2LYBA

Structure of hiv-1 myr(-) matrix protein in complex with 1,2-dioctanoyl-sn-phosphatidyl-l-serine
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein p17
publication title Trio engagement via plasma membrane phospholipids and the myristoyl moiety governs HIV-1 matrix binding to bilayers.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 35
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2lybA01
2N1RA 2H3ZA 2NV3A 2JMGA 4IC9A 2K4IA 1TAMA 1ED1A 1UPHA 1HIWA 2LYBA 2H3IA 4ICAA 2LYAA 2K4EA 1A6SA 1ECWA 2H3FA 2H3VA 4JMUA 2GOLA 2HMXA 2H3QA 1HEKA 1L6NA 2K4HA
chains in the Genus database with same CATH superfamily
3QU5A 1RM6C 1ZQGA 1MSWD 2P6RA 1BNPA 4YG2A 1Z00B 2QB0B 4M6WA 5DDYA 5J0RA 3KHHA 5CRXA 2K4PA 2IHNA 4ECTA 3G6XA 9ICEA 4QZGA 1ZD5A 5DGAA 8ICTA 3Q8QB 4PL2A 3NUQA 1UA1A 3Q8RB 3JPPA 5HR7A 4G9BA 4XQ8A 1XWLA 4B9SA 3SAGA 4O0IA 2DWQA 3EPIA 3V7JA 3CNHA 4ED6A 1IM4A 2W7OA 4RQ6A 3PVXA 1M6YA 4UB3A 1Z19A 5KFSA 1A77A 3I28A 4USAA 2RDIA 1HJPA 4BWMA 1UT5A 4QIWC 3AQFA 4HAIA 1PK1A 2JGAA 5J0WA 4P2HA 3D2NA 3H7IA 4GC7A 1PK3A 2PFOA 1DK2A 3L3FX 5AM0A 5AI9A 4KLSA 4KN7A 5CR0A 2L5YA 2W9MA 5KFHA 2G07A 3C23A 2NRVA 5AKGA 1V97A 4O3MA 1TE2A 2A1JA 4UQGA 4BX9C 1KFTA 1ZQ1C 4BWJA 3Q8LA 2Y1JA 5ALQA 3GILA 2R8JA 2BCRA 9ICMA 1LVHA 5ALWA 4Z6DA 4F8RA 4UARA 2XO7A 3AL0B 3ISCA 1YZ7A 5KFYA 4DSJA 1BPZA 1Z00A 1PUZA 3C2LA 2ZUCA 2KHVA 4ED8A 3HWTA 1UCVA 4Q43A 4M9GA 4M9JA 2FJ6A 5CEHA 3RJEA 3IG5A 2MRLA 2ODGA 3AMZA 1XSNA 3QU4A 3I76A 4RQ3A 1A6SA 5KNIA 1ZQPA 3K4GA 4RQ7A 4P4PA 3M7DA 4GIBA 1S77D 2EQYA 4ED7A 3JPRA 4UB5A 4EBCA 4M9NA 4U7CA 2K89A 8ICVA 4ECUA 3RTVA 3ONNA 2M9NA 3HRDD 4NLGA 5BPCA 2KD1A 2XY7A 4JV2A 4I2CA 2ZJ8A 4TUSA 3HILA 4AP9A 3H8MA 4IQVA 4EZ6A 3H0LB 5J0OA 2F3NA 2WFAA 2BHNA 2ZIXA 2FPKA 4IL6U 4UB6U 4J9LA 9ICPA 1JI7A 4ED1A 1SKRA 3IRUA 1SL1A 3RBEA 4I2JA 1KN5A 4OJ6A 3N7PD 1CUKA 2I9GA 5H2FU 4DCCA 4PGXA 4CGZA 2C28A 8ICXA 3TAQA 4RPXA 4YN4A 3ZD9A 1AROP 3ED5A 3BZKA 5ALYA 