2LYBA

Structure of hiv-1 myr(-) matrix protein in complex with 1,2-dioctanoyl-sn-phosphatidyl-l-serine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
b'GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein p17
publication title Trio engagement via plasma membrane phospholipids and the myristoyl moiety governs HIV-1 matrix binding to bilayers.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 35
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lybA01
4JMUA 2K4HA 1L6NA 2HMXA 2H3IA 2K4EA 2N1RA 2H3QA 2H3FA 1TAMA 2JMGA 2K4IA 2H3VA 4ICAA 2NV3A 1HEKA 2LYAA 2H3ZA 1HIWA 1UPHA 4IC9A 1ED1A 2LYBA 2GOLA 1A6SA 1ECWA
chains in the Genus database with same CATH superfamily
4Q45A 4NY8A 4TUSA 5GTIU 2ZIXB 3V7KA 4I2GA 4RQ2A 5EWGA 4X5VA 2AQ0A 2CN1A 4C7ZA 3SAGA 4DQPA 4RUAA 1T3NA 3RH6A 2J6UA 2R8JA 4C80A 1L7NA 3CYMA 4K4GA 2ZG6A 3FAHA 2RLTA 5CHGA 2ALZA 2Y0SF 3AL0B 4OJLA 5J29A 2KN7A 4QWEA 3QEBZ 3IM1A 4DWIA 1JRPA 5AI8A 1D9FA 2K60A 4DQIA 4YXMA 3A0HU 5FP0A 2LPEA 2BCVA 4ECSA 1IV8A 3IDWA 2WB1C 1TVAA 2W9CB 1XO0A 3QU9A 4ZH4A 3C29A 2BPFA 3OHAA 4EELA 1V9PA 3MBYA 4RT3A 2EDUA 3ZDCA 3BZCA 2XIDA 4GLXA 1KL9A 3K1RB 5DG7A 1NJZA 3ETLA 3HRDD 4ECRA 2KJ9A 3E2EA 5L1KA 2BCQA 2DWQA 1RXVA 5KG2A 1LKYA 3HX0A 1NKEA 2KICA 3TAQA 4FS2A 5IIIA 5J0YA 1ZQKA 3LK9A 5J0XA 1JIHA 4O3PA 1OUQA 2KIWA 4ECYA 4F4ZA 4B9NA 4RQ0A 3QEAZ 4KMUA 2E1FA 3TACB 1KBUA 2JH1A 8ICHA 3MC1A 2DGZA 1ZQJA 2CRXA 4R65A 5DBAA 5CP2A 4U7CA 3C28A 9ICQA 2W9AA 9ICWA 1HEKA 2M9NA 1KFSA 9ICTA 4DSIA 3NRWA 1B22A 3M8RA 1T8EA 4Z6DA 4RZRA 5KNIA 1XS9D 1M6YA 4IR1A 3CP8A 3AM9A 4Y2JA 3V72A 2V9WA 2DPIA 8ICKA 3GDXA 1ZQUA 1ZQOA 1U4BA 1V97A 3UMGA 1L5UA 4DF4A 4PHDA 3RB6A 2ASDA 5AM4A 4R8UA 3T5KA 2H3ZA 4RQ1A 5ALVA 1S10A 4CGZA 3OSNA 3GIIA 4PGQA 2R8GA 4M47A 2G08A 4O9MA 4LVSA 9ICPA 4KLDA 1KTQA 1ZQZA 2OXOA 1TKDA 5L1IA 4M04A 3RJFA 1COKA 3WK9A 5KG5A 2YB1A 2XY7A 2JHDA 5KFEA 2HHQA 4F5PA 2G0AA 4CF4A 2WFAA 2E5SA 5AKIA 5KL8B 3ZDEA 1B0XA 3IG8A 1TAUA 5ALNA 4J9OA 1C20A 2Y1JA 1Q46A 3GIMA 4EZ6A 3Q8QB 2E8MA 1A77A 4QZAA 3QUQA 1KKXA 9ICGA 7ICQA 3QXGA 1F0MA 4P0QB 1NK9A 1A76A 7ICPA 2XY5A 4UAUA 5J2IA 2PFNA 2HBMA 2AHOB 3AUOA 4RT2A 5F9NA 4FZNA 4B9VA 5ALGA 4QZ8A 7ICNA 2A1JB 3MGVA 4JWNA 1IXRA 4QZFA 5AI9A 1COOA 4Z6EA 4IRDA 3HKZF 4KLSA 4GXIA 4DL5A 4ED6A 4DOBA 4J9SA 2F8KA 2RDJA 2BPGA 3NVVA 1C7YA 2G5IB 2P35A 2XVTA 3WU2U 4F3OA 4NL9A 4BWMA 3FDSA 1SL1A 5AKZA 4YD1A 5ALQA 5AM2A 3ZD9A 4FFDA 3PW4A 2BDUA 5J2DA 5J0SA 4EEYA 1U45A 1X9MA 3JPNA 1UCVA 3RTVA 2LYAA 2R8KA 8ICJA 5IIKA 2BDPA 4ECZA 4Q8FA 4KX5A 2HW3A 4ECVA 2KK0A 2W9BB 4ED3A 2ZTCA 3LDAA 4TURA 2JEJA 2P6RA 5D49A 2GWSA 1H38A 1URJA 5AKLA 4FO6A 4OJPA 3F2CA 1JXLA 2KJ8A 3QU5A 4C8LA 1TK5A 2W9MA 4K4HA 3C21A 1MSWD 5DDYA 3PX0A 1FFUA 1KFDA 4MFAA 1FFVA 2OHFA 5G5HA 2QB1A 2YX8A 2I5HA 2YQEA 2AGPA 1XSNA 2W03A 2ZUDA 8ICXA 4OJ6A 5J2AA 3D2NA 3VC8A 4F4YA 4F91B 2JV3A 3MR2A 3UQ0A 4YG2A 1X2IA 2NYVA 3KHRA 2HBLA 4UBBA 9ICAA 5KFOA 3T5LA 2UVUA 3T5JA 3HT3A 1N5WA 4DSEA 2BZFA 2ISOA 4UASA 1S0OA 2W7PA 3PSTA 2LBOA 3NRZA 2WF7A 5EE0A 4F5OA 2HOQA 1QQ5A 2ZIVB 4R63A 2KZ3A 2NV3A 2MUTB 5KFSA 4RNNA 4YMOA 1Z00B 1ZRNA 1JI7A 3I76A 2MAXA 4Q43A 3PMLA 2KG5A 2W8KA 1X66A 1BPDA 9ICXA 3QX7A 2KE7A 1ZQSA 2HDOA 3M8SA 2EAMA 3H4DA 3Q8PB 4ED8A 2HI0A 1RYRA 3FYHA 2XY6A 4DEZA 2BQ3A 4NLKA 3ETRA 5D4BA 2KSOA 7ICEA 4O3OA 3V6HA 4DQQA 1D9DA 2J6TA 2N1RA 9ICEA 5E79U 1CEZA 5JU5A 3T79A 3K1ZA 4HYKA 3EPIA 1L8LA 1PK1A 4DOCA 1SWVA 5DBCA 3LVWA 2KZZA 1UT5A 2VKQA 1SL2A 9ICSA 1MA7A 2IA6A 4MFCA 3RFAA 5DG8A 4GC7A 2LI6A 2Z7JA 5EWEA 1NOMA 3BJYA 2VA8A 4GXKA 5EE9A 3QU2A 2R18A 4I2BA 1ZJNA 3CNHA 1NKCA 4P0PA 3PVXA 2ZIUB 2OCEA 8ICGA 4DF8A 5EWFA 1L3SA 2NRZA 4NLZA 4KMOB 2M0NA 3A0BU 1WCNA 5AKKA 2K8BB 5DG9A 4UBCA 1ZD3A 2RDIA 3ONNA 1SIJA 4P4MA 3GV7B 3HJEA 1BPZA 2VANA 1SXEA 3IG5A 2JXJA 2HHXA 3PR5B 2KFZA 3N97B 4Q8EA 3H8WA 3AU2A 3NTUA 4QZIA 2DUYA 8ICNA 4NLCA 4BJQA 2C2DA 3C2KA 1Z19A 5F3XB 5AIAA 2I1QA 3ZDDA 3BQ0A 5AKGA 2IMWP 1F44A 3SMVA 1FO4A 4FBTA 1ZQTA 1XSPA 9ICFA 4RNMA 3V6KA 4DO9A 2ZXIA 1XNSA 2P66A 4IL6U 1ZD5A 1CI4A 2FDRA 5AK5A 4Z6CA 3VCBA 2HMXA 2KOBA 4PGYA 3AQEA 4M2YA 1ZYQA 2H3FA 2B21A 1QSSA 2B0CA 2LHTA 4TQSA 2HHVA 4QZEA 2H3VA 3EW9A 3LWLA 3GZFA 4Y2UA 2DBYA 3FC4A 8ICSA 3ICXA 4EZ9A 3PX4A 1TE2A 2BQUA 4F2SA 3B0YA 1ZQHA 2PFOA 4ELUA 