM A;  1Z00 A;  2DKZ A;  4I27 A;  4O9M A;  4FZM A;  1AQ6 A;  4FS1 A;  4ECV A;  2WF6 A;  4UB8 U;  3HW8 A;  7ICF A;  2QB1 A;  4M47 A;  4OJL A;  4J9R A;  1QQ7 A;  1UT8 A;  5KFF A;  4OD0 A;  2RDJ A;  3RB6 A;  5AHX A;  2XO7 A;  3WK4 A;  8ICZ A;  4O3N A;  1TKD A;  4M9N A;  1SZH A;  4R8U B;  2I9G A;  1KL9 A;  4QZC A;  4OJO A;  1Z4O A;  3Q8L A;  3RH6 A;  2JHD A;  3LWL A;  2G06 A;  1L3T A;  4F5Q A;  5J0Q A;  5KT7 A;  4MFC A;  5KFR A;  4F4W A;  2E8N A;  4DFK A;  2C28 A;  2F1J A;  2IBK A;  4CNQ A;  4F5N A;  5KTQ A;  3D2N A;  4DS5 A;  5IIM A;  4DSK A;  4NLG A;  2V4R A;  3MDC A;  4QZ9 A;  2I5H A;  1Z4N A;  4NM1 A;  4YN4 A;  4IQW A;  4G9B A;  4F4K A;  3BS5 A;  2E1F A;  4Y2T A;  3CRX A;  2WHE A;  3PSP A;  4I2A A;  4RU9 A;  8ICL A;  5ALL A;  2B0C A;  1B4F A;  3ALR A;  5AKL A;  1A6S A;  1NJZ A;  2HOI A;  9ICC A;  2BPF A;  5C0Y A;  5KFA A;  1NZP A;  2XVT A;  1XSN A;  2W8K A;  2DQN B;  4UAS A;  1BNP A;  4CE6 A;  1NI3 A;  2ZXI A;  3PMN A;  2GO7 A;  3MFI A;  3SEN A;  4UBB A;  4MFA A;  1SV0 C;  1SL0 A;  1SXD A;  4DQQ A;  1HUZ A;  3TAN A;  3OHB A;  3IG5 A;  4NM2 A;  3M1Y A;  2ZTD A;  5G5G A;  2M9N A;  2WFA A;  3TFS A;  2KSO B;  9ICM A;  3SI8 A;  4KTQ A;  5J0X A;  5KAI U;  1ZET A;  2OWO A;  9ICH A;  2OCE A;  2YB1 A;  5AIA A;  2W3S A;  4YD2 A;  3ISD A;  9ICF A;  4I2G A;  3KHG A;  4JK1 A;  4FBT A;  4QWB A;  4AYB F;  4LVS A;  4EZ9 A;  1N60 A;  4BWM A;  1OUQ A;  5EWE A;  3SZ2 A;  1N48 A;  4KMO B;  5J2H A;  3E58 A;  4RT3 A;  1NZB A;  1DRG A;  2HHW A;  4ECX A;  1Z00 B;  3KKA C;  4DLG A;  1WWV A;  4BUG A;  1UHU A;  5D46 A;  4EZ6 A;  1L7P A;  4JUZ A;  1QCK A;  3NVW A;  4HYK A;  4YQW A;  1J2M A;  2KP7 A;  4RQ5 A;  2KK0 A;  2LYB A;  4BX9 C;  1WCN A;  4ELU A;  4QNL A;  1BPY A;  4DFJ A;  1KBU A;  5HR6 A;  2KIC A;  5KFT A;  5L1J A;  4DL2 A;  4B9N A;  1RXV A;  3Q8P B;  1K5O A;  1FFU A;  2XIC A;  4QZA A;  3F5A A;  3RAQ A;  5KFH A;  9ICN A;  2ASL A;  2YQE A;  4NY8 A;  2KMD A;  1TAQ A;  2YMM A;  5KG5 A;  3SV3 A;  1X6I A;  4GIB A;  3MFH A;  3IRU A;  4GXJ A;  4PL1 A;  2W04 A;  2BPC A;  4YR2 A;  4BGD A;  1UA1 A;  2RDI A;  3BDP A;  5HMM A;  2G5I B;  1NK0 A;  4KN4 A;  2CN1 A;  