2LYBA

Structure of hiv-1 myr(-) matrix protein in complex with 1,2-dioctanoyl-sn-phosphatidyl-l-serine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trio engagement via plasma membrane phospholipids and the myristoyl moiety governs HIV-1 matrix binding to bilayers.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
molecule keywords Matrix protein p17
total genus 35
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lybA01
1UPHA 4ICAA 1TAMA 2JMGA 2K4EA 1L6NA 2LYBA 2H3IA 2LYAA 2K4HA 1A6SA 2H3FA 1HEKA 2H3VA 1HIWA 1ED1A 4JMUA 4IC9A 2HMXA 2H3ZA 1ECWA 2N1RA 2NV3A 2H3QA 2GOLA 2K4IA
chains in the Genus database with same CATH superfamily
3PX0A 5DBBA 9ICBA 1XSLA 4P4PA 4ECXA 4F5RA 3RH4A 4QZ8A 5AI5A 3QX7A 2YTUA 4DCCA 1AQ6A 2XIDA 2ALZA 2IA6A 3RJHA 4YMNA 3GV8B 4ECSA 2KOBA 3RB4A 4KN4A 3TACB 4C7ZA 2K60A 4RQMA 3VCBA 9ICJA 2FMQA 5JRTA 2HSZA 5ALMA 2DFLA 2BKEA 2VJ5A 4UAWA 5ALJA 4KLJA 1ZQZA 7ICKA 4ECYA 3RFAA 4OD0A 8ICHA 2QARB 3IN5A 1TVAA 2LPEA 4Y2QA 8ICBA 2YX8A 3BS7A 3L5KA 1N60A 4KLHA 1OW5A 3LVVA 1XNSA 1Q3VA 2Y1JA 3F5EA 2LKYA 4J9RA 1U9LA 5KT3A 3WK6A 4DOAA 2I1QA 3G6YA 5KFUA 3QE9Y 3F53A 3T5LA 8ICRA 4M04A 4DLEA 2PFNA 3ETLA 5CWRA 2C2RA 8ICTA 4NXZA 3M9NB 3RR8A 3F5AA 1XC9A 2F1HA 3HWTA 3WU2U 4X5VA 2DUYA 2W54A 4M6WB 3V6HA 1WWVA 1ZQHA 3RTVA 5KFEA 2XC9A 2BCQA 4RQ3A 3THVA 3KOOA 1ZD3A 4YCXA 8ICSA 3OGUA 5AI4A 4DL7A 1JRPA 2E1FA 2ZIUB 4F91B 4B6JA 5F9LA 2HHTA 3A0HU 1J97A 5IILA 3C23A 2KG5A 1ZQMA 3H0RB 4GC6A 2ISPA 2ASLA 2QLTA 3NTUA 1JI7A 3EUB2 2KN7A 1IXRA 5KTQA 1NK6A 4O3PA 3T5KA 2VANA 2KICA 4Q8FA 4YR0A 2R8IA 3L4PA 2ZJAA 3SV3A 2BCSA 3K1ZA 4FE3A 3C5GA 4P2HA 4FZLA 1SZPA 3IHQB 3QU5A 4NM2A 2F44A 3SD7A 5DG8A 4EZ9A 1COOA 2W9AA 3PO5A 4F4ZA 7ICEA 1F0MA 1SXEA 4KLEA 4DL4A 3H0MB 1WWUA 2WHEA 1JXLA 2UVRA 5KFBA 1QQ6A 3CP8A 2O6KA 1NK5A 2P6UA 4KLMA 1V97A 2W7OA 3ZDEA 2Y1IA 2QB0B 2K4EA 4TURA 4QZEA 5IIKA 4BGDA 2EZXA 3OSNA 4M9GA 5KFNA 1SKRA 1HJPA 3M6ZA 4YMOA 1COKA 2KJ9A 3H4DA 4DOCA 4PJ0U 4QWAA 1JIHA 4ED6A 3ED5A 4DQPA 4IR1A 1L3SA 2A19A 3ZDCA 3WKCA 4IQWA 3QU7A 4KMUA 3ZD8A 5AIBA 8ICNA 2XGPA 3HX0A 2HCFA 3KZXA 4R8UA 5KL8B 2FE9A 4EX6A 5CP2A 5IIIA 1S0NA 5KFLA 3BQ0A 5H2FU 2JEJA 1KEJA 1TKDA 2QB0A 4ELUA 5F9NA 3JPNA 1Q3UA 4ICAA 2VA8A 2JHDA 5ALSA 4FBTA 2PMZF 1QSLA 1A0PA 2L5YA 2DF4B 1HIWA 3BQ7A 3KBBA 2EANA 3GIKA 3B9JA 1RXVA 3IRUA 5BPCA 5DQHA 1TK0A 4J9QA 2W8LA 9ICIA 2KEYA 3ZDAA 4ECTA 2JMGA 4F4XA 5KT5A 1S9FA 1UCVA 3MR2A 3SZ2A 1X9WA 1P7DA 2EAMA 5KAIU 2C22A 2KJ5A 2ZXIA 4QWCA 2NRVA 4R63A 3TADA 3RH5A 2Y0SC 4MF8A 4YR3A 1ECWA 3I76A 3MC1A 4BWJA 4HYKA 5J2GA 4RPZA 2V4RA 5KG0A 3BDPA 3AN1A 4F4YA 2DWQA 2KKPA 1DOQA 2WF7A 4YFKA 4QWBA 1ZQDA 4QWDA 2KNJA 5DB7A 2FMSA 4QZAA 4RT3A 5C5JA 1C7YA 3RF9A 1LB2B 3TFRA 2HOFA 2GOLA 3QUBA 3BS5A 4YXMA 9ICSA 4DF4A 3DDHA 4I2AA 3C2MA 3SAHA 3JPTA 2AGQA 1T8EA 3PZPA 1KRPA 4RQ2A 2K8BB 4YG2A 5FP0A 5AKYA 2HI0A 4IQUA 5J2AA 1BPDA 2I5HA 5EE1A 2E1EA 4G3IA 2FPKA 4DOBA 3ZD9A 2C2DA 5GTIU 7ICHA 2C28A 3RJIA 5B5EU 2K4PA 5KG3A 2I6XA 5DKWA 2MSNA 4F4KA 3K4GA 2G08A 4LZDA 1ZQIA 3F2BA 4KLDA 4F3OA 3GQCA 3QZ8A 4JWNA 2IMWP 1ZQGA 1SIJA 1S0OA 3H40A 3G6XA 2V9WA 3EWAA 3IG8A 5J0XA 4ELTA 3M9OB 2WF9A 7ICNA 4UW9A 3WKEA 2HHSA 5HMLA 4M47A 2EQYA 4O5CA 4O5KA 2XCAA 4C7YA 3TARA 1SWWA 4EELA 3RJEA 9ICQA 3PX4A 2F8LA 5F3XB 3SYZA 2F1IA 1Q46A 5ALEA 1HUZA 3AM9A 3BQ1A 3WK9A 7ICFA 1ZD5A 4CDGA 4I2BA 3ISCA 1L3VA 4BJQA 2R8JA 4I2IA 4Y2UA 2BPFA 4J9LA 2PI5A 1N2XA 3M8RA 1UA0A 1OUQA 5AKZA 4ZH4A 4F4WA 2C2EA 3KZIU 3RB0A 8ICPA 1WG8A 5KFAA 1Z1VA 5KFPA 5J0QA 1SL1A 1VDVA 2ZIXB 4QIWF 5KFDA 4C8MA 2JH1A 3OTQA 3Q8LA 4J9PA 1VJ5A 4C4TA 4ECWA 9ICEA 5KG2A 3JPQA 4GC7A 4ED8A 2XY7A 2DBYA 3BZCA 9ICKA 1X40A 1DK2A 4F2RA 3G6VA 2BHNA 2DL0A 2KD1A 1PK1B 4M9LA 9ICWA 1ZQYA 3JPRA 2RRDA 5DQIA 4M2YA 5AKEA 5AM2A 2IBKA 2DGZA 3TADC 3QUTA 4Q8EA 4M9JA 5KT2A 2RLTA 4RNOA 1BGXT 3O0FA 4O3RA 2AU0A 1TV9A 2UVUA 3BQ2A 4R66A 2PMZC 2OH2A 1S10A 4F5QA 1X66A 3KHHA 2FLPA 2KJ8A 3RBEA 4P0QB 1DXSA 3RH6A 2GWSA 4KMOB 2KTQA 2KZZA 3ISDA 2ESEA 8ICKA 2PFOA 4PHPA 3LWMA 3U26A 1O03A 2K4IA 4KLSA 1RG6A 3B0XA 4KLLA 4F2SA 4B9NA 4F71A 2JRZA 2KIWA 4Z6CA 1RYUA 1V85A 2ASJA 4IS7A 1L7MA 2AH5A 2D6FC 1TFRA 5AI8A 2OYYA 5IINA 5CB1A 1DK3A 4MEXA 4O5EA 3UXOA 1MA7A 4B9MA 4RQ5A 1DGJA 4KLTA 2BGWA 2UVWA 1ZQKA 2BDUA 4XQ8A 1SKSA 