3UPQA 1FEZA 5DLGA 5KT3A 3T5HA 1L8OA 1L7PA 2QKQA 3LVVA 1JX4A 4LZGA 7ICNA 4FZNA 4OJLA 1ED1A 3TI0A 3KZXA 5KL1B 8ICIA 4JK1A 2KV2A 2VJ5A 4DL2A 1S9FA 3LK9A 5KFEA 2PI4A 5DQIA 2Q4TA 7ICLA 4Z6CA 3RR7A 5KFPA 4Y2RA 3H0MB 5DBBA 3F5AA 8ICBA 1B43A 3BS5B 1DOQA 4M04A 1ZD2P 4QZCA 5L1LA 2HW3A 3R9KA 5AK4A 1XS9D 4PPXA 4OJOA 1KFSA 5AKZA 3RJJA 2H3VA 1S0NA 3OJUA 5J2DA 2AGPA 2C2DA 7ICIA 5J2CA 3MR2A 5ALXA 2KMDA 2MAXA 2ZTEA 4R63A 4NLCA 2ES6A 3C29A 4C7YA 1U45A 3FDSA 4LJXA 4PL1A 4FFDA 3SYZA 3E2EA 4MF8A 4UBCA 2BQUA 3OTQA 5AM2A 3EPGA 4I2DA 1WCLA 3OSNA 3OPXA 3GDXA 2RLTA 2MA1A 1KQQA 1JRPA 1OW5A 5KAIU 2ZIUB 5ALRA 1NK9A 2K8AA 2N1RA 2DPJA 2QB1A 1WYGA 4ED3A 5AICA 4NL9C 5ALDA 1BPYA 3IM1A 1AQ6A 1XO1A 3QNMA 3MDAA 2WF5A 1DRGA 2W3RA 3T79A 4BDPA 1QQ6A 4QZAA 1U4BA 3CW2C 4K4GA 4OO1J 1FO4A 3RH6A 2KG5A 1L7NA 1PVPA 2JRZA 2KOBA 3QEAZ 2IA6A 1T4GA 2VA8A 3THVA 1JXEA 3M8RA 1N48A 3RR8A 2G08A 4GFJA 2KP7A 3GV7B 1LKYB 4IR9A 3PSFA 1V9PA 5DQHA 2ISOA 2FLLA 3IN5A 2KJ8A 2D6FC 5F3XB 2A1AA 4UAUA 4EENA 5J2JA 3ZDBA 3MR3A 4J9RA 3SAFA 3V6HA 1PVRA 3S6JA 1COOA 5G5HA 4PH5A 1SXDA 2KEYA 4YR2A 2V9WA 1TAMA 2KVSA 3GZFA 1SV0A 5KG5A 8ICUA 2MSNA 5AM1A 1SV4A 3RJGA 9ICUA 5J2EA 1S97A 5IIJA 4QJFB 2HDOA 1PZNA 4PJ0U 1QSLA 4DSEA 4RNOA 3K1RB 3H4DA 2KHQA 4GXIA 5ALEA 5AM5A 5IILA 4YQWA 5KFTA 3RJKA 5B66U 2BCQA 4YD1A 2QARA 2KIVA 3WKEA 3B9JA 4UB2A 4IRCA 2ZIUA 1IXRA 3HP6A 1NI3A 2VA2A 3PSTA 2W43A 3NVWA 5ALZA 4CDGA 3NVZA 4KTQA 1Z1BA 1TKDA 1BPEA 5KG6A 2EAPA 3GV8B 1RQLA 1NJZA 4C7ZA 4C8NA 2XICA 1L3VA 5KFRA 4RQ0A 3PR5B 3OHBA 2KK0A 1QQ5A 7ICKA 1BGXT 4Z6FA 4F4XA 4DSLA 1SV0C 4KLQA 5CWRA 4YMNA 2NYVA 5BOLA 9ICHA 2F1IA 3V7LA 1UHUA 4O5CA 4QW9A 3BDPA 4NWIA 3N4MB 2C22A 5ALVA 5AM3A 1RPLA 2KIWA 9ICIA 3QU9A 3GIKA 2YY6A 4Q8FA 1XU4A 3N7SC 3OSPA 4NV0A 3F2BA 3FAHA 2RRDA 1ZQNA 8ICQA 4M2YA 5L9XA 2JEIA 4WJ3B 2B21A 4PZOA 5HHHA 4Y2JA 4F3OA 4JV1A 2P35A 2KSOB 2E5SA 3ETRA 4YMOA 5HP4A 4MEXA 1WUDA 1ZQDA 1ZQZA 1NZPA 1WWVA 4QW8A 4YFKA 4ECXA 3QX7A 4KLFA 3JPSA 