5EE1A 1UT8A 2WHEA 3ALRA 1SZPA 2AXTU 3SD7A 3MFIA 4BUGA 1FIQA 4EBDA 2DPJA 3BS7A 2EAPA 1ZOLA 4UAWA 5J2EA 5C0YA 5HMMA 3ORYA 3SAHA 5AI6A 1DK3A 1LV5A 4UB1A 4O5EA 2PI5A 5EE3A 8ICUA 1ZQRA 4J9LA 4M9HA 4RQMA 3BS5A 4RQNA 4FZMA 4DL6A 5JRTA 4KLFA 1QSLA 1QTMA 5JUMA 1X6IA 4QZCA 4PZNA 3Q8LA 8ICRA 1DXSA 3PY8A 4UAVA 3BQ1A 2EAOA 2Q4TA 4IS7A 4RUCA 1ZQFA 3RR8A 4C7YA 5KFLA 2RP5A 4QW8A 2DFLA 2W43A 4EYHB 5KFNA 2ASJA 5KFFA 5CR0A 2EH9A 4YR0A 2BPCA 1ED1A 4IQWA 5J0UA 3SYZA 2EANA 4DQSA 2JGAA 1NK6A 2K8AA 1N56A 5J2GA 2GLEA 2K89A 1XU4A 3KOOA 1J2NA 5IILA 8ICZA 5KFBA 2W3SA 3QNMA 2UVRA 3I1YA 8ICVA 3O0FA 2VA3A 1BVSA 3HPOA 4OD0A 2R8HA 3NVZA 2F1JA 2L5YA 3RR7A 1BPYA 4O3NA 3RRGA 4M6WB 2ODGA 1A0PA 2HBKA 2E8PA 5ALMA 2KKPA 1B4FA 3HW8A 5IIJA 4PL1A 5ALXA 2P6UA 4YR3A 4J9RA 3MR3A 3RBDA 1EXNA 1ZQYA 2IOHA 2LM4A 1Q8KA 2NRTA 2XCAA 4DS4A 4UB4A 4TQRA 2ZJ8A 4IRKA 2A3VA 5CRXA 3RJIA 4O3SA 4Y2XA 2KFNA 1N5XA 2C2EA 3QZ7A 3RB0A 2WTFA 3GU3A 3B9JA 5KFIA 1CRXA 4F8RA 4ICAA 4AP9A 4YMMA 2HSZA 4Y2YA 3MDCA 2F8LA 1B43A 4FZLA 3PZPA 3QYPA 4OJOA 4QJFB 5JTIA 4QZHA 1S77D 3AU6A 4ED2A 1YZ6A 5AHXA 5BPCA 5ALIA 4F50A 3H8MA 3SAFA 1KQQA 1RYUA 4RQ7A 3RB4A 1TAMA 1KN5A 2W54A 3DV9A 1RG6A 3U26A 4GFJA 4KN7A 1MQ2A 1HIWA 3EPGA 2FJ6A 1S5LU 1KW4A 4OO1J 3KKAA 3M1YA 2NO4A 3HILA 4DFPA 2G5HB 1ZQDA 1PZNA 4RQ5A 3NVWA 5ALZA 1UA0A 4KLGA 1MN8A 2EZYA 5KTQA 5AM3A 4B9LA 2F1IA 1QLNA 1T3QA 4TUQA 7ICHA 1QQ7A 4DLEA 2ZIXA 2PMZC 4UB5A 3RB3A 3TQ1A 4NL9C 3GFKB 2FLNA 4PZOA 5DBBA 5J0TA 5BOLA 4EENA 2C2RA 1QH9A 1ZQPA 3GIJA 4CNQA 3KD3A 1AROP 2KHQA 2H3IA 4KLJA 1QCKA 4M0AA 3RJEA 1X9SA 2QARB 3WKBA 2HHUA 2NRXA 4JV2A 2JRZA 4ZOHC 4Q44A 3SV3A 3F5AA 3GV5B 2VA2A 1SZHA 1ZQNA 3H8JA 1Q3VA 4R64A 4DL3A 5KFDA 2YMQA 4JUZA 1ZQGA 3BQ7A 1NK0A 3CW2C 2BHNA 4F5QA 3GQCA 2JMGA 4RU9A 4KLHA 4I29A 4QNLA 3SI8A 1XO1A 5AKYA 5ALJA 3JPRA 2R8IA 7ICFA 3WK5A 1ZJMA 3I28A 5KAIU 1DOQA 5KT2A 2IBKA 4ECUA 1RM6C 1HJPA 4I2JA 1U47A 1WWUA 3BDPA 4MHVA 5KFKA 4F4XA 2QB0B 2FPLA 2BGWA 4KITB 1KRPA 7ICLA 3RJJA 1UQVA 1HUZA 4P4PA 4AYBF 2Y0SC 2E8OA 5J2CA 1NI3A 5HMLA 3TFSA 4RPZA 1SGGA 7ICSA 9ICUA 2HCFA 5KFMA 4F4WA 2UVWA 2F3NA 3T3FA 2JZBB 5L1LA 4ACOA 1L8OA 4DLGA 2AJQA 2YN4A 4KLLA 2OEHA 3WKEA 5GTHU 2G09A 3H4BA 2KV2A 5AKXA 4F93B 4J9PA 5KFXA 2XC9A 4NLNA 3EZ5A 2C28A 4YMNA 5ALEA 1ZRMA 1SL0A 4GXJA 1FEZA 4B9TA 1RPLA 5IINA 4O5CA 4NLBA 3BQ2A 5ALUA 4EX6A 3SQIA 3M9MB 2XGPA 4DL2A 2O6KA 4PHAA 3OHBA 3PW5A 2YMMA 5KG3A 1K1SA 2K8CB 2GOLA 2IHMA 3KFUF 5CA7A 4MF2A 4I2FA 8ICPA 4I27A 1D8BA 3QZ8A 3M6ZA 1Z4NA 4JV0A 2ASLA 2V4RA 5KT4A 3RRHA 1ZQWA 4F5RA 2DKXA 2G06A 1KDHA 2RHFA 1F5SA 3MDAA 3QUTA 4I2EA 3ISDA 2LYHA 2WAQF 4KX3A 3Q8RB 3MGIA 5DGAA 2JH7A 1IG6A 2JEFA 4BXOB 3L4PA 4P0QA 5K4LA 4UQGA 3RH5A 5KFGA 4OJ5A 5ALOA 4F72A 2AGOA 3IN5A 3JPPA 3N28A 2E1EA 3N7SC 2ZIWB 1ZQ1C 3V7JA 2A1JA 2FE9A 2MSNA 4U6PA 5B66U 4YCXA 5T14A 3J81j 3C2LA 3T5HA 1NZBA 5ALFA 3C5FA 9ICHA 4BWJA 5ALPA 5L9XA 4UATA 3WK8A 1XSLA 4NWIA 4O3QA 4E0DA 3PW7A 2Y9TA 4B9SA 4DSJA 1NZPA 3MABA 2AU0A 3RAQA 5CJ7A 3RH4A 2PXIA 4C8NA 1VJ5A 1J97A 3OJUA 4NLGA 4PPXA 4US8A 4EX7A 1L6NA 4KN4A 2AQ4A 5TISU 4I28A 1S0VA 4NXZA 2W9BA 1Z1VA 5KG7A 4GC6A 8ICTA 3TKAA 1JMSA 4QW9A 3JPQA 1DGJA 1ZD4A 2PFQA 1VDVA 4XQ8A 4PHEA 3L5KA 3Q8MA 1TK0A 5AIBA 3HKZC 3BS5B 4AYBC 4JB3A 3QU7A 3OJSA 7ICMA 4MFFA 4DOAA 1T94A 3JPOA 4Y2SA 1O08A 1TV9A 1RDFA 1ZXIA 5KT7A 1KEJA 4J9NA 1NK4A 4NM2A 3MR5A 3RAXA 4DL7A 1JROA 2MA1A 1IM4A 4YQWA 3WK6A 1RQNA 1N48A 2VIXA 2KMDA 3M9OB 1U49A 3IV6A 3PSPA 5KFQA 3V7LA 2FMQA 3UMCA 4F92B 5HHHA 4I2HA 1P7DA 1PVRA 2H5XA 3WK4A 3RBEA 5DLFA 1S0MA 3THVA 1ZD2P 7ICTA 3UXNA 4QWDA 5KFVA 2MUTA 1NKBA 2J6SA 5H2FU 3NGDA 1JN3A 5AM1A 5B5EU 1Z00A 3G6XA 3TFRA 2W7OA 2FI1A 2WF6A 5HR7A 8ICYA 4XRHA 2W8LA 3AMZA 3NS1A 5KFHA 3PO5A 3B0XA 4I2DA 3F53A 1PVPA 3M7DA 5KFTA 2NRWA 4IC9A 1V85A 2BQRA 5AKJA 2KP7A 1NJWA 1SKWA 2ZJ5A 4QZGA 2IOFK 4IR9A 3BQTA 2KZMA 1LVHA 1N60A 1PVQA 1SV4A 1S0NA 4M9NA 4MF8A 3KZXA 3M9NB 4M9GA 3WKAA 4YR2A 5CEHA 4Y2TA 5HHIA 1KFTA 5KFRA 4KLOA 1D8LA 1Z3EB 4UAZA 5EOZA 2WAQC 3C1ZA 2VJ5A 2OM6A 4NM1A 4G3IA 1LKYB 2KJ5A 7ICIA 5AM5A 4LZDA 1JXEA 5ALWA 5J8YA 1UHUA 4KLQA 3H0LB 2FMSA 1JUDA 1N2XA 3GV8B 4EBEA 3PNCA 1J2MA 4DSKA 9ICIA 3PW2A 4C8OA 4IQUA 4UB8U 3TI0A 5ALKA 4RQ6A 2FPKA 4PH5A 2Y9UA 1MC8A 2ZJAA 2ZIUA 3UM9A 3PX6A 7ICVA 2ZXHA 2IHNA 2MU2A 