1K1QA 4KX5A 4DO9A 4KLUA 4I2JA 1SWVA 3UMBA 1D8LA 3EPGA 8ICEA 2F77X 3N28A 1ZQPA 5GTHU 4DLGA 1QCKA 2W9BB 2KFZA 2YMPA 1Q8KA 5J2FA 2A1JA 5KFJA 1K5OA 4DS5A 5B66U 1BPYA 3MBYA 1L3UA 5KT7A 2BQ3A 4RPXA 3PMLA 4G9BA 4NV0A 5J2DA 5EE0A 9ICRA 5AK5A 3MGVA 5HR6A 1FEZA 2P66A 4MFCA 9ICXA 5KFTA 3M8SA 2YN4A 1MQ2A 5L9XA 4KLOA 3SV4A 1UT8A 1SV0C 2F2AB 3PY8A 3C29A 2W9MA 3ORYA 1N62A 4YD1A 2VA2A 3ZDBA 3BS5B 1C20A 8ICOA 5J2IA 1ZQAA 4QIWC 4YXJA 4JB3A 5EE9A 4O0IA 2RP5A 4Q43A 1X2IA 4K4HA 4NM1A 3HILA 7ICOA 5AK6A 4GLXA 1F5SA 5AICA 3KD3A 2HBKA 5E79U 5J8YC 4FZNA 2W9CA 2ZUBA 4DFMA 4BWMA 3LK9A 3T79A 2NRZA 1NNLA 4EYHB 4USAA 5IIOA 5KFKA 4RPYA 4NY8A 1VLBA 1ZETA 4OJ6A 1LVHA 2ISOA 2LYBA 1ZOLA 4PGQA 2IHMA 4J9SA 4RQ1A 3D2SA 2XVTA 4ELVA 4J9OA 3UQ2A 2H3QA 2R8HA 1N61A 1TAQA 2KMDA 3ALRA 5J29A 2H3VA 5TZVA 1WYGA 1UA1A 5KT4A 2KIVA 3RRHA 5CRXA 4K4GA 4GXJA 4FS2A 1F44A 1WCLA 1TE2A 2XO7A 1XS9D 4XA5A 4F8RA 9ICLA 4R8UB 2OCEA 5ALZA 4XRHA 2BCVA 4C8OA 4UQGA 3Q8KA 3MABA 1IIPA 2LHTA 4DFKA 4UBBA 4ECQA 1NKBA 3J81j 2Y9TA 5CJ7A 3QZ7A 3N4MB 4Y2JA 3I28A 2R8KA 2KV2A 4O3QA 3WKAA 1NJZA 1S77D 4J9NA 4J03A 2GH1A 4P0PB 4TUQA 4UB8U 1U49A 4CGZA 3AMZA 1XSNA 5KFYA 1ZXIA 4FFDA 3PW0A 4IQTA 3M6KA 3ETRA 2AQ0A 4JV0A 2JEIA 3CNHA 1ZYQA 5T14A 1XSPA 4MFFA 4RQ4A 4UB6U 3NGDA 4PGXA 4BX9C 2EDUA 4DL5A 3ZI4A 4M0AA 1OXJA 1ZJMA 5ALKA 2RHFA 3QUQA 2HHQA 1N5WA 1SKWA 5J2JA 8ICVA 2W3SA 1U4BA 3ONNA 2GLEA 2ZJ8A 9ICVA 2Q4TA 4Z6FA 1L7PA 4I27A 1XU4A 1XO1A 4DFDA 4MHVA 4AYBF 1DGSA 3TI0A 3JPOA 2HBJA 2KVCA 1T7PA 4EBDA 1ZQQA 8ICFA 1FIQA 2FPLA 2HHVA 1S97A 4YQWA 3NS1A 4TUSA 1H38A 1QQ7A 4QZBA 1RYRA 2PKEA 1BPEA 5AKGA 4RQNA 8ICGA 1L5UA 2ZIWB 2WF8A 1MSWD 1NKCA 2EAPA 3PSPA 2ZIVB 4C8LA 1PVRA 3WK7A 3ISBA 1B43A 3WK4A 1PK1A 1K1SA 5ALFA 3DEEA 4RUCA 2A1AA 4P4MA 5EWEA 1Z00A 2F1JA 4RT2A 4AP9A 3M7DA 2JZBB 4DQIA 2QKQA 3EYZA 4F5NA 4GFJA 3MR6A 7ICSA 4DQQA 3MDCA 4NL9A 4NL9C 4I29A 1T3QA 2W8KA 5JTIA 4F5PA 1U45A 1HUOA 3MGHA 4UAUA 4ED0A 4ED3A 1S76D 1L7NA 3F2CA 3QYPA 2LBOA 4UB5A 3PVXA 2BCRA 3PW7A 1SZHA 1BPZA 2JEFA 1T4GA 2Z7JA 3FYHA 4EZ6A 3C5FA 2W55A 3E0FA 3V7LA 4DSJA 2G0AA 4MF2A 4Z6EA 4FZMA 1ZQLA 4FO6A 4OO1J 5C0YA 3OJUA 4C4RA 2QB1A 3H0LB 2P6RA 1BPXA 2HOQA 3KFUF 3OJSA 1U47A 4BXOA 5ALOA 1N5XA 8ICXA 3OPXA 4ED1A 4Y2RA 1BNOA 5EWFA 4PHEA 4YMMA 3GIJA 2EZZA 7ICGA 4YN4A 3IP4B 1FFUA 3GZFA 2PI4A 3KHGA 2PFPA 4UAZA 1ZQFA 2G5HB 4Q45A 9ICMA 9ICOA 3N97B 4AYBC 8ICMA 3T5HA 4KLGA 3UXNA 2H3FA 4EEKA 1ZQBA 2ODGA 4Y2PA 5AI0A 5HMMA 3RJGA 3D2QA 4UB1A 3PW2A 4RU9A 1T3NA 4U7CA 1TAMA 3AQFA 1A76A 2HOIA 2HHXA 4R65A 1SXDA 9ICPA 5AKIA 4I2EA 1JXEA 1RQLA 4ED2A 1KFDA 4DSKA 5DLGA 3RJFA 3EZ5A 1KKXA 1NK7A 3TANA 7ICLA 5KT6A 3RJKA 1CUKA 4I28A 3R9KA 7ICRA 2ASDA 5ALQA 2W7PA 4RQ7A 4O3MA 2LI6A 1YZ6A 1L6NA 1NJWA 2JZBA 4C8NA 2E3TA 1BVSA 4RUAA 2CPRA 3SAGA 1RDFA 3L3FX 2NRWA 5ALNA 4DFJA 1NK8A 1WCNA 3RRGA 3K1RB 4QZGA 2MA1A 2LYHA 2A3VA 1Z1BA 9ICHA 3GFKB 3RJJA 1B0XA 2YY6A 2KKVA 1NKEA 4ZOHC 3V7JA 3PV8A 3H8WA 4M6WA 3NVZA 1CI4A 3UM9A 4XUSA 2FI1A 2OHFA 3AQEA 4EX7A 8ICAA 2JGAA 4QZDA 3AUOA 3GIIA 4UASA 3IM1A 2EZYA 1B4FA 4PHDA 4I2GA 5G5GA 2K8AA 4NLBA 2PFQA 2DPJA 2ZIXA 2CN1A 5D46A 3Q8PB 3QEAZ 2J6UA 2LM4A 3PR4A 3N7SC 4O3OA 5KG4A 2WFAA 4MEYA 1QLNA 1NJYA 3NASA 1X9XA 3LYSA 2XCPA 4YD2A 4DS4A 3UPQA 2FLLA 1KQQA 1UPHA 5AK3A 5KNIA 4NLZA 1NOMA 2ES6A 3D6JA 4GXKA 3NVWA 4IRDA 2AQ4A 4P0PA 2P35A 2ZUDA 2BQRA 5ALWA 1O08A 1S5LU 1ZQSA 1IM4A 2KE7A 3Q8SB 4DSEA 2I9GA 1ZQWA 2IOHA 2BQUA 5JU5A 3KKAA 4PZOA 4MFAA 4DFPA 2HW3A 1B22A 5AI6A 1V38A 5D49A 3Q8QB 1Z4OA 4QJFB 4CF4A 1BPBA 3FM9A 2EH9A 1ZQOA 2AGPA 5ALHA 2YMQA 1D8YA 4Y2YA 4IQVA 2UVVA 2BR0A 2F8KA 4HAIA 4Y2XA 4UB2A 2RDJA 5J0UA 2AHOB 5KG5A 1A6SA 1LKYB 3QEBZ 1JMSA 1MN8A 2R18A 4I2CA 4RZRA 5TISU 2D3DA 2N1RA 2IOFA 1KLNA 4OJ5A 4DL3A 9ICTA 1Y88A 4LJXA 1KTQA 1N48A 3KHLA 5J2EA 5KFZA 3H4BA 2MUTA 2Q0ZX 8ICWA 1S8OA 4EYIB 3WKDA 4NLNA 3GIMA 2HMXA 4U6PA 3TKAA 3LVWA 3OSPA 4JV2A 5CA7A 5ALUA 1NJXA 3RAXA 5KAFU 4NJ8A 3OHBA 2DKZA 1Z3EB 1QSYA 2KK0A 5J2CA 3GV7B 3I1YA 3WK8A 1M6YA 5J2BA 2KVSA 2XGQA 3C1YA 5AKKA 3F2DA 4C8KA 3V72A 5CHGA 4GIBA 1X6IA 1PK3A 2LMRA 4CCHA 5EWGA 1JALA 5DLFA 2HHWA 3A0BU 5J0RA 9ICCA 2NYVA 2HBMA 1ZQJA 1ZQXA 3PR5B 2KSOA 3QUCA 3MFIA 2OWOA 4KLFA 5AI9A 4LZGA 1BNPA 1UHUA 4GXIA 3N7RC 2AXTU 2NRTA 3C2LA 1U48A 2IHNA 5J0TA 3HKZC 5ALIA 