4B9M A;  4YMN A;  3Q8M A;  4RZR A;  2UVU A;  3OJU A;  1P7D A;  4I28 A;  2JH7 A;  3RB0 A;  3H40 A;  1KW4 A;  7ICO A;  3PSF A;  2K8B B;  4QZH A;  2PFP A;  7ICJ A;  5KFC A;  7ICG A;  2F3N A;  4DEZ A;  5HML A;  3RJE A;  4GLX A;  8ICO A;  2K60 A;  4KLL A;  4TUP A;  2VAN A;  1M6Y A;  5ALI A;  4Y2U A;  5AIB A;  4RUA A;  4O5K A;  3JPO A;  4Q8E A;  2NO5 A;  1ZQF A;  1ZQS A;  2HHT A;  3M8S A;  3H8J A;  3BQ0 A;  5JU5 A;  4TQR A;  3AUO A;  1N5X A;  2W9A A;  1DK2 A;  5KFS A;  4DQI A;  3MBY A;  4YMO A;  5EE9 A;  5DG7 A;  1ZQW A;  3RH4 A;  1TE2 A;  3CYM A;  1CRX A;  3IM1 A;  4F72 A;  5AM4 A;  4ELV A;  2AGQ A;  4U6P A;  3RJG A;  2A1J A;  1SB3 C;  4EX7 A;  1L3V A;  3RJJ A;  3DEE A;  3LVV A;  5ALT A;  1L3S A;  2LM4 A;  4ACO A;  4AP9 A;  3JPP A;  4F5R A;  4UAT A;  3PZP A;  4PGX A;  5ALS A;  4M9L A;  5JRT A;  5AK5 A;  2ALZ A;  4F4Z A;  4F8R A;  1ZRN A;  5DBA A;  4O3Q A;  2DBY A;  2KEY A;  9ICQ A;  1ZQX A;  1JX4 A;  3LVW A;  3PW2 A;  2CRX A;  4JB3 A;  4FBU A;  4MF8 A;  4Y2J A;  3C1Y A;  4PHA A;  4XRH A;  1KQQ A;  1S0N A;  3UMC A;  1XNS A;  4Q43 A;  4M9G A;  4NV0 A;  4I2C A;  4UW9 A;  3Q8K A;  4KMU A;  4Z6F A;  2M0N A;  3ZDC A;  5AK6 A;  1MN8 A;  1BPE A;  4UB3 A;  1KFD A;  4X5V A;  2BDU A;  2HBK A;  4RQ6 A;  4JV1 A;  4TQS A;  1X40 A;  2ZXH A;  3UQ2 A;  4IL6 U;  1DGJ A;  2PI5 A;  1SL2 A;  2FMQ A;  1KKX A;  1X9M A;  1KSP A;  4RUC A;  2HMX A;  3BQ2 A;  1UA0 A;  4IRD A;  2OHF A;  2XCP A;  4Y2S A;  1RG6 A;  5KAF U;  1ZQQ A;  8ICU A;  7ICL A;  1V9P A;  3NTU A;  1KLN A;  1NK6 A;  3FYH A;  3RJK A;  2F2A B;  3IN5 A;  1F0M A;  5KT6 A;  2R8I A;  1PZN A;  4MHV A;  3IHQ B;  2W9B A;  4KLF A;  3KZX A;  4J03 A;  4O5C A;  4KLQ A;  4DOC A;  2MUT B;  2FE9 A;  3PW7 A;  3OSN A;  4R65 A;  3PR5 B;  2KHQ A;  4I2H A;  2OEH A;  4DSL A;  1ZQN A;  3BS7 A;  3JPQ A;  3WK9 A;  3C23 A;  3ISB A;  3MR6 A;  2FMS A;  4O3P A;  2HHU A;  2V4Q A;  2QLT A;  4F71 A;  1T4G A;  4MEX A;  1X6J A;  3LYS A;  1SKW A;  5B66 U;  3V7K A;  4NJ8 A;  2ZIW A;  4F93 B;  2QB0 A;  4PHE A;  3I76 A;  5AK4 A;  3LWM A;  2BGW A;  7ICR A;  1D8L A;  5ALV A;  1URJ A;  2JEG A;  3AU2 A;  5KNI A;  2LYH A;  3TAP A;  4QZI