4FS1A 1X9WA 3D2SA 3AN1A 3FM9A 5IIOA 4J9KA 5HR6A 2LYBA 4IQVA 2XCPA 5DB8A 2RRDA 4O0IA 2BCSA 3ZI4A 4JWMA 5KFWA 4PGXA 1NJYA 5DDMA 5ALLA 4ECQA 4DFDA 4R8UB 9ICLA 5L1JA 1AQ6A 3SV4A 3AEVA 3D2QA 8ICBA 5AI0A 3KKAC 2KTQA 4FE3A 4F2RA 2V4QA 1MQ3A 1PUZA 2XI9A 2KKVA 4US9A 3IHQB 3EUB2 3JPTA 2WF8A 4CE6A 4KLUA 3L3FX 3ZDAA 2D3DA 5AKEA 3AQFA 1Z1BA 5HNKA 4USAA 3NASA 5CWRA 2PFPA 1TK8A 5DB9A 2NO5A 3CRXA 5DLGA 2HHSA 2C22A 4IRCA 3PSIA 2HBJA 1SWWA 2YB4A 1K1QA 3EWAA 1RZTA 5J0OA 2KVCA 2ATLA 2AGQA 4RNOA 2EQYA 3C2MA 3GILA 3TADC 1S9FA 2KIVA 5DKWA 3JPSA 5J0WA 1HUOA 1DK2A 5J0QA 1OW5A 4DFKA 4TUPA 4C8KA 2BCUA 1QQ6A 9ICNA 4CDGA 1DRGA 7ICUA 3LVVA 1S97A 2F77X 1RYSA 1T7PA 3ED5A 9ICMA 4M9JA 1XC9A 2ZTDA 2BR0A 1SKRA 5KFUA 3ZD8A 2MRLA 2JR5A 3HP6A 3S6JA 5C5JA 2ZUBA 2WF9A 4UB6U 2PI4A 2K4HA 2XO7A 3H40A 4YP3A 4I2AA 1Y88A 4RQ4A 3OTQA 8ICEA 2QLTA 4EEKA 3PMNA 1L3VA 2W55A 4ED1A 7ICRA 4K4IA 3C5GA 1UPHA 4QIWF 4QZ9A 7ICKA 2NRVA 2CPRA 4PJ0U 9ICKA 2AH5A 5KFJA 1ZQCA 3PSFA 2HVIA 1ZQBA 4R66A 4DFMA 2Q0ZX 2HHTA 8ICOA 4XA5A 4O3RA 4A8EA 5KG0A 4UARA 1NJXA 4BX9C 5KT3A 2ZUCA 4ECTA 3DDHA 2JEGA 7ICOA 9ICRA 1X40A 2HVHA 5CB1A 3ISBA 3TADA 1L7OA 4C8MA 4RPXA 3MFHA 5KG1A 4UW9A 1YZ7A 4M9LA 4B9UA 1ZQLA 5KT6A 5KL1B 4UB2A 4CCHA 5J0RA 4MEXA 3ZDBA 4M6WA 1NK7A 2WF5A 5KG6A 2YMPA 3UXPA 3K75D 4UAYA 2W9CA 2GO7A 8ICAA 5DQIA 5KFPA 1N63A 2OWOA 1Z4OA 4YVZA 3F5EA 3QUBA 4LJXA 3H7IA 4KLMA 5KFZA 8ICMA 2DF4B 4GIBA 8ICLA 3WKCA 2DL0A 4C4TA 2W11A 2KEYA 4MEYA 1X42A 3UPQA 4Y2PA 5L1MA 2D6FC 1CUKA 3BZKA 1NK8A 3N7RC 2E3TA 1OXJA 2W3RA 5BOMA 1JX4A 5AI4A 4Y2QA 4DQRA 3Q8KA 2EZZA 8ICCA 4ECWA 1X6JA 2Y1IA 1IIPA 4DSFA 3RJHA 5J2JA 4RQ8A 3MGHA 7ICGA 3RF9A 1YT3A 3M6KA 4CF3A 1LB2B 3G6VA 2KSOB 5G5GA 3KHLA 3KZIU 3N7PD 1WCLA 1T4GA 1ZQQA 2KNJA 4P4OA 4B6JA 4J03A 5KFAA 1ZQVA 1PK1B 1ZQIA 3H8SA 4ED7A 2DKZA 4ED0A 1PK3A 2CXYA 4YD2A 3GIKA 4KLIA 1L3TA 4CF5A 9ICVA 5ALHA 4I2IA 2F44A 5AM0A 2EZXA 3NUQA 5ALYA 1JALA 1L7MA 4ECXA 2A1AA 4P0PB 3Q8SB 2A19A 5AKHA 3KHGA 4LZGA 3D6JA 2QARA 4J9MA 3OGUA 4NV0A 3ISCA 4C4SA 5KG4A 1X9XA 4QWBA 5KFCA 5KT5A 3KTQA 3WKDA 3SZ2A 3H0MB 3TARA 3KHHA 3F2DA 8ICFA 4I2CA 8ICQA 1ZQAA 1WUDA 1U48A 2LMRA 9ICBA 2F2AB 1U9LA 1BNOA 1XWLA 2HOFA 5IIMA 1TAQA 2K4EA 4QIWC 5AK3A 4XUSA 3QU4A 2YY6A 4ELVA 2OH2A 3RJKA 2W04A 1ZETA 2QB0A 2FLPA 5F9LA 5ALDA 4QWCA 4RQ3A 1N62A 2OYYA 2D8CA 3HWTA 4JMUA 2KVSA 4F5NA 1Q3UA 9ICCA 5HP4A 4DSLA 4YFKA 1K5OA 3E0FA 4ELTA 4B9MA 3UXOA 2I9GA 2FMPA 1TFRA 2XGQA 1SXDA 2G07A 4G9BA 3SENA 2B6GA 2JZBA 3PO4A 4DFJA 1NNLA 3TAPA 2ES6A 4C4RA 5AI5A 3E58A 9ICOA 1SV0C 2H3QA 3K4GA 4O3MA 1BNPA 2HOIA 3PR4A 4EBCA 5ALRA 4EYIB 1V38A 4KTQA 9ICJA 2FPMA 3H0RB 3PW0A 1ECWA 4OCZA 3LYSA 4F4KA 4P2HA 3C23A 2HHWA 4QZBA 5KFYA 2FLLA 3DEEA 3V6JA 4KLTA 2YTUA 4Z6FA 2K4IA 1S8OA 2XICA 5J0PA 1ZQMA 1WG8A 1KSPA 4QWAA 3TANA 2WB1F 3NVYA 1SKSA 3IRUA 4DCCA 1D8YA 3F2BA 4PL2A 4IQTA 5J8YC 4CRXA 2K4PA 3WK7A 1BPBA 5D46A 5J2FA 3UQ2A 3C1YA 1L7PA 2GH1A 1UA1A 2QKQA 3MR6A 2KHVA 4JV1A 3KBBA 3EYZA 2F1HA 2ZTEA 2E8NA 1NK5A 4FBUA 4PHPA 4RPYA 2ZIVA 2DQNB 3QE9Y 1A6SA 4JK1A 1O03A 2F76X 3OSPA 4BXOA 1BGXT 4C0ZA 3LWMA 4YXJA 4J9QA 5AICA 4YN4A 1VLBA 1QSYA 2VJ4A 1SV0A 2IOFA 1KLNA 8ICIA 3IP4B 4Y2VA 2ZIWA 3OPXA 5DQGA 2ESEA 5KAFU 1DGSA 1RXWA 4BDPA 3SEIA 3UMBA 3R9KA 5ALSA 1ZQXA 3RJGA 5ALTA 3N4MB 5DGBA 4WJ3B 2YMLA 5AK6A 7ICJA 1ZQEA 2PKEA 2RQ5A 5J2HA 3SR6A 2PMZF 5A0LA 4BGDA 1WWVA 2UVVA 4QZDA 4O5KA 2BKEA 8ICWA 1L3UA 2ISPA 5J2KA 5DB7A 1BPXA 4DL4A 1WYGA 1SB3C 2LM1A 5J2BA 2LKYA 1RQLA 2I6XA 5AK4A 4F71A 2BCRA 5DQHA 4HAIA 4DS5A 2JEIA 4NJ8A 3PV8A 4KLEA 1GO3F 4Y2RA 5TZVA 1N61A 3QUCA 2KD1A 1S76D 1BPEA 5DB6A 4UB3A 3G6YA
chains in the Genus database with same CATH topology