1L3TA 4EBCA 1QH9A 3PX6A 2QARA 4QZFA 2CXYA 4QZHA 4LVSA 1PVQA 1KL9A 2FJ6A 4EENA 4DSIA 3N7PD 5DG9A 4JK1A 2XY5A 1X42A 1CEZA 2BPCA 1RQNA 5DBCA 2KZ3A 4Q44A 2A1JB 4F50A 8ICCA 4Y2VA 2LYAA 4J9KA 4QW9A 2Y9UA 4DEZA 5J0WA 4IL6U 4UAVA 3V7KA 4IRKA 3MDAA 4UB3A 4EBEA 3D2NA 5AKLA 3FAHA 1X9SA 1AROP 3LDAA 5KFHA 4CE6A 4RQ6A 3RB6A 2E8NA 7ICJA 3CW2C 5JUMA 2F76X 2M9NA 5KFVA 4QZIA 5HR7A 4BDPA 2F3NA 4TQSA 7ICMA 8ICUA 1D9FA 3IG5A 1J2MA 3TAQA 4DQRA 3H8JA 2WB1C 2PXIA 4PHAA 4B9TA 5KFSA 2WAQF 3LWLA 4RQ8A 4F72A 4C80A 5HHIA 3UMGA 2ZTCA 3B0YA 5KFWA 2YMLA 2J6TA 5ALTA 3K75D 3WKBA 2W04A 3RB3A 4DL6A 2ATLA 1PUZA 4ECUA 1SV0A 4B9SA 3H8MA 2HVHA 3MR3A 1KN5A 3EW9A 5BOMA 2DKXA 1L7OA 3CRXA 3HP6A 2VIXA 4FS1A 2ZIUA 4P0QA 4ECVA 1N56A 5AM0A 1ZQCA 5ALXA 2K8CB 2HBLA 3JPSA 2K4HA 2ZIWA 3SR6A 5KFIA 4NLKA 5DG7A 5DGAA 3KHRA 4OJPA 5L1KA 2FPMA 2E8MA 3TQ1A 2M0NA 4O3NA 1ZD4A 2XI9A 5L1LA 3UQ0A 2K89A 5KG6A 5L1JA 2W11A 3GU3A 4UBCA 2G5IB 2J6SA 3E2EA 1NK0A 3AU6A 3FDSA 4YVZA 1SL0A 7ICTA 2B21A 2RQ5A 2R8GA 5AHXA 3C21A 2MAXA 5AM5A 3OHAA 3QU2A 3VC8A 5J8YA 3BJYA 4DWIA 2BPGA 1ZQTA 2OEHA 3BQTA 5AM1A 3S6JA 8ICIA 5ALLA 3SMVA 1PZNA 3IDWA 2FMPA 5KFFA 4E0DA 4PPXA 4I2FA 3V6KA 2BDPA 4PL1A 4KITB 2ZUCA 3NRZA 3T3FA 5J2KA 4RNMA 2HDOA 5DGBA 2YMMA 4RQ0A 1JX4A 4IR9A 3C2KA 3HKZF 1ED1A 5L1MA 3QNMA 5DQGA 3PW5A 5K4LA 4BXOB 4FBUA 3BZKA 4JUZA 5ALGA 1SV4A 2JEGA 5AM3A 5EOZA 1KFSA 3HPOA 2EAOA 1RM6C 1SGGA 2ZXHA 1ZQ1C 2YB1A 4I2HA 4J9MA 2E8PA 5AKJA 4QWEA 5KFXA 3PNCA 1KDHA 2H3ZA 2JXJA 4CF5A 3GILA 3NRWA 1IV8A 5D4BA 2NV3A 1KFTA 7ICUA 3RAQA 5KFGA 4CF3A 4PL2A 4F92B 1TAUA 3SAFA 1D8BA 1NZPA 4ECRA 9ICAA 1CRXA 1QTMA 1ZRMA 1JROA 2NO5A 2HHUA 5EE3A 5ALDA 2VA3A 2JV3A 4EEYA 3ZDDA 5DDMA 3QU4A 4JV1A 7ICPA 1Z00B 5AKXA 3PSTA 5J2HA 8ICQA 4M9HA 2LM1A 4O9MA 3HRDD 4RNNA 3TFSA 1GO3F 2ZIVA 2W43A 4Z6DA 5G5HA 1XO0A 4OCZA 2W9CB 1ZRNA 4NWIA 3NUQA 4KTQA 1PVPA 2KHQA 2KSOB 5ALRA 2H5XA 4C0ZA 1JN3A 2KFNA 5CEHA 3HW8A 2KHVA 1FFVA 1X9MA 2E5SA 4DSFA 2B6GA 4WJ3B 4PGYA 1ZQUA 5AKHA 1RYSA 1S0MA 1XWLA 2BCUA 3C28A 3Q8MA 4ACOA 3Q8RB 5KFOA 2OM6A 2G09A 1S0VA 4UARA 4B9UA 2ZTEA 9ICNA 4UB4A 3ICXA 1IG6A 3IV6A 8ICZA 3M1YA 3SEIA 5CR0A 2W3RA 2YQEA 4PZNA 4BUGA 5KFQA 5KFCA 3PW4A 5AK4A 2JR5A 5KL1B 3C1ZA 2AGOA 3PMNA 3H7IA 2NO4A 2DPIA 5HHHA 2Y0SF 3NVVA 7ICVA 1MC8A 1ZQVA 3HJEA 5J0OA 3V6JA 4F93B 4US9A 4YP3A 1SL2A 9ICUA 1L8LA 2ZJ5A 9ICFA 1FO4A 4DSLA 4C4SA 4DL2A 3SQIA 1V9PA 1HEKA 1A77A 1ZQNA 4YR2A 1LV5A 3PSFA 5DBAA 5DB9A 3WK5A 2ZTDA 2IOFK 1N63A 4KX3A 2OXOA 8ICLA 3AU2A 4Y2SA 1ZQEA 1UT5A 3HT3A 5DDYA 4NLCA 2VKQA 1J2NA 1ZQRA 4OJOA 4QW8A 5IIJA 2VJ4A 2DQNB 4QZ9A 5HNKA 3AL0B 4NLGA 8ICJA 2MRLA 3PO4A 4UAYA 1RPLA 1TK8A 4DF8A 4K4IA 4PH5A 8ICYA 5J0PA 5AIAA 2G07A 4UATA 2MU2A 3GV5B 2KP7A 5DB6A 2G06A 2JH7A 5KG1A 3UMCA 3RR7A 7ICIA 3E58A 3EPIA 2V4QA 5DB8A 1Z4NA 2WF5A 1D9DA 3TAPA 3DV9A 2KZMA 3KKAC 3H8SA 1ZJNA 4TUPA 4JMUA 3UXPA 2WF6A 3MGIA 4JWMA 2RDIA 3CYMA 4M9NA 4KN7A 3MFHA 3AEVA 3SI8A 4CNQA 3GDXA 5KG7A 5L1IA 1MQ3A 5KFMA 4B9VA 1SB3C 1QSSA 4A8EA 3T5JA 2E8OA 1UQVA 4F5OA 2FDRA 2WTFA 5ALYA 3JPPA 1RZTA 2NRXA 1URJA 2GO7A 4IC9A 5IIMA 3QXGA 1KW4A 2B0CA 2WAQC 4TQRA 4I2DA 4OJLA 5J0SA 5J0YA 2AJQA 1ZD2P 2YB4A 5KFRA 2CRXA 4QNLA 4ECZA 5HP4A 4DQSA 4KLQA 1T94A 1NK9A 4QZCA 4B9LA 4US8A 3RBDA 5AM4A 1WUDA 1TK5A 4Y2TA 3FC4A 1KSPA 1RXWA 2WB1F 3MR5A 5A0LA 2W03A 1Z19A 3SENA 3QU9A 2FLNA 2H3IA 2HVIA 2MUTB 2XY6A 4P4OA 1EXNA 1JUDA 1NZBA 7ICQA 3PSIA 2D8CA 2BZFA 1NI3A 1NK4A 4O3SA 3KTQA 1DRGA 2ZG6A 1X6JA 3NVYA 4KLIA 1LKYA 5BOLA 4CRXA 1YT3A 1YZ7A 1QQ5A 2W9BA 5ALVA 5ALPA 4IRCA 4R64A 3M9MB 2XICA 1KBUA 9ICGA 4ED7A 1L8OA
chains in the Genus database with same CATH topology