A;  1ZJN A;  3SMV A;  3PX0 A;  4C7Y A;  3RBE A;  3WKA A;  2KG5 A;  1D9F A;  5KFL A;  7ICS A;  4DOA A;  2XGP A;  4KLD A;  4C8K A;  1PK3 A;  4YVZ A;  2BCR A;  1RZT A;  1Q3U A;  2HVI A;  4O3R A;  2NRV A;  1L3U A;  3N97 B;  9ICB A;  3I28 A;  5ALG A;  2HBM A;  2PFN A;  5ALF A;  2J6S A;  4M0A A;  3M6K A;  2AU0 A;  1BPB A;  1S10 A;  3C5F A;  2C2D A;  4J9K A;  1TK5 A;  3SEI A;  3RB3 A;  2LYA A;  1U48 A;  5ALO A;  4RPY A;  9ICL A;  1WUD A;  1S8O A;  5HNK A;  1QQ6 A;  5J2D A;  3QU9 A;  3QUC A;  8ICQ A;  1VDV A;  1FO4 A;  4EEK A;  4KLJ A;  2EQY A;  3K1R B;  4QWD A;  3JPT A;  2QB0 B;  3PW5 A;  2XY5 A;  2V9W A;  3F2C A;  5AM5 A;  2C22 A;  4IR1 A;  1YZ7 A;  2LI6 A;  2E3T A;  2JEJ A;  3K1Z A;  2EAO A;  3HIL A;  5J0O A;  1NJW A;  1WG8 A;  5KT4 A;  2HI0 A;  8ICK A;  1L7N A;  1NK7 A;  2J6U A;  4AYB C;  2C2E A;  7ICH A;  5KL8 B;  5KFZ A;  1TFR A;  4QIW C;  1QTM A;  2PMZ F;  4NLC A;  2Y1I A;  3GV7 B;  3ORY A;  2LM1 A;  3MDA A;  2PXI A;  4BDP A;  2XY7 A;  1ECW A;  2JH1 A;  4DL6 A;  2AGO A;  1X9S A;  1KRP A;  3TFR A;  4NLZ A;  2EAP A;  8ICF A;  1KN5 A;  1PVR A;  4PL2 A;  4ECW A;  3HRD D;  3WK8 A;  2F1H A;  4Y2Y A;  5ALX A;  4CF4 A;  2O6K A;  4GXK A;  1ZQJ A;  1JI7 A;  4ZOH C;  3PX6 A;  4DL3 A;  3RTV A;  3RJH A;  9ICE A;  4EYI B;  3WKC A;  4IR9 A;  3F2D A;  4CF5 A;  2OM6 A;  4B9S A;  4CRX A;  2E8M A;  4MFF A;  4ECS A;  4I2I A;  1SKR A;  4B9U A;  4UB2 A;  5DGA A;  5L1K A;  4F50 A;  5KFX A;  2FPM A;  1HIW A;  8ICW A;  3NRW A;  3GIL A;  2VA8 A;  3L5K A;  8ICE A;  1Z19 A;  1NK4 A;  4YCX A;  2KJ9 A;  4M9J A;  3BS5 B;  5KL1 B;  3SD7 A;  4C8L A;  5FP0 A;  2BZF A;  2KVS A;  3S6J A;  2MUT A;  2W3R A;  4UAU A;  3N7R C;  5G5H A;  2Y0S F;  5J0W A;  7ICN A;  4IS7 A;  4UQG A;  3F5E A;  2PI4 A;  2KZM A;  3H8S A;  4C4R A;  2JGA A;  1T3N A;  1Z3E B;  3N7S C;  1ZQU A;  4DL7 A;  4UB4 A;  5KFP A;  2YB4 A;  4YXM A;  5DG9 A;  5AKK A;  3I1Y A;  3V72 A;  5KFE A;  3VC8 A;  4KLT A;  1FIQ A;  1HEK A;  4R8U A;  2GOL A;  5AKH A;  4F5P A;  3SQI A;  2DPI A;  3PW4 A;  3QEA Z;  2HOF A;  2HBL A;  4O3M A;  4EEL A;  5DKW A;  2IOF K;  1NKC A;  4RQ1 A;  3QNM A;  3H4D A;  3H0R B;  5DLF A;  