2OYYA 3PSFA 1Q3VA 2A3VA 4JMUA 5CRXA 2KNJA 1D8BA 4KMOB 2M0NA 1L6NA 2W7PA 4C0ZA 2DGZA 3M6ZA 1PVQA 1Q3UA 3PSTA 3L3FX 2LBOA 3MGVA 2CRXA 2HOQA 2ZIXB 3KZXA 3E0FA 2K8BB 3AQFA 3GU3A 2ZIVB 3ONNA 4U7CA 4A8EA 3C28A 2JMGA 1Z1BA 1CRXA 3HKZF 4ICAA 2CN1A 4FZMA 3IG5A 2NV3A 2VJ4A 3SAGA 4QNLA 2G06A 1HEKA 4BX9C 3CRXA 2G07A 2F8LA 3IP4B 4FZLA 2ZIWA 2WAQC 3OPXA 3NRWA 2VJ5A 2OM6A 3PZPA 2RHFA 4OJOA 4QJFB 2G5IB 2XVTA 3CYMA 2KJ5A 2ZG6A 3PSIA 3HKZC 2HBJA 3NUQA 4NLCA 4AYBC 2Q4TA 2Y0SF 3AL0B 2YB4A 3CP8A 4OJLA 3SAFA 1T94A 4P0PB 4BJQA 5KL1B 1Z19A 2BDUA 2H3QA 2WAQF 4KX3A 2RP5A 4O3MA 1TAMA 2KVCA 2JH7A 3H0LB 2HOIA 4AYBF 4GFJA 2MA1A 3SMVA 1F44A 4WJ3B 2Y0SC 2LYAA 1HIWA 2H3ZA 2ZXIA 4NV0A 4P0QA 2VIXA 1ED1A 3H0RB 1XNSA 4OO1J 4CGZA 4KX5A 1ECWA 2JGAA 2G5HB 3F5EA 2G08A 2K8AA 3LYSA 4OJ5A 2ZIUA 3PSPA 2K89A 3VCBA 2PMZF 2HMXA 2OXOA 2KOBA 3AQEA 2WB1C 5A0LA 3IN5A 3H0MB 2DF4B 2N1RA 1XO0A 4CDGA 3DEEA 1DRGA 2YB1A 3LVVA 2H3FA 2JHDA 3C29A 1URJA 2ZXHA 3F2DA 1P7DA 2F77X 1PVRA 2E1EA 2LHTA 2G0AA 2ZIWB 3N7SC 2K4IA 2H3VA 1ZQ1C 3O0FA 4ACOA 4OJPA 1WUDA 3GZFA 3T79A 3D2SA 2XICA 3F2CA 4U6PA 3K1ZA 2E5SA 2KJ8A 2ZIXA 5KL8B 5T14A 2PMZC 1NZBA 3LVWA 3ICXA 2WB1F 2XIDA 2KEYA 5HR6A 2G09A 2MRLA 2F2AB 2LYBA 3IG8A 2KV2A 2LKYA 2VKQA 2RRDA 2D6FC 3F2BA 4PL2A 3N7RC 1MA7A 2YX8A 1A0PA 2HBKA 2K4HA 2HOFA 3RFAA 4CRXA 2KJ9A 4NWIA 2KHQA 2W03A 2W7OA 2H3IA 2KKPA 2Z7JA 5HR7A 2K4EA 3ALRA 4OJ6A 4QIWC 3D2NA 1GO3F 2KICA 4PL1A 3VC8A 4NLBA 2GH1A 4P0QB 4BUGA 2R18A 3SQIA 1IIPA 2KHVA 1OUQA 4P0PA 3D2QA 2HBLA 2OH2A 3F53A 2W04A 3F5AA 4FE3A 1PVPA 2ZIUB 5C0YA 2HBMA 2KIWA 3M7DA 2KD1A 3RF9A 1UPHA 4IC9A 4QIWF 1YT3A 2ZIVA 1SZHA 2DQNB 2K8CB 3M6KA 2GOLA 3KFUF 2XI9A 2CPRA 2KKVA 1A6SA 3N7PD 4FZNA 2E1FA 2F76X 3SAHA 1KBUA 2JH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JMU A;  2K4H A;  1L6N A;  2HMX A;  2H3I A;  2K4E A;  2N1R A;  2H3Q A;  2H3F A;  1TAM A;  2JMG A;  2K4I A;  2H3V A;  4ICA A;  2NV3 A;  1HEK A;  2LYA A;  2H3Z A;  1HIW A;  1UPH A;  4IC9 A;  1ED1 A;  2LYB A;  2GOL A;  1A6S A;  1ECW A; 
#chains in the Genus database with same CATH topology
 4Q45 A;  4NY8 A;  4TUS A;  5GTI U;  2ZIX B;  3V7K A;  4I2G A;  4RQ2 A;  5EWG A;  4X5V A;  2AQ0 A;  2CN1 A;  4C7Z A;  3SAG A;  4DQP A;  4RUA A;  1T3N A;  3RH6 A;  2J6U A;  2R8J A;  4C80 A;  1L7N A;  3CYM A;  4K4G A;  2ZG6 A;  3FAH A;  2RLT A;  5CHG A;  2ALZ A;  2Y0S F;  3AL0 B;  4OJL A;  5J29 A;  2KN7 A;  4QWE A;  3QEB Z;  3IM1 A;  4DWI A;  1JRP A;  5AI8 A;  1D9F A;  2K60 A;  4DQI A;  4YXM A;  3A0H U;  5FP0 A;  2LPE A;  2BCV A;  4ECS A;  1IV8 A;  3IDW A;  2WB1 C;  1TVA A;  2W9C B;  1XO0 A;  3QU9 A;  4ZH4 A;  3C29 A;  2BPF A;  3OHA A;  4EEL A;  1V9P A;  3MBY A;  4RT3 A;  2EDU A;  3ZDC A;  3BZC A;  2XID A;  4GLX A;  1KL9 A;  3K1R B;  5DG7 A;  1NJZ A;  3ETL A;  3HRD D;  4ECR A;  2KJ9 A;  3E2E A;  5L1K A;  2BCQ A;  2DWQ A;  1RXV A;  5KG2 A;  1LKY A;  3HX0 A;  1NKE A;  2KIC A;  3TAQ A;  4FS2 A;  5III A;  5J0Y A;  1ZQK A;  3LK9 A;  5J0X A;  1JIH A;  4O3P A;  1OUQ A;  2KIW A;  4ECY A;  4F4Z A;  4B9N A;  4RQ0 A;  3QEA Z;  4KMU A;  2E1F A;  3TAC B;  1KBU A;  2JH1 A;  8ICH A;  3MC1 A;  2DGZ A;  1ZQJ A;  2CRX A;  4R65 A;  5DBA A;  5CP2 A;  4U7C A;  3C28 A;  9ICQ A;  2W9A A;  9ICW A;  1HEK A;  2M9N A;  1KFS A;  9ICT A;  4DSI A;  3NRW A;  1B22 A;  3M8R A;  1T8E A;  4Z6D A;  4RZR A;  5KNI A;  1XS9 D;  1M6Y A;  4IR1 A;  3CP8 A;  3AM9 A;  4Y2J A;  3V72 A;  2V9W A;  2DPI A;  8ICK A;  3GDX A;  1ZQU A;  1ZQO A;  1U4B A;  1V97 A;  3UMG A;  1L5U A;  4DF4 A;  4PHD A;  3RB6 A;  2ASD A;  5AM4 A;  4R8U A;  3T5K A;  2H3Z A;  4RQ1 A;  5ALV A;  1S10 A;  4CGZ A;  3OSN A;  3GII A;  4PGQ A;  2R8G A;  4M47 A;  2G08 A;  4O9M A;  4LVS A;  9ICP A;  4KLD A;  1KTQ A;  1ZQZ A;  2OXO A;  1TKD A;  5L1I A;  4M04 A;  3RJF A;  1COK A;  3WK9 A;  5KG5 A;  2YB1 A;  2XY7 A;  2JHD A;  5KFE A;  2HHQ A;  4F5P A;  2G0A A;  4CF4 A;  2WFA A;  2E5S A;  5AKI A;  5KL8 B;  3ZDE A;  1B0X A;  3IG8 A;  1TAU A;  5ALN A;  4J9O A;  1C20 A;  2Y1J A;  1Q46 A;  3GIM A;  4EZ6 A;  3Q8Q B;  2E8M A;  1A77 A;  4QZA A;  3QUQ A;  1KKX A;  9ICG A;  7ICQ A;  3QXG A;  1F0M A;  4P0Q B;  1NK9 A;  1A76 A;  7ICP A;  2XY5 A;  4UAU A;  5J2I A;  2PFN A;  2HBM A;  2AHO B;  3AUO A;  4RT2 A;  5F9N A;  4FZN A;  4B9V A;  5ALG A;  4QZ8 A;  7ICN A;  2A1J B;  3MGV A;  4JWN A;  1IXR A;  4QZF A;  5AI9 A;  1COO A;  4Z6E A;  4IRD A;  3HKZ F;  4KLS A;  4GXI A;  4DL5 A;  4ED6 A;  4DOB A;  4J9S A;  2F8K A;  2RDJ A;  2BPG A;  3NVV A;  1C7Y A;  2G5I B;  2P35 A;  2XVT A;  3WU2 U;  4F3O A;  4NL9 A;  4BWM A;  3FDS A;  1SL1 A;  5AKZ A;  4YD1 A;  5ALQ A;  5AM2 A;  3ZD9 A;  4FFD A;  3PW4 A;  2BDU A;  5J2D A;  5J0S A;  4EEY A;  1U45 A;  1X9M A;  3JPN A;  1UCV A;  3RTV A;  2LYA A;  2R8K A;  8ICJ A;  5IIK A;  2BDP A;  4ECZ A;  4Q8F A;  4KX5 A;  2HW3 A;  4ECV A;  2KK0 A;  2W9B B;  