2ZJ5A 3KTQA 1JMSA 4QWDA 3V6KA 4FBUA 5AI5A 3EZ5A 1N60A 9ICWA 4J03A 2LKYA 5KT2A 3IV6A 2JH7A 9ICVA 3CRXA 3WKAA 4XA5A 3ZDCA 2JH1A 2YMLA 4ECRA 4J9QA 4QNLA 2DKZA 2JV3A 1NK0A 5JTIA 3NTUA 3UQ2A 4XUSA 2ASDA 5AI8A 2ZIVB 4EBEA 2G5IB 2E8NA 2H5XA 1ZQXA 5KFXA 4CF5A 3Q8MA 3BS7A 5DB7A 1L7MA 4GXKA 5HHIA 1ZD4A 2WF9A 3MR6A 4KLDA 2IMWP 4Z6EA 1X9XA 4KX3A 4KITB 2C2RA 8ICAA 5DDMA 4YR0A 4UW9A 3MBYA 2F1JA 2KICA 3K75D 4CCHA 5J2GA 1IV8A 4JWNA 4PGYA 4HYKA 4C8KA 1ZQAA 3NRWA 3KZIU 2WTFA 9ICRA 1RG6A 1SWWA 1X66A 2RHFA 4UAWA 2XVTA 4NJ8A 2W9BA 3LWLA 1KKXA 4UAZA 5J2HA 2UVVA 1IG6A 3QUCA 4XRHA 5J0YA 5AI4A 1N5XA 4ECWA 5AM4A 9ICFA 5DGBA 2E1FA 3UXOA 2KSOA 2BDPA 1TK8A 1ZRNA 5JRTA 5AHXA 2ASLA 2GLEA 5AIBA 4OCZA 2BGWA 1L5UA 4M47A 2LYBA 4QZFA 4NM1A 2KZMA 2KJ9A 2MUTB 2BPFA 1X9SA 1B22A 2JEGA 1XO0A 2CXYA 1SXEA 3V6JA 3PV8A 1B0XA 2UVWA 4IR1A 5D49A 5G5GA 2BCUA 3L4PA 8ICWA 4RQMA 1B4FA 1RYSA 3BQTA 3I1YA 1BPXA 2HBMA 2HOFA 4Y2SA 2GOLA 2H3QA 5ALJA 5J2KA 1LV5A 3KFUF 4LZDA 1ZQQA 4EEKA 2KKVA 4PGQA 3AN1A 3MFHA 4Y2PA 1NKCA 1NK7A 2M0NA 1ZYQA 4DQRA 3SAHA 3Q8PB 4P4MA 4DFMA 4KLLA 4O3PA 4IRDA 2D3DA 2GWSA 4Q44A 3TAPA 3MC1A 3GV5B 4J9OA 4QZBA 3EWAA 1F44A 2XCAA 5ALFA 4I2AA 3UQ0A 5D4BA 5KFAA 4ECSA 2PKEA 4RU9A 2DQNB 4RQ1A 3F2CA 2QB0A 4RZRA 5CP2A 3L5KA 3ETLA 2R18A 4O9MA 2FPMA 3PZPA 5AI6A 3M9OB 3RAXA 1DGJA 1QTMA 1ZQIA 1Q46A 1ZJMA 2F44A 1JROA 2H3ZA 3PW4A 2W9AA 3T5JA 5AKKA 2EAMA 1ZOLA 5DBCA 5TZVA 4KX5A 2FMQA 2MUTA 7ICPA 3PMNA 4JMUA 5EE0A 4JUZA 5ALMA 5KFWA 1HUOA 2LM4A 2HHXA 3WU2U 1WWUA 4C0ZA 1N61A 8ICPA 3QUTA 8ICJA 4QWCA 2FI1A 4A8EA 3D2QA 3SZ2A 1NK6A 3RAQA 2OEHA 4DLEA 3N7RC 3KKAC 3KHRA 3V7KA 3IG8A 4QWAA 2XGQA 4F4WA 1QCKA 4QZ8A 2CPRA 1YZ6A 3CYMA 3SMVA 3QZ8A 1Z1VA 5KG7A 2LI6A 5KT6A 4DSKA 2OCEA 4B9LA 4DOBA 4Y2YA 1S0MA 9ICCA 2VKQA 1J2MA 1SGGA 3NASA 3PX0A 4DSIA 3RRHA 4FS2A 1K5OA 1DXSA 1QSSA 4NL9A 1S8OA 4O3RA 4OJ5A 3RB0A 3WK5A 3H8JA 5IIOA 4C8OA 1UPHA 4EEYA 5AKHA 3F5EA 4PZNA 3PY8A 4RPYA 3NS1A 4QZHA 2HMXA 2WF8A 