1Q8K A;  2GWS A;  4UAV A;  8ICP A;  4YP3 A;  1B0X A;  4F4Y A;  5KFQ A;  2ZJ8 A;  2W9C A;  5DBB A;  1ZD3 A;  2JZB B;  3F2B A;  3ISC A;  4R63 A;  2N1R A;  4I29 A;  3ETR A;  3PY8 A;  3EZ5 A;  2F76 X;  1ZXI A;  4RPX A;  1OXJ A;  1XU4 A;  9ICU A;  3C2M A;  3PX4 A;  5J2A A;  2ZG6 A;  5KG6 A;  3GIM A;  2I6X A;  2MA1 A;  3NVY A;  4JWN A;  9ICP A;  2XY6 A;  3NGD A;  2Y0S C;  1J97 A;  4DSI A;  4BXO A;  9ICA A;  4NL9 C;  2Q4T A;  3Q8S B;  5JUM A;  3HKZ F;  5J2K A;  3RJF A;  1ZQA A;  3KHR A;  3C29 A;  2H3V A;  3TAR A;  3RAX A;  1NJX A;  3AU6 A;  4P4P A;  2EDU A;  5J2C A;  4KX5 A;  5KFK A;  1K1Q A;  3QZ7 A;  1V38 A;  2RP5 A;  2KSO A;  1ZQD A;  2NRT A;  4M04 A;  4O0I A;  3THV A;  2RQ5 A;  8ICC A;  3D6J A;  4MF2 A;  4DS4 A;  2H3Z A;  1ZD5 A;  2KIW A;  3QE9 Y;  1ZQK A;  1L8O A;  1NK8 A;  2QKQ A;  4NLN A;  3EUB 2;  2ZJ5 A;  2YMP A;  1ZJM A;  1LV5 A;  2R8K A;  8ICN A;  3DDH A;  3UXN A;  3ZDD A;  1T3Q A;  2FMP A;  3EYZ A;  1S0O A;  4PPX A;  1FEZ A;  4NXZ A;  1TVA A;  1C20 A;  3B9J A;  4F92 B;  4EEY A;  2KFZ A;  1U49 A;  5KT3 A;  1SL1 A;  1MQ2 A;  1PVP A;  2KHV A;  3PR4 A;  2YMQ A;  2W8L A;  3EWA A;  2H3I A;  1CUK A;  3MGV A;  4QWA A;  4J9S A;  2UVV A;  1NK5 A;  4GXI A;  1N2X A;  2HHQ A;  2KVC A;  3IP4 B;  4P0P A;  2HHS A;  2HCF A;  1RYR A;  4F5O A;  1H38 A;  2DGZ A;  1DOQ A;  2R8G A;  1LB2 B;  2OH2 A;  3IV6 A;  4YXJ A;  2AJQ A;  5ALJ A;  4R64 A;  1N5W A;  2KV2 A;  4J9O A;  4C8O A;  5ALD A;  3PO4 A;  1COK A;  1RXW A;  1BPD A;  2CPR A;  1XO0 A;  2F1I A;  1U47 A;  1S0M A;  4EBE A;  4R66 A;  2RHF A;  3KZI U;  2OYY A;  5ALW A;  1RM6 C;  2G09 A;  3HT3 A;  2XC9 A;  3FDS A;  7ICK A;  2BQU A;  1X9W A;  1N62 A;  3PV8 A;  3AN1 A;  3GV5 B;  1NK9 A;  2KFN A;  2A19 A;  2P35 A;  4F3O A;  1X66 A;  2R18 A;  2JEF A;  4DWI A;  4DFM A;  5KT2 A;  8ICR A;  3UPQ A;  4O5E A;  3C28 A;  4ELT A;  4CDG A;  2HOQ A;  3OPX A;  2K4P A;  5KG2 A;  5AKX A;  5J0R A;  5ALR A;  3H7I A;  5AM3 A;  4QZE A;  2KZZ A;  4RQN A;  1MSW D;  3DV9 A;  3GDX A;  2K4E A;  1RQL A;  3IG8 A;  5ALQ A;  1D8Y A;  3NS1 A;  4YMM A;  2FJ6 A;  2PMZ C;  5KFI A;  4CCH A;  5BOL A;  1Q46 A;  4ECU A;  4P0Q A;  4DCC