4ED3 A;  2ZTC A;  3LDA A;  4TUR A;  2JEJ A;  2P6R A;  5D49 A;  2GWS A;  1H38 A;  1URJ A;  5AKL A;  4FO6 A;  4OJP A;  3F2C A;  1JXL A;  2KJ8 A;  3QU5 A;  4C8L A;  1TK5 A;  2W9M A;  4K4H A;  3C21 A;  1MSW D;  5DDY A;  3PX0 A;  1FFU A;  1KFD A;  4MFA A;  1FFV A;  2OHF A;  5G5H A;  2QB1 A;  2YX8 A;  2I5H A;  2YQE A;  2AGP A;  1XSN A;  2W03 A;  2ZUD A;  8ICX A;  4OJ6 A;  5J2A A;  3D2N A;  3VC8 A;  4F4Y A;  4F91 B;  2JV3 A;  3MR2 A;  3UQ0 A;  4YG2 A;  1X2I A;  2NYV A;  3KHR A;  2HBL A;  4UBB A;  9ICA A;  5KFO A;  3T5L A;  2UVU A;  3T5J A;  3HT3 A;  1N5W A;  4DSE A;  2BZF A;  2ISO A;  4UAS A;  1S0O A;  2W7P A;  3PST A;  2LBO A;  3NRZ A;  2WF7 A;  5EE0 A;  4F5O A;  2HOQ A;  1QQ5 A;  2ZIV B;  4R63 A;  2KZ3 A;  2NV3 A;  2MUT B;  5KFS A;  4RNN A;  4YMO A;  1Z00 B;  1ZRN A;  1JI7 A;  3I76 A;  2MAX A;  4Q43 A;  3PML A;  2KG5 A;  2W8K A;  1X66 A;  1BPD A;  9ICX A;  3QX7 A;  2KE7 A;  1ZQS A;  2HDO A;  3M8S A;  2EAM A;  3H4D A;  3Q8P B;  4ED8 A;  2HI0 A;  1RYR A;  3FYH A;  2XY6 A;  4DEZ A;  2BQ3 A;  4NLK A;  3ETR A;  5D4B A;  2KSO A;  7ICE A;  4O3O A;  3V6H A;  4DQQ A;  1D9D A;  2J6T A;  2N1R A;  9ICE A;  5E79 U;  1CEZ A;  5JU5 A;  3T79 A;  3K1Z A;  4HYK A;  3EPI A;  1L8L A;  1PK1 A;  4DOC A;  1SWV A;  5DBC A;  3LVW A;  2KZZ A;  1UT5 A;  2VKQ A;  1SL2 A;  9ICS A;  1MA7 A;  2IA6 A;  4MFC A;  3RFA A;  5DG8 A;  4GC7 A;  2LI6 A;  2Z7J A;  5EWE A;  1NOM A;  3BJY A;  2VA8 A;  4GXK A;  5EE9 A;  3QU2 A;  2R18 A;  4I2B A;  1ZJN A;  3CNH A;  1NKC A;  4P0P A;  3PVX A;  2ZIU B;  2OCE A;  8ICG A;  4DF8 A;  5EWF A;  1L3S A;  2NRZ A;  4NLZ A;  4KMO B;  2M0N A;  3A0B U;  1WCN A;  5AKK A;  2K8B B;  5DG9 A;  4UBC A;  1ZD3 A;  2RDI A;  3ONN A;  1SIJ A;  4P4M A;  3GV7 B;  3HJE A;  1BPZ A;  2VAN A;  1SXE A;  3IG5 A;  2JXJ A;  2HHX A;  3PR5 B;  2KFZ A;  3N97 B;  4Q8E A;  3H8W A;  3AU2 A;  3NTU A;  4QZI A;  2DUY A;  8ICN A;  4NLC A;  4BJQ A;  2C2D A;  3C2K A;  1Z19 A;  5F3X B;  5AIA A;  2I1Q A;  3ZDD A;  3BQ0 A;  5AKG A;  2IMW P;  1F44 A;  3SMV A;  1FO4 A;  4FBT A;  1ZQT A;  1XSP A;  9ICF A;  4RNM A;  3V6K A;  4DO9 A;  2ZXI A;  1XNS A;  2P66 A;  4IL6 U;  1ZD5 A;  1CI4 A;  2FDR A;  5AK5 A;  4Z6C A;  3VCB A;  2HMX A;  2KOB A;  4PGY A;  3AQE A;  4M2Y A;  1ZYQ A;  2H3F A;  2B21 A;  1QSS A;  2B0C A;  2LHT A;  4TQS A;  2HHV A;  4QZE A;  2H3V A;  3EW9 A;  3LWL A;  3GZF A;  4Y2U A;  2DBY A;  3FC4 A;  8ICS A;  3ICX A;  4EZ9 A;  3PX4 A;  1TE2 A;  2BQU A;  4F2S A;  3B0Y A;  1ZQH A;  2PFO A;  4ELU A;  5EE1 A;  1UT8 A;  2WHE A;  3ALR A;  1SZP A;  2AXT U;  3SD7 A;  3MFI A;  4BUG A;  1FIQ A;  4EBD A;  2DPJ A;  3BS7 A;  2EAP A;  1ZOL A;  4UAW A;  5J2E A;  5C0Y A;  5HMM A;  3ORY A;  3SAH A;  5AI6 A;  1DK3 A;  1LV5 A;  4UB1 A;  4O5E A;  2PI5 A;  5EE3 A;  8ICU A;  1ZQR A;  4J9L A;  4M9H A;  4RQM A;  3BS5 A;  4RQN A;  4FZM A;  4DL6 A;  5JRT A;  4KLF A;  1QSL A;  1QTM A;  5JUM A;  1X6I A;  4QZC A;  4PZN A;  3Q8L A;  8ICR A;  1DXS A;  3PY8 A;  4UAV A;  3BQ1 A;  2EAO A;  2Q4T A;  4IS7 A;  4RUC A;  1ZQF A;  3RR8 A;  4C7Y A;  5KFL A;  2RP5 A;  4QW8 A;  2DFL A;  2W43 A;  4EYH B;  5KFN A;  2ASJ A;  5KFF A;  5CR0 A;  2EH9 A;  4YR0 A;  2BPC A;  1ED1 A;  4IQW A;  5J0U A;  3SYZ A;  2EAN A;  4DQS A;  2JGA A;  1NK6 A;  2K8A A;  1N56 A;  5J2G A;  2GLE A;  2K89 A;  1XU4 A;  3KOO A;  1J2N A;  5IIL A;  8ICZ A;  5KFB A;  2W3S A;  3QNM A;  2UVR A;  3I1Y A;  8ICV A;  3O0F A;  2VA3 A;  1BVS A;  3HPO A;  4OD0 A;  2R8H A;  3NVZ A;  2F1J A;  2L5Y A;  3RR7 A;  1BPY A;  4O3N A;  3RRG A;  4M6W B;  2ODG A;  1A0P A;  2HBK A;  2E8P A;  5ALM A;  2KKP A;  1B4F A;  3HW8 A;  5IIJ A;  4PL1 A;  5ALX A;  2P6U A;  4YR3 A;  4J9R A;  3MR3 A;  3RBD A;  1EXN A;  1ZQY A;  2IOH A;  2LM4 A;  1Q8K A;  2NRT A;  2XCA A;  4DS4 A;  4UB4 A;  4TQR A;  2ZJ8 A;  4IRK A;  2A3V A;  5CRX A;  3RJI A;  4O3S A;  4Y2X A;  2KFN A;  1N5X A;  2C2E A;  3QZ7 A;  3RB0 A;  2WTF A;  3GU3 A;  3B9J A;  5KFI A;  1CRX A;  4F8R A;  4ICA A;  4AP9 A;  4YMM A;  2HSZ A;  4Y2Y A;  3MDC A;  2F8L A;  1B43 A;  4FZL A;  3PZP A;  3QYP A;  4OJO A;  4QJF B;  5JTI A;  4QZH A;  1S77 D;  3AU6 A;  4ED2 A;  1YZ6 A;  5AHX A;  5BPC A;  5ALI A;  4F50 A;  3H8M A;  3SAF A;  1KQQ A;  1RYU A;  4RQ7 A;  3RB4 