4OJ6A 1Q3UA 2E1EA 4ICAA 4A8EA 4BUGA 2JHDA 2ZIUA 4P0QA 2RRDA 2F77X 2LYBA 2PMZF 1PVQA 2K8CB 5KL1B 2HBLA 3OPXA 2DGZA 2K4HA 2ZXHA 1ZQ1C 2YB1A 2ZIWA 3ONNA 1A6SA 1A0PA 2Q4TA 3AQEA 2KICA 3N7PD 2DF4B 2JGAA 1URJA 2XIDA 1HIWA 2R18A 2G08A 4IC9A 3IP4B 2Y0SF 3K1ZA 4FE3A 4AYBF 3F2BA 2H3ZA 2WAQC 3D2SA 2XVTA 4FZLA 3GZFA 4OJLA 2HBJA 2KOBA 2K8AA 2YB4A 2N1RA 3NRWA 3O0FA 4NLBA 2KVCA 2NV3A 4OJPA 2CRXA 4QNLA 2H3QA 2G5HB 2KEYA 3KFUF 2ZIXA 1T94A 2M0NA 3IG8A 4OJ5A 4PL2A 2CN1A 1D8BA 3SAFA 2PMZC 2JMGA 2OH2A 3VCBA 4AYBC 3N7SC 2XI9A 1P7DA 2KJ8A 2LYAA 3ALRA 3SQIA 2KJ5A 2ZXIA 2H3FA 3H0MB 4P0QB 1HEKA 1WUDA 2H3VA 4NV0A 1CRXA 2VJ5A 2K89A 2Y0SC 3PSFA 2ZIWB 3LYSA 2HMXA 2WB1F 4KMOB 4U6PA 3D2NA 3CP8A 3LVWA 1ECWA 5A0LA 2W03A 3GU3A 2F8LA 2ZIVB 3PSPA 3MGVA 1Z19A 5CRXA 3RFAA 1PVRA 2G5IB 5HR6A 4KX3A 3PSTA 1F44A 2OXOA 3D2QA 2W7OA 3IN5A 2KKPA 3DEEA 2F76X 2K4IA 4U7CA 4NLCA 2VKQA 1UPHA 1TAMA 3AQFA 2K4EA 5HR7A 2YX8A 4OJOA 4CDGA 2HOIA 2VJ4A 3LVVA 1GO3F 2ZIVA 2F2AB 3M7DA 4BJQA 2DQNB 3C29A 2H3IA 1XNSA 2KIWA 3F2DA 1XO0A 1Q3VA 3AL0B 3IG5A 3F5EA 1NZBA 2LKYA 3PSIA 1IIPA 2MRLA 4GFJA 1OUQA 4NWIA 2LHTA 3NUQA 2KNJA 4P0PA 2WB1C 1PVPA 2KHQA 2D6FC 3VC8A 3F53A 3M6ZA 2KJ9A 2OYYA 2WAQF 4C0ZA 2KV2A 2HBMA 4QIWC 1DRGA 2KHVA 2ZG6A 2E5SA 3SMVA 3RF9A 2G07A 2W7PA 2HOFA 2RP5A 2GOLA 2ZIXB 4O3MA 2GH1A 2JH7A 2G06A 4QIWF 3F5AA 4P0PB 4WJ3B 4CGZA 1L6NA 4PL1A 1MA7A 3C28A 2JH1A 2W04A 4ACOA 3F2CA 4CRXA 3M6KA 2LBOA 2OM6A 3N7RC 2CPRA 3KZXA 2HBKA 1YT3A 1SZHA 2G09A 5KL8B 3SAHA 3SAGA 3L3FX 2BDUA 2Z7JA 3HKZF 4FZNA 1ED1A 4JMUA 4QJFB 5T14A 3PZPA 2K8BB 3E0FA 3T79A 2MA1A 2XICA 1KBUA 2G0AA 1Z1BA 3ICXA 2A3VA 4KX5A 3CYMA 4FZMA 3HKZC 2E1FA 4BX9C 2ZIUB 4OO1J 5C0YA 2KKVA 3H0LB 2KD1A 3CRXA 2VIXA 3H0RB 2HOQA 2RHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UPH A;  4ICA A;  1TAM A;  2JMG A;  2K4E A;  1L6N A;  2LYB A;  2H3I A;  2LYA A;  2K4H A;  1A6S A;  2H3F A;  1HEK A;  2H3V A;  1HIW A;  1ED1 A;  4JMU A;  4IC9 A;  2HMX A;  2H3Z A;  1ECW A;  2N1R A;  2NV3 A;  2H3Q A;  2GOL A;  2K4I A; 
#chains in the Genus database with same CATH topology
 3PX0 A;  5DBB A;  9ICB A;  1XSL A;  4P4P A;  4ECX A;  4F5R A;  3RH4 A;  4QZ8 A;  5AI5 A;  3QX7 A;  2YTU A;  4DCC A;  1AQ6 A;  2XID A;  2ALZ A;  2IA6 A;  3RJH A;  4YMN A;  3GV8 B;  4ECS A;  2KOB A;  3RB4 A;  4KN4 A;  3TAC B;  4C7Z A;  2K60 A;  4RQM A;  3VCB A;  9ICJ A;  2FMQ A;  5JRT A;  2HSZ A;  5ALM A;  2DFL A;  2BKE A;  2VJ5 A;  4UAW A;  5ALJ A;  4KLJ A;  1ZQZ A;  7ICK A;  4ECY A;  3RFA A;  4OD0 A;  8ICH A;  2QAR B;  3IN5 A;  1TVA A;  2LPE A;  4Y2Q A;  8ICB A;  2YX8 A;  3BS7 A;  3L5K A;  1N60 A;  4KLH A;  1OW5 A;  3LVV A;  1XNS A;  1Q3V A;  2Y1J A;  3F5E A;  2LKY A;  4J9R A;  1U9L A;  5KT3 A;  3WK6 A;  4DOA A;  2I1Q A;  3G6Y A;  5KFU A;  3QE9 Y;  3F53 A;  3T5L A;  8ICR A;  4M04 A;  4DLE A;  2PFN A;  3ETL A;  5CWR A;  2C2R A;  8ICT A;  4NXZ A;  3M9N B;  3RR8 A;  3F5A A;  1XC9 A;  2F1H A;  3HWT A;  3WU2 U;  4X5V A;  2DUY A;  2W54 A;  4M6W B;  3V6H A;  1WWV A;  1ZQH A;  3RTV A;  5KFE A;  2XC9 A;  2BCQ A;  4RQ3 A;  3THV A;  3KOO A;  1ZD3 A;  4YCX A;  8ICS A;  3OGU A;  5AI4 A;  4DL7 A;  1JRP A;  2E1F A;  2ZIU B;  4F91 B;  4B6J A;  5F9L A;  2HHT A;  3A0H U;  1J97 A;  5IIL A;  3C23 A;  2KG5 A;  1ZQM A;  3H0R B;  4GC6 A;  2ISP A;  2ASL A;  2QLT A;  3NTU A;  1JI7 A;  3EUB 2;  2KN7 A;  1IXR A;  5KTQ A;  1NK6 A;  4O3P A;  3T5K A;  2VAN A;  2KIC A;  4Q8F A;  4YR0 A;  2R8I A;  3L4P A;  2ZJA A;  3SV3 A;  2BCS A;  3K1Z A;  4FE3 A;  3C5G A;  4P2H A;  4FZL A;  1SZP A;  3IHQ B;  3QU5 A;  4NM2 A;  2F44 A;  3SD7 A;  5DG8 A;  4EZ9 A;  1COO A;  2W9A A;  3PO5 A;  4F4Z A;  7ICE A;  1F0M A;  1SXE A;  4KLE A;  4DL4 A;  3H0M B;  1WWU A;  2WHE A;  1JXL A;  2UVR A;  5KFB A;  1QQ6 A;  3CP8 A;  2O6K A;  1NK5 A;  2P6U A;  4KLM A;  1V97 A;  2W7O A;  3ZDE A;  2Y1I A;  2QB0 B;  2K4E A;  4TUR A;  4QZE A;  5IIK A;  4BGD A;  2EZX A;  3OSN A;  4M9G A;  5KFN A;  1SKR A;  1HJP A;  3M6Z A;  4YMO A;  1COK A;  2KJ9 A;  3H4D A;  4DOC A;  4PJ0 U;  4QWA A;  1JIH A;  4ED6 A;  3ED5 A;  4DQP A;  4IR1 A;  1L3S A;  2A19 A;  3ZDC A;  3WKC A;  4IQW A;  3QU7 A;  4KMU A;  3ZD8 A;  5AIB A;  8ICN A;  2XGP A;  3HX0 A;  2HCF A;  3KZX A;  4R8U A;  5KL8 B;  2FE9 A;  4EX6 A;  5CP2 A;  5III A;  1S0N A;  5KFL A;  3BQ0 A;  5H2F U;  2JEJ A;  1KEJ A;  1TKD A;  2QB0 A;  4ELU A;  5F9N A;  3JPN A;  1Q3U A;  4ICA A;  2VA8 A;  2JHD A;  5ALS A;  4FBT A;  2PMZ F;  1QSL A;  1A0P A;  2L5Y A;  2DF4 B;  1HIW A;  3BQ7 A;  3KBB A;  2EAN A;  3GIK A;  3B9J A;  1RXV A;  3IRU A;  5BPC A;  5DQH A;  1TK0 A;  4J9Q A;  2W8L A;  9ICI A;  2KEY A;  3ZDA A;  4ECT A;  2JMG A;  4F4X A;  5KT5 A;  1S9F A;  1UCV A;  3MR2 A;  3SZ2 A;  1X9W A;  1P7D A;  2EAM A;  5KAI U;  2C22 A;  2KJ5 A;  2ZXI A;  4QWC A;  2NRV A;  4R63 A;  3TAD A;  3RH5 A;  2Y0S C;  4MF8 A;  4YR3 A;  1ECW A;  3I76 A;  