A;  2ZUB A;  2EH9 A;  4C0Z A;  4RQ3 A;  1TK0 A;  4US8 A;  2ZIV A;  2AHO B;  7ICI A;  2D3D A;  4ECZ A;  1WYG A;  4C7Z A;  2WB1 F;  5EE1 A;  4RT2 A;  3UMG A;  5K4L A;  1IG6 A;  1ZQZ A;  3HPO A;  4QZG A;  4DSF A;  3RF9 A;  1L7O A;  2PFO A;  4YR3 A;  5HHI A;  1UQV A;  3FAH A;  4QWC A;  3BJY A;  5DG8 A;  1DXS A;  1X42 A;  2DF4 B;  2VKQ A;  3CP8 A;  1SZP A;  4I2E A;  8ICX A;  1S97 A;  2Q0Z X;  2ZIW B;  2VIX A;  4UAW A;  1RDF A;  3GZF A;  4RNO A;  4EEN A;  3D2S A;  3ZI4 A;  3QUQ A;  3H4B A;  3RRG A;  4NL9 A;  5C5J A;  3L3F X;  3QXG A;  5ALZ A;  5H2F U;  7ICE A;  3GIK A;  4UB5 A;  2HHX A;  3B0X A;  4GC6 A;  4FZN A;  5AI6 A;  2XID A;  4RNM A;  3RJI A;  2G07 A;  3C1Z A;  2NO4 A;  9ICI A;  2KKP A;  4YG2 A;  3HP6 A;  1O03 A;  2GLE A;  5KFU A;  3G6X A;  4YFK A;  2IA6 A;  4NLK A;  5AK3 A;  1F5S A;  4US9 A;  4GC7 A;  1SXE A;  1IXR A;  4RQ4 A;  2KKV A;  3K75 D;  2W03 A;  4C4T A;  3TAD A;  4G3I A;  1Z1V A;  5IIK A;  1HJP A;  5ALP A;  1X9X A;  2EZY A;  5AM0 A;  2LKY A;  2K4H A;  3QUB A;  1MC8 A;  4PZO A;  3E2E A;  1ZYQ A;  1PK1 B;  1UCV A;  2WAQ F;  2KTQ A;  3KD3 A;  4U7C A;  4Y2P A;  1JUD A;  3WKD A;  2G08 A;  1QH9 A;  1PUZ A;  3M9O B;  2EZZ A;  3LK9 A;  2F8K A;  7ICP A;  2MU2 A;  4QZD A;  5CB1 A;  5J0U A;  5L1M A;  4XUS A;  4KLM A;  1ZQC A;  1XSL A;  4KLU A;  1KFT A;  3K4G A;  3C2K A;  4ED3 A;  5J0P A;  2BQ3 A;  4F2R A;  2B6G A;  2Z7J A;  5EE3 A;  5AKE A;  3L4P A;  4OJP A;  5KFG A;  3BQ1 A;  4ED1 A;  4J9P A;  4DL4 A;  2NRW A;  4B9V A;  5KFW A;  2NYV A;  2Y1J A;  5DQI A;  4DF4 A;  3JPR A;  5J0S A;  3AL0 B;  3WK7 A;  2XCA A;  3HWT A;  4EBD A;  4XQ8 A;  2KN7 A;  2FLP A;  4UAZ A;  5CJ7 A;  5ALM A;  1L6N A;  2NRX A;  9ICJ A;  4UAR A;  1QSS A;  4CGZ A;  4IQT A;  2HDO A;  3ZDE A;  4C4S A;  1LKY B;  1ZQL A;  1BPZ A;  1N56 A;  4M6W A;  4M9H A;  4K4G A;  5F9N A;  7ICQ A;  1IM4 A;  4IQU A;  2EAN A;  2KE7 A;  3MR3 A;  5J0Y A;  1N63 A;  3T5H A;  3EPG A;  4F91 B;  1ZQ1 C;  9ICR A;  1NNL A;  2PKE A;  3EPI A;  4YR0 A;  2ISO A;  2ZIX B;  4UB6 U;  5ALY A;  2FPL A;  2WAQ C;  4KIT B;  3WK5 A;  1NJY A;  2KNJ A;  5EWF A;  1FFV A;  3TAC B;  2JR5 A;  1ZQO A;  2K8C B;  