A;  1TAM A;  1KN5 A;  2W54 A;  3DV9 A;  1RG6 A;  3U26 A;  4GFJ A;  4KN7 A;  1MQ2 A;  1HIW A;  3EPG A;  2FJ6 A;  1S5L U;  1KW4 A;  4OO1 J;  3KKA A;  3M1Y A;  2NO4 A;  3HIL A;  4DFP A;  2G5H B;  1ZQD A;  1PZN A;  4RQ5 A;  3NVW A;  5ALZ A;  1UA0 A;  4KLG A;  1MN8 A;  2EZY A;  5KTQ A;  5AM3 A;  4B9L A;  2F1I A;  1QLN A;  1T3Q A;  4TUQ A;  7ICH A;  1QQ7 A;  4DLE A;  2ZIX A;  2PMZ C;  4UB5 A;  3RB3 A;  3TQ1 A;  4NL9 C;  3GFK B;  2FLN A;  4PZO A;  5DBB A;  5J0T A;  5BOL A;  4EEN A;  2C2R A;  1QH9 A;  1ZQP A;  3GIJ A;  4CNQ A;  3KD3 A;  1ARO P;  2KHQ A;  2H3I A;  4KLJ A;  1QCK A;  4M0A A;  3RJE A;  1X9S A;  2QAR B;  3WKB A;  2HHU A;  2NRX A;  4JV2 A;  2JRZ A;  4ZOH C;  4Q44 A;  3SV3 A;  3F5A A;  3GV5 B;  2VA2 A;  1SZH A;  1ZQN A;  3H8J A;  1Q3V A;  4R64 A;  4DL3 A;  5KFD A;  2YMQ A;  4JUZ A;  1ZQG A;  3BQ7 A;  1NK0 A;  3CW2 C;  2BHN A;  4F5Q A;  3GQC A;  2JMG A;  4RU9 A;  4KLH A;  4I29 A;  4QNL A;  3SI8 A;  1XO1 A;  5AKY A;  5ALJ A;  3JPR A;  2R8I A;  7ICF A;  3WK5 A;  1ZJM A;  3I28 A;  5KAI U;  1DOQ A;  5KT2 A;  2IBK A;  4ECU A;  1RM6 C;  1HJP A;  4I2J A;  1U47 A;  1WWU A;  3BDP A;  4MHV A;  5KFK A;  4F4X A;  2QB0 B;  2FPL A;  2BGW A;  4KIT B;  1KRP A;  7ICL A;  3RJJ A;  1UQV A;  1HUZ A;  4P4P A;  4AYB F;  2Y0S C;  2E8O A;  5J2C A;  1NI3 A;  5HML A;  3TFS A;  4RPZ A;  1SGG A;  7ICS A;  9ICU A;  2HCF A;  5KFM A;  4F4W A;  2UVW A;  2F3N A;  3T3F A;  2JZB B;  5L1L A;  4ACO A;  1L8O A;  4DLG A;  2AJQ A;  2YN4 A;  4KLL A;  2OEH A;  3WKE A;  5GTH U;  2G09 A;  3H4B A;  2KV2 A;  5AKX A;  4F93 B;  4J9P A;  5KFX A;  2XC9 A;  4NLN A;  3EZ5 A;  2C28 A;  4YMN A;  5ALE A;  1ZRM A;  1SL0 A;  4GXJ A;  1FEZ A;  4B9T A;  1RPL A;  5IIN A;  4O5C A;  4NLB A;  3BQ2 A;  5ALU A;  4EX6 A;  3SQI A;  3M9M B;  2XGP A;  4DL2 A;  2O6K A;  4PHA A;  3OHB A;  3PW5 A;  2YMM A;  5KG3 A;  1K1S A;  2K8C B;  2GOL A;  2IHM A;  3KFU F;  5CA7 A;  4MF2 A;  4I2F A;  8ICP A;  4I27 A;  1D8B A;  3QZ8 A;  3M6Z A;  1Z4N A;  4JV0 A;  2ASL A;  2V4R A;  5KT4 A;  3RRH A;  1ZQW A;  4F5R A;  2DKX A;  2G06 A;  1KDH A;  2RHF A;  1F5S A;  3MDA A;  3QUT A;  4I2E A;  3ISD A;  2LYH A;  2WAQ F;  4KX3 A;  3Q8R B;  3MGI A;  5DGA A;  2JH7 A;  1IG6 A;  2JEF A;  4BXO B;  3L4P A;  4P0Q A;  5K4L A;  4UQG A;  3RH5 A;  5KFG A;  4OJ5 A;  5ALO A;  4F72 A;  2AGO A;  3IN5 A;  3JPP A;  3N28 A;  2E1E A;  3N7S C;  2ZIW B;  1ZQ1 C;  3V7J A;  2A1J A;  2FE9 A;  2MSN A;  4U6P A;  5B66 U;  4YCX A;  5T14 A;  3J81 j;  3C2L A;  3T5H A;  1NZB A;  5ALF A;  3C5F A;  9ICH A;  4BWJ A;  5ALP A;  5L9X A;  4UAT A;  3WK8 A;  1XSL A;  4NWI A;  4O3Q A;  4E0D A;  3PW7 A;  2Y9T A;  4B9S A;  4DSJ A;  1NZP A;  3MAB A;  2AU0 A;  3RAQ A;  5CJ7 A;  3RH4 A;  2PXI A;  4C8N A;  1VJ5 A;  1J97 A;  3OJU A;  4NLG A;  4PPX A;  4US8 A;  4EX7 A;  1L6N A;  4KN4 A;  2AQ4 A;  5TIS U;  4I28 A;  1S0V A;  4NXZ A;  2W9B A;  1Z1V A;  5KG7 A;  4GC6 A;  8ICT A;  3TKA A;  1JMS A;  4QW9 A;  3JPQ A;  1DGJ A;  1ZD4 A;  2PFQ A;  1VDV A;  4XQ8 A;  4PHE A;  3L5K A;  3Q8M A;  1TK0 A;  5AIB A;  3HKZ C;  3BS5 B;  4AYB C;  4JB3 A;  3QU7 A;  3OJS A;  7ICM A;  4MFF A;  4DOA A;  1T94 A;  3JPO A;  4Y2S A;  1O08 A;  1TV9 A;  1RDF A;  1ZXI A;  5KT7 A;  1KEJ A;  4J9N A;  1NK4 A;  4NM2 A;  3MR5 A;  3RAX A;  4DL7 A;  1JRO A;  2MA1 A;  1IM4 A;  4YQW A;  3WK6 A;  1RQN A;  1N48 A;  2VIX A;  2KMD A;  3M9O B;  1U49 A;  3IV6 A;  3PSP A;  5KFQ A;  3V7L A;  2FMQ A;  3UMC A;  4F92 B;  5HHH A;  4I2H A;  1P7D A;  1PVR A;  2H5X A;  3WK4 A;  3RBE A;  5DLF A;  1S0M A;  3THV A;  1ZD2 P;  7ICT A;  3UXN A;  4QWD A;  5KFV A;  2MUT A;  1NKB A;  2J6S A;  5H2F U;  3NGD A;  1JN3 A;  5AM1 A;  5B5E U;  1Z00 A;  3G6X A;  3TFR A;  2W7O A;  2FI1 A;  2WF6 A;  5HR7 A;  8ICY A;  4XRH A;  2W8L A;  3AMZ A;  3NS1 A;  5KFH A;  3PO5 A;  3B0X A;  4I2D A;  3F53 A;  1PVP A;  3M7D A;  5KFT A;  2NRW A;  4IC9 A;  1V85 A;  2BQR A;  5AKJ A;  2KP7 A;  1NJW A;  1SKW A;  2ZJ5 A;  4QZG A;  2IOF K;  4IR9 A;  3BQT A;  2KZM A;  1LVH A;  1N60 A;  1PVQ A;  1SV4 A;  1S0N A;  4M9N A;  4MF8 A;  3KZX A;  3M9N B;  4M9G A;  3WKA A;  4YR2 A;  5CEH A;  4Y2T A;  5HHI A;  1KFT A;  5KFR A;  4KLO A;  1D8L A;  1Z3E B;  4UAZ A;  5EOZ A;  2WAQ C;  3C1Z A;  2VJ5 A;  