2YMPA 5CB1A 4DFKA 8ICZA 4C8MA 3H40A 2HSZA 2I6XA 1DK3A 2DFLA 2FDRA 5KFGA 4KLGA 4Y2QA 3SENA 1HIWA 4ELTA 8ICEA 1L3UA 2LYAA 3HJEA 4FZLA 3C2KA 3C1ZA 2K4EA 3GIMA 5FP0A 3KHLA 2W8LA 3FM9A 3BZCA 3C2MA 1T8EA 9ICJA 2UVRA 1O08A 4DL6A 2PMZF 2AGOA 2K8BB 4B9UA 3H8WA 1BNOA 3AQEA 1K1SA 2H3IA 3DEEA 1C20A 4DOCA 2AQ4A 3NGDA 9ICLA 1JALA 1VLBA 5EE1A 3RF9A 1LB2B 2AGQA 4Q45A 4PHEA 4YXMA 1KDHA 2Y0SF 4ELVA 4JB3A 2AHOB 5KFJA 5C5JA 8ICOA 9ICKA 4J9SA 4DQQA 2W9CB 3E58A 4AYBF 4TURA 3K1ZA 4CF4A 3TFRA 4TQSA 2W8KA 2JZBB 5EWGA 2NRWA 4M9HA 2WHEA 2HHWA 4MFAA 2NRZA 4F4KA 2YB1A 4ACOA 1SWVA 2OYYA 5E79U 4QZEA 2F76X 2XY6A 2DBYA 4DQPA 1S0OA 1NJYA 1RYUA 1ZQSA 1V85A 4JV0A 2FPLA 2NO4A 2O6KA 9ICOA 5J8YA 3LWMA 1IIPA 2PMZC 8ICNA 2XC9A 1SKWA 3H0RB 4F50A 2EH9A 4F5NA 4DFJA 2LYHA 4YXJA 4FE3A 1SL0A 2GH1A 4BXOB 7ICMA 5IIKA 4PHDA 4CRXA 4NLBA 2Y0SC 2KZ3A 4DSFA 5DBAA 1QSYA 3BS5A 3QEBZ 2IOFA 4KMUA 2DL0A 4F2RA 5EE9A 2E8OA 2CN1A 4AYBC 5IIIA 4F72A 2YMMA 5AK3A 2XCPA 1RZTA 5ALSA 2JR5A 3EW9A 3RJIA 3GFKB 4I28A 2JEJA 4EBDA 3QUBA 2ZIWB 3RRGA 4J9KA 4IC9A 3T5LA 4B9TA 5EE3A 5IINA 2BPGA 3Q8SB 1X40A 1TK5A 2KNJA 4ICAA 5GTHU 2Y9UA 8ICMA 3BQ0A 5L1JA 5D46A 1FFUA 1ZQRA 2ZUDA 4UATA 4B6JA 4NLZA 5J0XA 2BQRA 4R64A 3PW7A 2PFPA 4EZ9A 5J2BA 2HHSA 3M1YA 4B9NA 4DLGA 4CF3A 5J8YC 3U26A 5EWEA 1CEZA 3WK4A 2Y1IA 5J0QA 1ZQJA 5KFMA 1RXVA 1SL2A 3HW8A 1HEKA 2P6UA 1Q8KA 1F5SA 4YVZA 2W55A 1XC9A 2I5HA 2C2EA 5EWFA 3UXPA 4FZMA 2BCVA 5KFQA 1N2XA 2KN7A 2LBOA 1LKYA 2BR0A 4I27A 2HVHA 2YMQA 3SV3A 4C4TA 4MEYA 1UA0A 1X42A 4KLOA 5KFKA 1O03A 3NVYA 4F71A 1T7PA 5J2IA 2HHQA 1U49A 3PX4A 3BJYA 4PHAA 3CP8A 2FMSA 2HBLA 3WKDA 1RDFA 4G3IA 3TKAA 7ICRA 2K4IA 2EAOA 3N97B 4R66A 2HOQA 1T3NA 3H8SA 5ALNA 2FLPA 4Q8EA 1YT3A 2DGZA 1KRPA 3F53A 3NVVA 4TUPA 5J2AA 1L6NA 4UB4A 5AKXA 5KT7A 5AKIA 4DF8A 3G6VA 4Y2VA 4DQSA 3UMGA 1CI4A 2JMGA 3EUB2 3ALRA 4MFCA 5B5EU 4M6WB 3MR5A 5AKYA 2BDUA 4F4YA 2J6SA 4B9MA 4IS7A 1L3SA 1JN3A 3QXGA 5KG3A 5KFNA 5HNKA 8ICCA 2DF4B 2IOHA 