3MC1 A;  4BWJ A;  4HYK A;  5J2G A;  4RPZ A;  2V4R A;  5KG0 A;  3BDP A;  3AN1 A;  4F4Y A;  2DWQ A;  2KKP A;  1DOQ A;  2WF7 A;  4YFK A;  4QWB A;  1ZQD A;  4QWD A;  2KNJ A;  5DB7 A;  2FMS A;  4QZA A;  4RT3 A;  5C5J A;  1C7Y A;  3RF9 A;  1LB2 B;  3TFR A;  2HOF A;  2GOL A;  3QUB A;  3BS5 A;  4YXM A;  9ICS A;  4DF4 A;  3DDH A;  4I2A A;  3C2M A;  3SAH A;  3JPT A;  2AGQ A;  1T8E A;  3PZP A;  1KRP A;  4RQ2 A;  2K8B B;  4YG2 A;  5FP0 A;  5AKY A;  2HI0 A;  4IQU A;  5J2A A;  1BPD A;  2I5H A;  5EE1 A;  2E1E A;  4G3I A;  2FPK A;  4DOB A;  3ZD9 A;  2C2D A;  5GTI U;  7ICH A;  2C28 A;  3RJI A;  5B5E U;  2K4P A;  5KG3 A;  2I6X A;  5DKW A;  2MSN A;  4F4K A;  3K4G A;  2G08 A;  4LZD A;  1ZQI A;  3F2B A;  4KLD A;  4F3O A;  3GQC A;  3QZ8 A;  4JWN A;  2IMW P;  1ZQG A;  1SIJ A;  1S0O A;  3H40 A;  3G6X A;  2V9W A;  3EWA A;  3IG8 A;  5J0X A;  4ELT A;  3M9O B;  2WF9 A;  7ICN A;  4UW9 A;  3WKE A;  2HHS A;  5HML A;  4M47 A;  2EQY A;  4O5C A;  4O5K A;  2XCA A;  4C7Y A;  3TAR A;  1SWW A;  4EEL A;  3RJE A;  9ICQ A;  3PX4 A;  2F8L A;  5F3X B;  3SYZ A;  2F1I A;  1Q46 A;  5ALE A;  1HUZ A;  3AM9 A;  3BQ1 A;  3WK9 A;  7ICF A;  1ZD5 A;  4CDG A;  4I2B A;  3ISC A;  1L3V A;  4BJQ A;  2R8J A;  4I2I A;  4Y2U A;  2BPF A;  4J9L A;  2PI5 A;  1N2X A;  3M8R A;  1UA0 A;  1OUQ A;  5AKZ A;  4ZH4 A;  4F4W A;  2C2E A;  3KZI U;  3RB0 A;  8ICP A;  1WG8 A;  5KFA A;  1Z1V A;  5KFP A;  5J0Q A;  1SL1 A;  1VDV A;  2ZIX B;  4QIW F;  5KFD A;  4C8M A;  2JH1 A;  3OTQ A;  3Q8L A;  4J9P A;  1VJ5 A;  4C4T A;  4ECW A;  9ICE A;  5KG2 A;  3JPQ A;  4GC7 A;  4ED8 A;  2XY7 A;  2DBY A;  3BZC A;  9ICK A;  1X40 A;  1DK2 A;  4F2R A;  3G6V A;  2BHN A;  2DL0 A;  2KD1 A;  1PK1 B;  4M9L A;  9ICW A;  1ZQY A;  3JPR A;  2RRD A;  5DQI A;  4M2Y A;  5AKE A;  5AM2 A;  2IBK A;  2DGZ A;  3TAD C;  3QUT A;  4Q8E A;  4M9J A;  5KT2 A;  2RLT A;  4RNO A;  1BGX T;  3O0F A;  4O3R A;  2AU0 A;  1TV9 A;  2UVU A;  3BQ2 A;  4R66 A;  2PMZ C;  2OH2 A;  1S10 A;  4F5Q A;  1X66 A;  3KHH A;  2FLP A;  2KJ8 A;  3RBE A;  4P0Q B;  1DXS A;  3RH6 A;  2GWS A;  4KMO B;  2KTQ A;  2KZZ A;  3ISD A;  2ESE A;  8ICK A;  2PFO A;  4PHP A;  3LWM A;  3U26 A;  1O03 A;  2K4I A;  4KLS A;  1RG6 A;  3B0X A;  4KLL A;  4F2S A;  4B9N A;  4F71 A;  2JRZ A;  2KIW A;  4Z6C A;  1RYU A;  1V85 A;  2ASJ A;  4IS7 A;  1L7M A;  2AH5 A;  2D6F C;  1TFR A;  5AI8 A;  2OYY A;  5IIN A;  5CB1 A;  1DK3 A;  4MEX A;  4O5E A;  3UXO A;  1MA7 A;  4B9M A;  4RQ5 A;  1DGJ A;  4KLT A;  2BGW A;  2UVW A;  1ZQK A;  2BDU A;  4XQ8 A;  1SKS A;  1K1Q A;  4KX5 A;  4DO9 A;  4KLU A;  4I2J A;  1SWV A;  3UMB A;  1D8L A;  3EPG A;  8ICE A;  2F77 X;  3N28 A;  1ZQP A;  5GTH U;  4DLG A;  1QCK A;  2W9B B;  2KFZ A;  2YMP A;  1Q8K A;  5J2F A;  2A1J A;  5KFJ A;  1K5O A;  4DS5 A;  5B66 U;  1BPY A;  3MBY A;  1L3U A;  5KT7 A;  2BQ3 A;  4RPX A;  3PML A;  4G9B A;  4NV0 A;  5J2D A;  5EE0 A;  9ICR A;  5AK5 A;  3MGV A;  5HR6 A;  1FEZ A;  2P66 A;  4MFC A;  9ICX A;  5KFT A;  3M8S A;  2YN4 A;  1MQ2 A;  5L9X A;  4KLO A;  3SV4 A;  1UT8 A;  1SV0 C;  2F2A B;  3PY8 A;  3C29 A;  2W9M A;  3ORY A;  1N62 A;  4YD1 A;  2VA2 A;  3ZDB A;  3BS5 B;  1C20 A;  8ICO A;  5J2I A;  1ZQA A;  4QIW C;  4YXJ A;  4JB3 A;  5EE9 A;  4O0I A;  2RP5 A;  4Q43 A;  1X2I A;  4K4H A;  4NM1 A;  3HIL A;  7ICO A;  5AK6 A;  4GLX A;  1F5S A;  5AIC A;  3KD3 A;  2HBK A;  5E79 U;  5J8Y C;  4FZN A;  2W9C A;  2ZUB A;  4DFM A;  4BWM A;  3LK9 A;  3T79 A;  2NRZ A;  1NNL A;  4EYH B;  4USA A;  5IIO A;  5KFK A;  4RPY A;  4NY8 A;  1VLB A;  1ZET A;  4OJ6 A;  1LVH A;  2ISO A;  2LYB A;  1ZOL A;  4PGQ A;  2IHM A;  4J9S A;  4RQ1 A;  3D2S A;  2XVT A;  4ELV A;  4J9O A;  3UQ2 A;  2H3Q A;  2R8H A;  1N61 A;  1TAQ A;  2KMD A;  3ALR A;  5J29 A;  2H3V A;  5TZV A;  1WYG A;  1UA1 A;  5KT4 A;  2KIV A;  3RRH A;  5CRX A;  4K4G A;  4GXJ A;  4FS2 A;  1F44 A;  1WCL A;  1TE2 A;  2XO7 A;  1XS9 D;  4XA5 A;  4F8R A;  9ICL A;  4R8U B;  2OCE A;  5ALZ A;  4XRH A;  2BCV A;  4C8O A;  4UQG A;  3Q8K A;  3MAB A;  1IIP A;  2LHT A;  4DFK A;  4UBB A;  4ECQ A;  1NKB A;  3J81 j;  2Y9T A;  5CJ7 A;  3QZ7 A;  3N4M B;  4Y2J A;  3I28 A;  2R8K A;  2KV2 A;  4O3Q A;  3WKA A;  1NJZ A;  1S77 D;  4J9N A;  4J03 A;  2GH1 A;  4P0P B;  4TUQ A;  