2OM6 A;  4NM1 A;  4G3I A;  1LKY B;  2KJ5 A;  7ICI A;  5AM5 A;  4LZD A;  1JXE A;  5ALW A;  5J8Y A;  1UHU A;  4KLQ A;  3H0L B;  2FMS A;  1JUD A;  1N2X A;  3GV8 B;  4EBE A;  3PNC A;  1J2M A;  4DSK A;  9ICI A;  3PW2 A;  4C8O A;  4IQU A;  4UB8 U;  3TI0 A;  5ALK A;  4RQ6 A;  2FPK A;  4PH5 A;  2Y9U A;  1MC8 A;  2ZJA A;  2ZIU A;  3UM9 A;  3PX6 A;  7ICV A;  2ZXH A;  2IHN A;  2MU2 A;  4FS1 A;  1X9W A;  3D2S A;  3AN1 A;  3FM9 A;  5IIO A;  4J9K A;  5HR6 A;  2LYB A;  4IQV A;  2XCP A;  5DB8 A;  2RRD A;  4O0I A;  2BCS A;  3ZI4 A;  4JWM A;  5KFW A;  4PGX A;  1NJY A;  5DDM A;  5ALL A;  4ECQ A;  4DFD A;  4R8U B;  9ICL A;  5L1J A;  1AQ6 A;  3SV4 A;  3AEV A;  3D2Q A;  8ICB A;  5AI0 A;  3KKA C;  2KTQ A;  4FE3 A;  4F2R A;  2V4Q A;  1MQ3 A;  1PUZ A;  2XI9 A;  2KKV A;  4US9 A;  3IHQ B;  3EUB 2;  3JPT A;  2WF8 A;  4CE6 A;  4KLU A;  3L3F X;  3ZDA A;  2D3D A;  5AKE A;  3AQF A;  1Z1B A;  5HNK A;  4USA A;  3NAS A;  5CWR A;  2PFP A;  1TK8 A;  5DB9 A;  2NO5 A;  3CRX A;  5DLG A;  2HHS A;  2C22 A;  4IRC A;  3PSI A;  2HBJ A;  1SWW A;  2YB4 A;  1K1Q A;  3EWA A;  1RZT A;  5J0O A;  2KVC A;  2ATL A;  2AGQ A;  4RNO A;  2EQY A;  3C2M A;  3GIL A;  3TAD C;  1S9F A;  2KIV A;  5DKW A;  3JPS A;  5J0W A;  1HUO A;  1DK2 A;  5J0Q A;  1OW5 A;  4DFK A;  4TUP A;  4C8K A;  2BCU A;  1QQ6 A;  9ICN A;  4CDG A;  1DRG A;  7ICU A;  3LVV A;  1S97 A;  2F77 X;  1RYS A;  1T7P A;  3ED5 A;  9ICM A;  4M9J A;  1XC9 A;  2ZTD A;  2BR0 A;  1SKR A;  5KFU A;  3ZD8 A;  2MRL A;  2JR5 A;  3HP6 A;  3S6J A;  5C5J A;  2ZUB A;  2WF9 A;  4UB6 U;  2PI4 A;  2K4H A;  2XO7 A;  3H40 A;  4YP3 A;  4I2A A;  1Y88 A;  4RQ4 A;  3OTQ A;  8ICE A;  2QLT A;  4EEK A;  3PMN A;  1L3V A;  2W55 A;  4ED1 A;  7ICR A;  4K4I A;  3C5G A;  1UPH A;  4QIW F;  4QZ9 A;  7ICK A;  2NRV A;  2CPR A;  4PJ0 U;  9ICK A;  2AH5 A;  5KFJ A;  1ZQC A;  3PSF A;  2HVI A;  1ZQB A;  4R66 A;  4DFM A;  2Q0Z X;  2HHT A;  8ICO A;  4XA5 A;  4O3R A;  4A8E A;  5KG0 A;  4UAR A;  1NJX A;  4BX9 C;  5KT3 A;  2ZUC A;  4ECT A;  3DDH A;  2JEG A;  7ICO A;  9ICR A;  1X40 A;  2HVH A;  5CB1 A;  3ISB A;  3TAD A;  1L7O A;  4C8M A;  4RPX A;  3MFH A;  5KG1 A;  4UW9 A;  1YZ7 A;  4M9L A;  4B9U A;  1ZQL A;  5KT6 A;  5KL1 B;  4UB2 A;  4CCH A;  5J0R A;  4MEX A;  3ZDB A;  4M6W A;  1NK7 A;  2WF5 A;  5KG6 A;  2YMP A;  3UXP A;  3K75 D;  4UAY A;  2W9C A;  2GO7 A;  8ICA A;  5DQI A;  5KFP A;  1N63 A;  2OWO A;  1Z4O A;  4YVZ A;  3F5E A;  3QUB A;  4LJX A;  3H7I A;  4KLM A;  5KFZ A;  8ICM A;  2DF4 B;  4GIB A;  8ICL A;  3WKC A;  2DL0 A;  4C4T A;  2W11 A;  2KEY A;  4MEY A;  1X42 A;  3UPQ A;  4Y2P A;  5L1M A;  2D6F C;  1CUK A;  3BZK A;  1NK8 A;  3N7R C;  2E3T A;  1OXJ A;  2W3R A;  5BOM A;  1JX4 A;  5AI4 A;  4Y2Q A;  4DQR A;  3Q8K A;  2EZZ A;  8ICC A;  4ECW A;  1X6J A;  2Y1I A;  1IIP A;  4DSF A;  3RJH A;  5J2J A;  4RQ8 A;  3MGH A;  7ICG A;  3RF9 A;  1YT3 A;  3M6K A;  4CF3 A;  1LB2 B;  3G6V A;  2KSO B;  5G5G A;  3KHL A;  3KZI U;  3N7P D;  1WCL A;  1T4G A;  1ZQQ A;  2KNJ A;  4P4O A;  4B6J A;  4J03 A;  5KFA A;  1ZQV A;  1PK1 B;  1ZQI A;  3H8S A;  4ED7 A;  2DKZ A;  4ED0 A;  1PK3 A;  2CXY A;  4YD2 A;  3GIK A;  4KLI A;  1L3T A;  4CF5 A;  9ICV A;  5ALH A;  4I2I A;  2F44 A;  5AM0 A;  2EZX A;  3NUQ A;  5ALY A;  1JAL A;  1L7M A;  4ECX A;  2A1A A;  4P0P B;  3Q8S B;  2A19 A;  5AKH A;  3KHG A;  4LZG A;  3D6J A;  2QAR A;  4J9M A;  3OGU A;  4NV0 A;  3ISC A;  4C4S A;  5KG4 A;  1X9X A;  4QWB A;  5KFC A;  5KT5 A;  3KTQ A;  3WKD A;  3SZ2 A;  3H0M B;  3TAR A;  3KHH A;  3F2D A;  8ICF A;  4I2C A;  8ICQ A;  1ZQA A;  1WUD A;  1U48 A;  2LMR A;  9ICB A;  2F2A B;  1U9L A;  1BNO A;  1XWL A;  2HOF A;  5IIM A;  1TAQ A;  2K4E A;  4QIW C;  5AK3 A;  4XUS A;  3QU4 A;  2YY6 A;  4ELV A;  2OH2 A;  3RJK A;  2W04 A;  1ZET A;  2QB0 A;  2FLP A;  5F9L A;  5ALD A;  4QWC A;  4RQ3 A;  1N62 A;  2OYY A;  2D8C A;  3HWT A;  4JMU A;  2KVS A;  4F5N A;  1Q3U A;  9ICC A;  5HP4 A;  4DSL A;  4YFK A;  1K5O A;  3E0F A;  4ELT A;  4B9M A;  3UXO A;  2I9G A;  2FMP A;  1TFR A;  2XGQ A;  1SXD A;  2G07 A;  4G9B A;  3SEN A;  2B6G A;  2JZB A;  3PO4 A;  4DFJ A;  1NNL A;  3TAP A;  2ES6 A;  4C4R A;  5AI5 A;  3E58 A;  9ICO A;  1SV0 C;  2H3Q A;  3K4G A;  4O3M A;  1BNP A;  2HOI A;  