1IIP A;  2YX8 A;  4KLG A;  2GH1 A;  2HBJ A;  3KBB A;  3OTQ A;  4JV2 A;  2BQR A;  1A76 A;  2JV3 A;  1T8E A;  2W9M A;  4OJ5 A;  2VJ5 A;  5J2I A;  3RBD A;  2XGQ A;  4QWE A;  4ZH4 A;  5GTI U;  1TK8 A;  2KIV A;  2Y9T A;  3NVV A;  1RQN A;  2C2R A;  3V7J A;  4ED7 A;  4Y2Q A;  5AI9 A;  3QUT A;  2QAR B;  2UVR A;  3LDA A;  2FPK A;  4JWM A;  1QQ5 A;  3FC4 A;  4IRK A;  3QZ8 A;  4LZD A;  1B22 A;  2W9C B;  5AI0 A;  1T94 A;  1V85 A;  2BR0 A;  5J2G A;  3KOO A;  9ICV A;  5KFY A;  3PST A;  2P6U A;  4OCZ A;  5KFV A;  3TKA A;  2DFL A;  1F44 A;  3AM9 A;  1ZQM A;  3C21 A;  1BPX A;  4P4O A;  4ED8 A;  4ECQ A;  4DO9 A;  3RH5 A;  3GQC A;  2I1Q A;  3V6J A;  2YN4 A;  1GO3 F;  1U4B A;  9ICO A;  5EE0 A;  2WTF A;  4HAI A;  5CP2 A;  3SYZ A;  5DB7 A;  4JV0 A;  1S77 D;  1KTQ A;  2CXY A;  1NKB A;  2MRL A;  3N28 A;  1ZQE A;  3UM9 A;  2BCU A;  2D8C A;  3D2Q A;  5L1I A;  2ZTC A;  4TUR A;  1NKE A;  8ICT A;  2RLT A;  1ZQP A;  2IOF A;  1T7P A;  5J8Y A;  4QZF A;  3V7L A;  5CHG A;  4I2F A;  3PML A;  2H5X A;  1ZOL A;  2VA2 A;  4KLO A;  4Y2V A;  1XS9 D;  5AM2 A;  3PNC A;  3TAQ A;  3KKA A;  4WJ3 B;  4Z6E A;  1S0V A;  1KEJ A;  4I2J A;  3T79 A;  5DQG A;  5F9L A;  1JXE A;  1L5U A;  4I2B A;  4USA A;  4KLS A;  2ASJ A;  3OSP A;  3OJS A;  2YML A;  3PW0 A;  4P2H A;  1ED1 A;  2W55 A;  5HR7 A;  1A77 A;  2WF7 A;  5CEH A;  1LVH A;  5KFM A;  3G6V A;  3M8R A;  3UXP A;  4IQV A;  7ICT A;  5AI4 A;  2JZB A;  2FLN A;  4Z6C A;  3Q8Q B;  2A3V A;  3H8M A;  3MC1 A;  4O3O A;  2F8L A;  1O08 A;  2H3F A;  4ECY A;  1L8L A;  2NV3 A;  3BQ7 A;  3OGU A;  3C5G A;  2WF8 A;  7ICU A;  3T5J A;  1CEZ A;  2BCV A;  5AI5 A;  2QAR A;  4QW8 A;  4K4H A;  4FE3 A;  1JXL A;  2ES6 A;  1U9L A;  5J0T A;  3RR7 A;  1D9D A;  2IMW P;  4PJ0 U;  4QIW F;  1SWV A;  5CR0 A;  3TI0 A;  1SKS A;  5J2J A;  3MGI A;  4Y2R A;  5DB8 A;  4J9N A;  4QZB A;  3TAD C;  3HJE A;  4IRC A;  1A0P A;  4ED0 A;  2P6R A;  5BPC A;  2DL0 A;  5EOZ A;  1ZD4 A;  3PVX A;  3T5L A;  2F44 A;  1HUO A;  3F53 A;  2P66 A;  3IDW A;  5L1L A;  1ZQB A;  3GU3 A;  5D49 A;  2YTU A;  4ECT A;  4KLI A;  4YD1 A;  5DDM A;  4DFP A;  1RYU A;  2KJ8 A;  1UPH A;  3O0F A;  4RQ7 A;  5KFN