4UB8 U;  1U49 A;  4CGZ A;  3AMZ A;  1XSN A;  5KFY A;  1ZXI A;  4FFD A;  3PW0 A;  4IQT A;  3M6K A;  3ETR A;  2AQ0 A;  4JV0 A;  2JEI A;  3CNH A;  1ZYQ A;  5T14 A;  1XSP A;  4MFF A;  4RQ4 A;  4UB6 U;  3NGD A;  4PGX A;  4BX9 C;  2EDU A;  4DL5 A;  3ZI4 A;  4M0A A;  1OXJ A;  1ZJM A;  5ALK A;  2RHF A;  3QUQ A;  2HHQ A;  1N5W A;  1SKW A;  5J2J A;  8ICV A;  2W3S A;  1U4B A;  3ONN A;  2GLE A;  2ZJ8 A;  9ICV A;  2Q4T A;  4Z6F A;  1L7P A;  4I27 A;  1XU4 A;  1XO1 A;  4DFD A;  4MHV A;  4AYB F;  1DGS A;  3TI0 A;  3JPO A;  2HBJ A;  2KVC A;  1T7P A;  4EBD A;  1ZQQ A;  8ICF A;  1FIQ A;  2FPL A;  2HHV A;  1S97 A;  4YQW A;  3NS1 A;  4TUS A;  1H38 A;  1QQ7 A;  4QZB A;  1RYR A;  2PKE A;  1BPE A;  5AKG A;  4RQN A;  8ICG A;  1L5U A;  2ZIW B;  2WF8 A;  1MSW D;  1NKC A;  2EAP A;  3PSP A;  2ZIV B;  4C8L A;  1PVR A;  3WK7 A;  3ISB A;  1B43 A;  3WK4 A;  1PK1 A;  1K1S A;  5ALF A;  3DEE A;  4RUC A;  2A1A A;  4P4M A;  5EWE A;  1Z00 A;  2F1J A;  4RT2 A;  4AP9 A;  3M7D A;  2JZB B;  4DQI A;  2QKQ A;  3EYZ A;  4F5N A;  4GFJ A;  3MR6 A;  7ICS A;  4DQQ A;  3MDC A;  4NL9 A;  4NL9 C;  4I29 A;  1T3Q A;  2W8K A;  5JTI A;  4F5P A;  1U45 A;  1HUO A;  3MGH A;  4UAU A;  4ED0 A;  4ED3 A;  1S76 D;  1L7N A;  3F2C A;  3QYP A;  2LBO A;  4UB5 A;  3PVX A;  2BCR A;  3PW7 A;  1SZH A;  1BPZ A;  2JEF A;  1T4G A;  2Z7J A;  3FYH A;  4EZ6 A;  3C5F A;  2W55 A;  3E0F A;  3V7L A;  4DSJ A;  2G0A A;  4MF2 A;  4Z6E A;  4FZM A;  1ZQL A;  4FO6 A;  4OO1 J;  5C0Y A;  3OJU A;  4C4R A;  2QB1 A;  3H0L B;  2P6R A;  1BPX A;  2HOQ A;  3KFU F;  3OJS A;  1U47 A;  4BXO A;  5ALO A;  1N5X A;  8ICX A;  3OPX A;  4ED1 A;  4Y2R A;  1BNO A;  5EWF A;  4PHE A;  4YMM A;  3GIJ A;  2EZZ A;  7ICG A;  4YN4 A;  3IP4 B;  1FFU A;  3GZF A;  2PI4 A;  3KHG A;  2PFP A;  4UAZ A;  1ZQF A;  2G5H B;  4Q45 A;  9ICM A;  9ICO A;  3N97 B;  4AYB C;  8ICM A;  3T5H A;  4KLG A;  3UXN A;  2H3F A;  4EEK A;  1ZQB A;  2ODG A;  4Y2P A;  5AI0 A;  5HMM A;  3RJG A;  3D2Q A;  4UB1 A;  3PW2 A;  4RU9 A;  1T3N A;  4U7C A;  1TAM A;  3AQF A;  1A76 A;  2HOI A;  2HHX A;  4R65 A;  1SXD A;  9ICP A;  5AKI A;  4I2E A;  1JXE A;  1RQL A;  4ED2 A;  1KFD A;  4DSK A;  5DLG A;  3RJF A;  3EZ5 A;  1KKX A;  1NK7 A;  3TAN A;  7ICL A;  5KT6 A;  3RJK A;  1CUK A;  4I28 A;  3R9K A;  7ICR A;  2ASD A;  5ALQ A;  2W7P A;  4RQ7 A;  4O3M A;  2LI6 A;  1YZ6 A;  1L6N A;  1NJW A;  2JZB A;  4C8N A;  2E3T A;  1BVS A;  4RUA A;  2CPR A;  3SAG A;  1RDF A;  3L3F X;  2NRW A;  5ALN A;  4DFJ A;  1NK8 A;  1WCN A;  3RRG A;  3K1R B;  4QZG A;  2MA1 A;  2LYH A;  2A3V A;  1Z1B A;  9ICH A;  3GFK B;  3RJJ A;  1B0X A;  2YY6 A;  2KKV A;  1NKE A;  4ZOH C;  3V7J A;  3PV8 A;  3H8W A;  4M6W A;  3NVZ A;  1CI4 A;  3UM9 A;  4XUS A;  2FI1 A;  2OHF A;  3AQE A;  4EX7 A;  8ICA A;  2JGA A;  4QZD A;  3AUO A;  3GII A;  4UAS A;  3IM1 A;  2EZY A;  1B4F A;  4PHD A;  4I2G A;  5G5G A;  2K8A A;  4NLB A;  2PFQ A;  2DPJ A;  2ZIX A;  2CN1 A;  5D46 A;  3Q8P B;  3QEA Z;  2J6U A;  2LM4 A;  3PR4 A;  3N7S C;  4O3O A;  5KG4 A;  2WFA A;  4MEY A;  1QLN A;  1NJY A;  3NAS A;  1X9X A;  3LYS A;  2XCP A;  4YD2 A;  4DS4 A;  3UPQ A;  2FLL A;  1KQQ A;  1UPH A;  5AK3 A;  5KNI A;  4NLZ A;  1NOM A;  2ES6 A;  3D6J A;  4GXK A;  3NVW A;  4IRD A;  2AQ4 A;  4P0P A;  2P35 A;  2ZUD A;  2BQR A;  5ALW A;  1O08 A;  1S5L U;  1ZQS A;  1IM4 A;  2KE7 A;  3Q8S B;  4DSE A;  2I9G A;  1ZQW A;  2IOH A;  2BQU A;  5JU5 A;  3KKA A;  4PZO A;  4MFA A;  4DFP A;  2HW3 A;  1B22 A;  5AI6 A;  1V38 A;  5D49 A;  3Q8Q B;  1Z4O A;  4QJF B;  4CF4 A;  1BPB A;  3FM9 A;  2EH9 A;  1ZQO A;  2AGP A;  5ALH A;  2YMQ A;  1D8Y A;  4Y2Y A;  4IQV A;  2UVV A;  2BR0 A;  2F8K A;  4HAI A;  4Y2X A;  4UB2 A;  2RDJ A;  5J0U A;  2AHO B;  5KG5 A;  1A6S A;  1LKY B;  3QEB Z;  1JMS A;  1MN8 A;  2R18 A;  4I2C A;  4RZR A;  5TIS U;  2D3D A;  2N1R A;  2IOF A;  1KLN A;  4OJ5 A;  4DL3 A;  9ICT A;  1Y88 A;  4LJX A;  1KTQ A;  1N48 A;  3KHL A;  5J2E A;  5KFZ A;  3H4B A;  2MUT A;  2Q0Z X;  8ICW A;  1S8O A;  4EYI B;  3WKD A;  4NLN A;  3GIM A;  2HMX A;  4U6P A;  3TKA A;  3LVW A;  3OSP A;  4JV2 A;  5CA7 A;  5ALU A;  1NJX A;  3RAX A;  5KAF U;  4NJ8 A;  3OHB A;  2DKZ A;  1Z3E B;  1QSY A;  2KK0 A;  5J2C A;  3GV7 B;  3I1Y A;  3WK8 