3PR4 A;  4EBC A;  5ALR A;  4EYI B;  1V38 A;  4KTQ A;  9ICJ A;  2FPM A;  3H0R B;  3PW0 A;  1ECW A;  4OCZ A;  3LYS A;  4F4K A;  4P2H A;  3C23 A;  2HHW A;  4QZB A;  5KFY A;  2FLL A;  3DEE A;  3V6J A;  4KLT A;  2YTU A;  4Z6F A;  2K4I A;  1S8O A;  2XIC A;  5J0P A;  1ZQM A;  1WG8 A;  1KSP A;  4QWA A;  3TAN A;  2WB1 F;  3NVY A;  1SKS A;  3IRU A;  4DCC A;  1D8Y A;  3F2B A;  4PL2 A;  4IQT A;  5J8Y C;  4CRX A;  2K4P A;  3WK7 A;  1BPB A;  5D46 A;  5J2F A;  3UQ2 A;  3C1Y A;  1L7P A;  2GH1 A;  1UA1 A;  2QKQ A;  3MR6 A;  2KHV A;  4JV1 A;  3KBB A;  3EYZ A;  2F1H A;  2ZTE A;  2E8N A;  1NK5 A;  4FBU A;  4PHP A;  4RPY A;  2ZIV A;  2DQN B;  3QE9 Y;  1A6S A;  4JK1 A;  1O03 A;  2F76 X;  3OSP A;  4BXO A;  1BGX T;  4C0Z A;  3LWM A;  4YXJ A;  4J9Q A;  5AIC A;  4YN4 A;  1VLB A;  1QSY A;  2VJ4 A;  1SV0 A;  2IOF A;  1KLN A;  8ICI A;  3IP4 B;  4Y2V A;  2ZIW A;  3OPX A;  5DQG A;  2ESE A;  5KAF U;  1DGS A;  1RXW A;  4BDP A;  3SEI A;  3UMB A;  3R9K A;  5ALS A;  1ZQX A;  3RJG A;  5ALT A;  3N4M B;  5DGB A;  4WJ3 B;  2YML A;  5AK6 A;  7ICJ A;  1ZQE A;  2PKE A;  2RQ5 A;  5J2H A;  3SR6 A;  2PMZ F;  5A0L A;  4BGD A;  1WWV A;  2UVV A;  4QZD A;  4O5K A;  2BKE A;  8ICW A;  1L3U A;  2ISP A;  5J2K A;  5DB7 A;  1BPX A;  4DL4 A;  1WYG A;  1SB3 C;  2LM1 A;  5J2B A;  2LKY A;  1RQL A;  2I6X A;  5AK4 A;  4F71 A;  2BCR A;  5DQH A;  4HAI A;  4DS5 A;  2JEI A;  4NJ8 A;  3PV8 A;  4KLE A;  1GO3 F;  4Y2R A;  5TZV A;  1N61 A;  3QUC A;  2KD1 A;  1S76 D;  1BPE A;  5DB6 A;  4UB3 A;  3G6Y A; 
#chains in the Genus database with same CATH homology
 2OYY A;  3PSF A;  1Q3V A;  2A3V A;  4JMU A;  5CRX A;  2KNJ A;  1D8B A;  4KMO B;  2M0N A;  1L6N A;  2W7P A;  4C0Z A;  2DGZ A;  3M6Z A;  1PVQ A;  1Q3U A;  3PST A;  3L3F X;  2LBO A;  3MGV A;  2CRX A;  2HOQ A;  2ZIX B;  3KZX A;  3E0F A;  2K8B B;  3AQF A;  3GU3 A;  2ZIV B;  3ONN A;  4U7C A;  4A8E A;  3C28 A;  2JMG A;  1Z1B A;  1CRX A;  3HKZ F;  4ICA A;  2CN1 A;  4FZM A;  3IG5 A;  2NV3 A;  2VJ4 A;  3SAG A;  4QNL A;  2G06 A;  1HEK A;  4BX9 C;  3CRX A;  2G07 A;  2F8L A;  3IP4 B;  4FZL A;  2ZIW A;  2WAQ C;  3OPX A;  3NRW A;  2VJ5 A;  2OM6 A;  3PZP A;  2RHF A;  4OJO A;  4QJF B;  2G5I B;  2XVT A;  3CYM A;  2KJ5 A;  2ZG6 A;  3PSI A;  3HKZ C;  2HBJ A;  3NUQ A;  4NLC A;  4AYB C;  2Q4T A;  2Y0S F;  3AL0 B;  2YB4 A;  3CP8 A;  4OJL A;  3SAF A;  1T94 A;  4P0P B;  4BJQ A;  5KL1 B;  1Z19 A;  2BDU A;  2H3Q A;  2WAQ F;  4KX3 A;  2RP5 A;  4O3M A;  1TAM A;  2KVC A;  2JH7 A;  3H0L B;  2HOI A;  4AYB F;  4GFJ A;  2MA1 A;  3SMV A;  1F44 A;  4WJ3 B;  2Y0S C;  2LYA A;  1HIW A;  2H3Z A;  2ZXI A;  4NV0 A;  4P0Q A;  2VIX A;  1ED1 A;  3H0R B;  1XNS A;  4OO1 J;  4CGZ A;  4KX5 A;  1ECW A;  2JGA A;  2G5H B;  3F5E A;  2G08 A;  2K8A A;  3LYS A;  4OJ5 A;  2ZIU A;  3PSP A;  2K89 A;  3VCB A;  2PMZ F;  2HMX A;  2OXO A;  2KOB A;  3AQE A;  2WB1 C;  5A0L A;  3IN5 A;  3H0M B;  2DF4 B;  2N1R A;  1XO0 A;  4CDG A;  3DEE A;  1DRG A;  2YB1 A;  3LVV A;  2H3F A;  2JHD A;  3C29 A;  1URJ A;  2ZXH A;  3F2D A;  1P7D A;  2F77 X;  1PVR A;  2E1E A;  2LHT A;  2G0A A;  2ZIW B;  3N7S C;  2K4I A;  2H3V A;  1ZQ1 C;  3O0F A;  4ACO A;  4OJP A;  1WUD A;  3GZF A;  3T79 A;  3D2S A;  2XIC A;  3F2C A;  4U6P A;  3K1Z A;  2E5S A;  2KJ8 A;  2ZIX A;  5KL8 B;  5T14 A;  2PMZ C;  1NZB A;  3LVW A;  3ICX A;  2WB1 F;  2XID A;  2KEY A;  5HR6 A;  2G09 A;  2MRL A;  2F2A B;  2LYB A;  3IG8 A;  2KV2 A;  2LKY A;  2VKQ A;  2RRD A;  2D6F C;  3F2B A;  4PL2 A;  3N7R C;  1MA7 A;  2YX8 A;  1A0P A;  2HBK A;  2K4H A;  2HOF A;  3RFA A;  4CRX A;  2KJ9 A;  4NWI A;  2KHQ A;  2W03 A;  2W7O A;  2H3I A;  2KKP A;  2Z7J A;  5HR7 A;  2K4E A;  3ALR A;  4OJ6 A;  4QIW C;  3D2N A;  1GO3 F;  2KIC A;  4PL1 A;  3VC8 A;  4NLB A;  2GH1 A;  4P0Q B;  4BUG A;  2R18 A;  3SQI A;  1IIP A;  2KHV A;  1OUQ A;  4P0P A;  3D2Q A;  2HBL A;  2OH2 A;  3F53 A;  2W04 A;  3F5A A;  4FE3 A;  1PVP A;  2ZIU B;  5C0Y A;  2HBM A;  2KIW A;  3M7D A;  2KD1 A;  3RF9 A;  1UPH A;  4IC9 A;  4QIW F;  1YT3 A;  2ZIV A;  1SZH A;  2DQN B;  2K8C B;  3M6K A;  2GOL A;  3KFU F;  2XI9 A;  2CPR A;  2KKV A;  1A6S A;  3N7P D;  4FZN A;  2E1F A;  2F76 X;  3SAH A;  1KBU A;  2JH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...