A;  1ZQY A;  4P0Q B;  4M6W B;  5DGB A;  3HX0 A;  1LKY A;  4DFD A;  1Z1B A;  1UT5 A;  2W7P A;  2LMR A;  5AIC A;  5J2E A;  4LZG A;  5EWG A;  3NRZ A;  2LHT A;  1SIJ A;  5L9X A;  5KFD A;  5IIJ A;  4QZ8 A;  3B0Y A;  2ZUD A;  4UBC A;  3WKE A;  3AQE A;  4DLE A;  4J9M A;  5DDY A;  3T5K A;  4A8E A;  3QU2 A;  4DQS A;  1QSY A;  1JRP A;  5AM1 A;  5DQH A;  5KFO A;  7ICV A;  4Q44 A;  5D4B A;  4RNN A;  3ZDA A;  2E8P A;  5KG4 A;  2HSZ A;  4FZL A;  4ED6 A;  2B21 A;  2Y9U A;  1SWW A;  2BHN A;  2F77 X;  4Y2X A;  5J8Y C;  2ISP A;  1NOM A;  4QW9 A;  3H0M B;  4J9L A;  3HKZ C;  2FDR A;  2J6T A;  2KOB A;  2ZIV B;  2DPJ A;  4OJ6 A;  4RQ2 A;  2W9B B;  3SAG A;  2JXJ A;  3SV4 A;  3UQ0 A;  5KG0 A;  3KHL A;  1ZQT A;  4O3S A;  2ZIU A;  9ICG A;  5J2F A;  5A0L A;  8ICA A;  5AKZ A;  1XWL A;  2RRD A;  1SV4 A;  2PFQ A;  1JN3 A;  1U45 A;  2A1A A;  5KG7 A;  5III A;  2W7O A;  1BGX T;  2DKX A;  5TIS U;  4QJF B;  5KT5 A;  1DGS A;  4P4M A;  2D6F C;  4LJX A;  4MEY A;  3TQ1 A;  8ICJ A;  1ZRM A;  2IHN A;  3QEB Z;  1K1S A;  1QSL A;  2EAM A;  4BXO B;  5B5E U;  1X2I A;  2W11 A;  4EX6 A;  2E5S A;  5CA7 A;  5DB9 A;  1EXN A;  3BQT A;  1S5L U;  5ALH A;  2XI9 A;  4DOB A;  2G5H B;  5DB6 A;  1MA7 A;  3MR2 A;  2ATL A;  4DL5 A;  3CNH A;  2FI1 A;  2EZX A;  4FO6 A;  4B6J A;  3V6K A;  3Q8R B;  2WF9 A;  2AH5 A;  2K4I A;  3GFK B;  1VJ5 A;  3MAB A;  3AQF A;  5KFB A;  4FS2 A;  4KLE A;  1ARO P;  4RQM A;  2BDP A;  3UMB A;  4DQP A;  3RR8 A;  2JRZ A;  2E1E A;  3SAH A;  4KLH A;  3NUQ A;  2ZIX A;  2OXO A;  5CWR A;  2JEI A;  4Q8F A;  5F3X B;  2R8H A;  3JPN A;  3VCB A;  3MGH A;  3R9K A;  3J81 j;  1N61 A; 
#chains in the Genus database with same CATH homology
 1ZQ1 C;  1ECW A;  2JH1 A;  2MRL A;  1A6S A;  4QIW F;  5C0Y A;  4IC9 A;  2XVT A;  2KOB A;  2ZIV B;  4PL1 A;  3D2Q A;  2KKV A;  2W04 A;  2WB1 C;  2DQN B;  2ZIX B;  1URJ A;  4OJ6 A;  2H3Q A;  1PVR A;  2W03 A;  3H0R B;  4PL2 A;  3SAG A;  2KEY A;  2ZXI A;  2WAQ C;  2G5I B;  2VJ4 A;  2KJ5 A;  4P0P B;  4BJQ A;  3LVW A;  1PVP A;  2CRX A;  2LKY A;  2K4H A;  2K4E A;  2KHV A;  3SMV A;  2CN1 A;  3E0F A;  2H3I A;  2ZIU A;  2KNJ A;  3F2B A;  1A0P A;  3MGV A;  