A;  1M6Y A;  5J2B A;  2KVS A;  2XGQ A;  3C1Y A;  5AKK A;  3F2D A;  4C8K A;  3V72 A;  5CHG A;  4GIB A;  1X6I A;  1PK3 A;  2LMR A;  4CCH A;  5EWG A;  1JAL A;  5DLF A;  2HHW A;  3A0B U;  5J0R A;  9ICC A;  2NYV A;  2HBM A;  1ZQJ A;  1ZQX A;  3PR5 B;  2KSO A;  3QUC A;  3MFI A;  2OWO A;  4KLF A;  5AI9 A;  4LZG A;  1BNP A;  1UHU A;  4GXI A;  3N7R C;  2AXT U;  2NRT A;  3C2L A;  1U48 A;  2IHN A;  5J0T A;  3HKZ C;  5ALI A;  1L3T A;  4EBC A;  1QH9 A;  3PX6 A;  2QAR A;  4QZF A;  2CXY A;  4QZH A;  4LVS A;  1PVQ A;  1KL9 A;  2FJ6 A;  4EEN A;  4DSI A;  3N7P D;  5DG9 A;  4JK1 A;  2XY5 A;  1X42 A;  1CEZ A;  2BPC A;  1RQN A;  5DBC A;  2KZ3 A;  4Q44 A;  2A1J B;  4F50 A;  8ICC A;  4Y2V A;  2LYA A;  4J9K A;  4QW9 A;  2Y9U A;  4DEZ A;  5J0W A;  4IL6 U;  4UAV A;  3V7K A;  4IRK A;  3MDA A;  4UB3 A;  4EBE A;  3D2N A;  5AKL A;  3FAH A;  1X9S A;  1ARO P;  3LDA A;  5KFH A;  4CE6 A;  4RQ6 A;  3RB6 A;  2E8N A;  7ICJ A;  3CW2 C;  5JUM A;  2F76 X;  2M9N A;  5KFV A;  4QZI A;  5HR7 A;  4BDP A;  2F3N A;  4TQS A;  7ICM A;  8ICU A;  1D9F A;  3IG5 A;  1J2M A;  3TAQ A;  4DQR A;  3H8J A;  2WB1 C;  2PXI A;  4PHA A;  4B9T A;  5KFS A;  2WAQ F;  3LWL A;  4RQ8 A;  4F72 A;  4C80 A;  5HHI A;  3UMG A;  2ZTC A;  3B0Y A;  5KFW A;  2YML A;  2J6T A;  5ALT A;  3K75 D;  3WKB A;  2W04 A;  3RB3 A;  4DL6 A;  2ATL A;  1PUZ A;  4ECU A;  1SV0 A;  4B9S A;  3H8M A;  2HVH A;  3MR3 A;  1KN5 A;  3EW9 A;  5BOM A;  2DKX A;  1L7O A;  3CRX A;  3HP6 A;  2VIX A;  4FS1 A;  2ZIU A;  4P0Q A;  4ECV A;  1N56 A;  5AM0 A;  1ZQC A;  5ALX A;  2K8C B;  2HBL A;  3JPS A;  2K4H A;  2ZIW A;  3SR6 A;  5KFI A;  4NLK A;  5DG7 A;  5DGA A;  3KHR A;  4OJP A;  5L1K A;  2FPM A;  2E8M A;  3TQ1 A;  2M0N A;  4O3N A;  1ZD4 A;  2XI9 A;  5L1L A;  3UQ0 A;  2K89 A;  5KG6 A;  5L1J A;  2W11 A;  3GU3 A;  4UBC A;  2G5I B;  2J6S A;  3E2E A;  1NK0 A;  3AU6 A;  3FDS A;  4YVZ A;  1SL0 A;  7ICT A;  2B21 A;  2RQ5 A;  2R8G A;  5AHX A;  3C21 A;  2MAX A;  5AM5 A;  3OHA A;  3QU2 A;  3VC8 A;  5J8Y A;  3BJY A;  4DWI A;  2BPG A;  1ZQT A;  2OEH A;  3BQT A;  5AM1 A;  3S6J A;  8ICI A;  5ALL A;  3SMV A;  1PZN A;  3IDW A;  2FMP A;  5KFF A;  4E0D A;  4PPX A;  4I2F A;  3V6K A;  2BDP A;  4PL1 A;  4KIT B;  2ZUC A;  3NRZ A;  3T3F A;  5J2K A;  4RNM A;  2HDO A;  5DGB A;  2YMM A;  4RQ0 A;  1JX4 A;  4IR9 A;  3C2K A;  3HKZ F;  1ED1 A;  5L1M A;  3QNM A;  5DQG A;  3PW5 A;  5K4L A;  4BXO B;  4FBU A;  3BZK A;  4JUZ A;  5ALG A;  1SV4 A;  2JEG A;  5AM3 A;  5EOZ A;  1KFS A;  3HPO A;  2EAO A;  1RM6 C;  1SGG A;  2ZXH A;  1ZQ1 C;  2YB1 A;  4I2H A;  4J9M A;  2E8P A;  5AKJ A;  4QWE A;  5KFX A;  3PNC A;  1KDH A;  2H3Z A;  2JXJ A;  4CF5 A;  3GIL A;  3NRW A;  1IV8 A;  5D4B A;  2NV3 A;  1KFT A;  7ICU A;  3RAQ A;  5KFG A;  4CF3 A;  4PL2 A;  4F92 B;  1TAU A;  3SAF A;  1D8B A;  1NZP A;  4ECR A;  9ICA A;  1CRX A;  1QTM A;  1ZRM A;  1JRO A;  2NO5 A;  2HHU A;  5EE3 A;  5ALD A;  2VA3 A;  2JV3 A;  4EEY A;  3ZDD A;  5DDM A;  3QU4 A;  4JV1 A;  7ICP A;  1Z00 B;  5AKX A;  3PST A;  5J2H A;  8ICQ A;  4M9H A;  2LM1 A;  4O9M A;  3HRD D;  4RNN A;  3TFS A;  1GO3 F;  2ZIV A;  2W43 A;  4Z6D A;  5G5H A;  1XO0 A;  4OCZ A;  2W9C B;  1ZRN A;  4NWI A;  3NUQ A;  4KTQ A;  1PVP A;  2KHQ A;  2KSO B;  5ALR A;  2H5X A;  4C0Z A;  1JN3 A;  2KFN A;  5CEH A;  3HW8 A;  2KHV A;  1FFV A;  1X9M A;  2E5S A;  4DSF A;  2B6G A;  4WJ3 B;  4PGY A;  1ZQU A;  5AKH A;  1RYS A;  1S0M A;  1XWL A;  2BCU A;  3C28 A;  3Q8M A;  4ACO A;  3Q8R B;  5KFO A;  2OM6 A;  2G09 A;  1S0V A;  4UAR A;  4B9U A;  2ZTE A;  9ICN A;  4UB4 A;  3ICX A;  1IG6 A;  3IV6 A;  8ICZ A;  3M1Y A;  3SEI A;  5CR0 A;  2W3R A;  2YQE A;  4PZN A;  4BUG A;  5KFQ A;  5KFC A;  3PW4 A;  5AK4 A;  2JR5 A;  5KL1 B;  3C1Z A;  2AGO A;  3PMN A;  3H7I A;  2NO4 A;  2DPI A;  5HHH A;  2Y0S F;  3NVV A;  7ICV A;  1MC8 A;  1ZQV A;  3HJE A;  5J0O A;  3V6J A;  4F93 B;  4US9 A;  4YP3 A;  1SL2 A;  9ICU A;  1L8L A;  2ZJ5 A;  9ICF A;  1FO4 A;  4DSL A;  4C4S A;  4DL2 A;  3SQI A;  1V9P A;  1HEK A;  1A77 A;  1ZQN A;  4YR2 A;  1LV5 A;  3PSF A;  5DBA A;  5DB9 A;  3WK5 A;  2ZTD A;  2IOF K;  1N63 A;  4KX3 A;  2OXO A;  8ICL A;  3AU2 A;  4Y2S A;  1ZQE A;  1UT5 A;  3HT3 A;  5DDY A;  4NLC A;  2VKQ A;  1J2N A;  1ZQR