1Q3V A;  2KD1 A;  3IG8 A;  2N1R A;  3IG5 A;  5A0L A;  1P7D A;  3F2D A;  2OM6 A;  2K8C B;  1XNS A;  2JH7 A;  1IIP A;  2YX8 A;  1Q3U A;  2F76 X;  4CRX A;  4WJ3 B;  2PMZ C;  2KVC A;  3H0L B;  3IP4 B;  2GH1 A;  2RRD A;  3F53 A;  2HBJ A;  2WAQ F;  2K8B B;  3PSF A;  4FZM A;  4P0P A;  1D8B A;  2M0N A;  3T79 A;  2K8A A;  4U7C A;  2DGZ A;  2G08 A;  3GU3 A;  4P0Q A;  2W7O A;  2G0A A;  2OH2 A;  4QJF B;  2D6F C;  2HBM A;  1HIW A;  4C0Z A;  1YT3 A;  2BDU A;  2ZIV A;  4OJL A;  2HBK A;  2VJ5 A;  3NRW A;  2YB1 A;  2KJ8 A;  4OJ5 A;  3M6K A;  2ZG6 A;  1UPH A;  2KV2 A;  2ZIU B;  3O0F A;  2ZXH A;  2MA1 A;  1Z19 A;  2K89 A;  4AYB F;  2WB1 F;  3SAF A;  5CRX A;  4NV0 A;  2LYA A;  4P0Q B;  4GFJ A;  2KJ9 A;  2E5S A;  1SZH A;  1OUQ A;  2Y0S C;  2Z7J A;  4KMO B;  1WUD A;  1ED1 A;  3RF9 A;  1Z1B A;  3N7P D;  4OJO A;  2CPR A;  5HR7 A;  1DRG A;  1NZB A;  2W7P A;  1XO0 A;  3M7D A;  5KL1 B;  4OJP A;  2JHD A;  2LHT A;  2Q4T A;  2DF4 B;  2VKQ A;  2XI9 A;  3CP8 A;  2HMX A;  2G5H B;  3ONN A;  3HKZ F;  1MA7 A;  4BUG A;  2G06 A;  2ZIW B;  2RHF A;  2VIX A;  3C29 A;  3F2C A;  4OO1 J;  2OYY A;  2H3V A;  2JMG A;  1T94 A;  3GZF A;  3CYM A;  3N7R C;  2G09 A;  2Y0S F;  3D2S A;  2A3V A;  3AQE A;  3PST A;  4KX5 A;  5T14 A;  1CRX A;  3M6Z A;  2K4I A;  2RP5 A;  2LYB A;  2F2A B;  4BX9 C;  3IN5 A;  4JMU A;  3F5E A;  1F44 A;  4A8E A;  3AQF A;  3K1Z A;  3AL0 B;  4QNL A;  3KZX A;  3L3F X;  4U6P A;  1KBU A;  2JGA A;  3D2N A;  2F8L A;  5HR6 A;  2KIC A;  3N7S C;  2H3F A;  2H3Z A;  2NV3 A;  2KHQ A;  2LBO A;  3DEE A;  3LVV A;  2R18 A;  2KIW A;  4AYB C;  3ICX A;  1L6N A;  1TAM A;  3RFA A;  4FZN A;  2YB4 A;  5KL8 B;  2XIC A;  1GO3 F;  2PMZ F;  4QIW C;  2XID A;  3PSI A;  4NWI A;  4FZL A;  4CGZ A;  3KFU F;  2E1E A;  3F5A A;  3SAH A;  4NLC A;  2G07 A;  1PVQ A;  4NLB A;  2E1F A;  3NUQ A;  3VC8 A;  1HEK A;  4ACO A;  3C28 A;  2ZIX A;  2KKP A;  3CRX A;  2GOL A;  2OXO A;  4CDG A;  3PSP A;  4FE3 A;  3SQI A;  4ICA A;  4KX3 A;  3LYS A;  2F77 X;  3VCB A;  3PZP A;  3ALR A;  2HOF A;  2HBL A;  2ZIW A;  2HOQ A;  4O3M A;  3OPX A;  2HOI A;  3H0M B;  3HKZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...