A;  4OJO A;  4QW8 A;  5IIJ A;  2VJ4 A;  2DQN B;  4QZ9 A;  5HNK A;  3AL0 B;  4NLG A;  8ICJ A;  2MRL A;  3PO4 A;  4UAY A;  1RPL A;  1TK8 A;  4DF8 A;  4K4I A;  4PH5 A;  8ICY A;  5J0P A;  5AIA A;  2G07 A;  4UAT A;  2MU2 A;  3GV5 B;  2KP7 A;  5DB6 A;  2G06 A;  2JH7 A;  5KG1 A;  3UMC A;  3RR7 A;  7ICI A;  3E58 A;  3EPI A;  2V4Q A;  5DB8 A;  1Z4N A;  2WF5 A;  1D9D A;  3TAP A;  3DV9 A;  2KZM A;  3KKA C;  3H8S A;  1ZJN A;  4TUP A;  4JMU A;  3UXP A;  2WF6 A;  3MGI A;  4JWM A;  2RDI A;  3CYM A;  4M9N A;  4KN7 A;  3MFH A;  3AEV A;  3SI8 A;  4CNQ A;  3GDX A;  5KG7 A;  5L1I A;  1MQ3 A;  5KFM A;  4B9V A;  1SB3 C;  1QSS A;  4A8E A;  3T5J A;  2E8O A;  1UQV A;  4F5O A;  2FDR A;  2WTF A;  5ALY A;  3JPP A;  1RZT A;  2NRX A;  1URJ A;  2GO7 A;  4IC9 A;  5IIM A;  3QXG A;  1KW4 A;  2B0C A;  2WAQ C;  4TQR A;  4I2D A;  4OJL A;  5J0S A;  5J0Y A;  2AJQ A;  1ZD2 P;  2YB4 A;  5KFR A;  2CRX A;  4QNL A;  4ECZ A;  5HP4 A;  4DQS A;  4KLQ A;  1T94 A;  1NK9 A;  4QZC A;  4B9L A;  4US8 A;  3RBD A;  5AM4 A;  1WUD A;  1TK5 A;  4Y2T A;  3FC4 A;  1KSP A;  1RXW A;  2WB1 F;  3MR5 A;  5A0L A;  2W03 A;  1Z19 A;  3SEN A;  3QU9 A;  2FLN A;  2H3I A;  2HVI A;  2MUT B;  2XY6 A;  4P4O A;  1EXN A;  1JUD A;  1NZB A;  7ICQ A;  3PSI A;  2D8C A;  2BZF A;  1NI3 A;  1NK4 A;  4O3S A;  3KTQ A;  1DRG A;  2ZG6 A;  1X6J A;  3NVY A;  4KLI A;  1LKY A;  5BOL A;  4CRX A;  1YT3 A;  1YZ7 A;  1QQ5 A;  2W9B A;  5ALV A;  5ALP A;  4IRC A;  4R64 A;  3M9M B;  2XIC A;  1KBU A;  9ICG A;  4ED7 A;  1L8O A; 
#chains in the Genus database with same CATH homology
 4OJ6 A;  1Q3U A;  2E1E A;  4ICA A;  4A8E A;  4BUG A;  2JHD A;  2ZIU A;  4P0Q A;  2RRD A;  2F77 X;  2LYB A;  2PMZ F;  1PVQ A;  2K8C B;  5KL1 B;  2HBL A;  3OPX A;  2DGZ A;  2K4H A;  2ZXH A;  1ZQ1 C;  2YB1 A;  2ZIW A;  3ONN A;  1A6S A;  1A0P A;  2Q4T A;  3AQE A;  2KIC A;  3N7P D;  2DF4 B;  2JGA A;  1URJ A;  2XID A;  1HIW A;  2R18 A;  2G08 A;  4IC9 A;  3IP4 B;  2Y0S F;  3K1Z A;  4FE3 A;  4AYB F;  3F2B A;  2H3Z A;  2WAQ C;  3D2S A;  2XVT A;  4FZL A;  3GZF A;  4OJL A;  2HBJ A;  2KOB A;  2K8A A;  2YB4 A;  2N1R A;  3NRW A;  3O0F A;  4NLB A;  2KVC A;  2NV3 A;  4OJP A;  2CRX A;  4QNL A;  2H3Q A;  2G5H B;  2KEY A;  3KFU F;  2ZIX A;  1T94 A;  2M0N A;  3IG8 A;  4OJ5 A;  4PL2 A;  2CN1 A;  1D8B A;  3SAF A;  2PMZ C;  2JMG A;  2OH2 A;  3VCB A;  4AYB C;  3N7S C;  2XI9 A;  1P7D A;  2KJ8 A;  2LYA A;  3ALR A;  3SQI A;  2KJ5 A;  2ZXI A;  2H3F A;  3H0M B;  4P0Q B;  1HEK A;  1WUD A;  2H3V A;  4NV0 A;  1CRX A;  2VJ5 A;  2K89 A;  2Y0S C;  3PSF A;  2ZIW B;  3LYS A;  2HMX A;  2WB1 F;  4KMO B;  4U6P A;  3D2N A;  3CP8 A;  3LVW A;  1ECW A;  5A0L A;  2W03 A;  3GU3 A;  2F8L A;  2ZIV B;  3PSP A;  3MGV A;  1Z19 A;  5CRX A;  3RFA A;  1PVR A;  2G5I B;  5HR6 A;  4KX3 A;  3PST A;  1F44 A;  2OXO A;  3D2Q A;  2W7O A;  3IN5 A;  2KKP A;  3DEE A;  2F76 X;  2K4I A;  4U7C A;  4NLC A;  2VKQ A;  1UPH A;  1TAM A;  3AQF A;  2K4E A;  5HR7 A;  2YX8 A;  4OJO A;  4CDG A;  2HOI A;  2VJ4 A;  3LVV A;  1GO3 F;  2ZIV A;  2F2A B;  3M7D A;  4BJQ A;  2DQN B;  3C29 A;  2H3I A;  1XNS A;  2KIW A;  3F2D A;  1XO0 A;  1Q3V A;  3AL0 B;  3IG5 A;  3F5E A;  1NZB A;  2LKY A;  3PSI A;  1IIP A;  2MRL A;  4GFJ A;  1OUQ A;  4NWI A;  2LHT A;  3NUQ A;  2KNJ A;  4P0P A;  2WB1 C;  1PVP A;  2KHQ A;  2D6F C;  3VC8 A;  3F53 A;  3M6Z A;  2KJ9 A;  2OYY A;  2WAQ F;  4C0Z A;  2KV2 A;  2HBM A;  4QIW C;  1DRG A;  2KHV A;  2ZG6 A;  2E5S A;  3SMV A;  3RF9 A;  2G07 A;  2W7P A;  2HOF A;  2RP5 A;  2GOL A;  2ZIX B;  4O3M A;  2GH1 A;  2JH7 A;  2G06 A;  4QIW F;  3F5A A;  4P0P B;  4WJ3 B;  4CGZ A;  1L6N A;  4PL1 A;  1MA7 A;  3C28 A;  2JH1 A;  2W04 A;  4ACO A;  3F2C A;  4CRX A;  3M6K A;  2LBO A;  2OM6 A;  3N7R C;  2CPR A;  3KZX A;  2HBK A;  1YT3 A;  1SZH A;  2G09 A;  5KL8 B;  3SAH A;  3SAG A;  3L3F X;  2BDU A;  2Z7J A;  3HKZ F;  4FZN A;  1ED1 A;  4JMU A;  4QJF B;  5T14 A;  3PZP A;  2K8B B;  3E0F A;  3T79 A;  2MA1 A;  2XIC A;  1KBU A;  2G0A A;  1Z1B A;  3ICX A;  2A3V A;  4KX5 A;  3CYM A;  4FZM A;  3HKZ C;  2E1F A;  4BX9 C;  2ZIU B;  4OO1 J;  5C0Y A;  2KKV A;  3H0L B;  2KD1 A;  3CRX A;  2VIX A;  3H0R B;  2HOQ A;  2RHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...