1CRXA 4DOAA 9ICQA 2G5HB 1N5WA 4F2SA 9ICBA 2NRTA 3SQIA 9ICTA 3MFIA 1KW4A 1ZQMA 2A19A 1KTQA 2ESEA 3KHGA 4DL7A 5A0LA 4ELUA 1N63A 2MU2A 2ZXHA 9ICGA 5CJ7A 1X2IA 3PO5A 3OHAA 1D8YA 3AM9A 5BOMA 1ZQUA 5KFUA 5AK5A 1NNLA 1N62A 2OM6A 3PSIA 1OUQA 3E0FA 1S76D 2A1JB 4DL4A 2JHDA 1RXWA 2J6UA 4ZOHC 3M9NB 1J97A 3MGIA 2HHTA 2E8MA 2ZJAA 2KZZA 5AI0A 5KG1A 4NLKA 4ED2A 9ICAA 4UAVA 3MGVA 4P0QB 3ZD8A 4I2BA 2VJ4A 5DG9A 4F5OA 4M0AA 2AQ0A 1SKSA 1MQ3A 3JPQA 3A0BU 3M8SA 5DB8A 2RP5A 3AU6A 2PXIA 4O3OA 2EDUA 2OH2A 2AU0A 3ZDDA 2K4HA 1ZQTA 1QH9A 3RJFA 3EYZA 4C8LA 5ALOA 4F91B 1NKBA 1BVSA 3LDAA 1S0VA 1RQNA 2NO5A 4BUGA 2KFZA 3GU3A 4JWMA 7ICEA 4YR3A 3AEVA 2VANA 2LPEA 2OWOA 1KFDA 2HCFA 3T5KA 4BJQA 1ZQCA 1NOMA 2G09A 3BQ2A 1KEJA 1TV9A 4FO6A 2ISPA 2ZIVA 5F9LA 2F2AB 1MN8A 5HMMA 4DEZA 4TQRA 3J81j 3KKAA 4RQ5A 7ICUA 3B0YA 1S10A 3FYHA 5KFZA 3HPOA 2G0AA 9ICNA 5KG0A 2HBKA 3F2DA 3PNCA 2ZIXB 4MHVA 2HI0A 9ICSA 1Q3UA 1PVQA 2KKPA 8ICGA 2XGPA 4I2FA 4KLEA 5ALLA 4ZH4A 1TVAA 5ALIA 2FLNA 4E0DA 1Z4NA 3T3FA 5ALHA 2ZG6A 4F4ZA 3SR6A 4QZIA 2EZXA 4J9MA 3D6JA 4I2EA 4M9LA 4KLTA 3C28A 1ZQEA 1SIJA 1C7YA 2V4QA 1XSLA 7ICHA 1L8LA 2XY5A 4EYIB 1ZQBA 3QU2A 4F5RA 4P0QA 3UXNA 4DS5A 3M6KA 3DV9A 3V72A 5KFIA 2BKEA 4K4HA 1JXLA 4ECVA 2ZXIA 4U6PA 1X9MA 3A0HU 2AH5A 2YN4A 1U48A 3TADA 2E1EA 3HX0A 2Q0ZX 1OXJA 4Y2UA 1ZQOA 1JUDA 4C4SA 2JEFA 3HT3A 4UB1A 2I1QA 4IQUA 4O3SA 3QYPA 3RH4A 3UMCA 2BCSA 4DS4A 5AKEA 4F92B 5DKWA 1D9DA 3DDHA 4RUCA 2ZTDA 2E3TA 2CRXA 3SV4A 2RQ5A 2LHTA 1S5LU 5DG7A 2V4RA 8ICLA 1FIQA 4PHPA 2D8CA 2LM1A 3PX6A 2DUYA 4Y2XA 4P0PB 2B0CA 4KLJA 3QU7A 4YD2A 3LVWA 3VC8A 1NK4A 4MF2A 2ZUBA 4QZ9A 5TISU 5DLFA 4FBTA 3QUQA 1U47A 4C4RA 1T3QA 2FMPA 5GTIU 2XI9A 3B0XA 3OGUA 3IHQB 1X6IA 3WK9A 5DQGA 1ZQLA 2AJQA 2W7PA 7ICQA 2PI5A 4UAYA 2KJ5A 2R8GA 4QWBA 3JPOA 5KFVA 8ICKA 3WKBA 2R8KA 2DPIA 1FFVA 4NLNA 1Z4OA 3WK6A 1ZETA 3RB3A 1TAQA 2R8IA 2RDJA 1A0PA 1BPBA 9ICXA 4CNQA 5DG8A 2WF6A 2GO7A 2ASJA 5KG4A 3AU2A 1ZRMA 2NV3A 1RYRA 3AUOA 3TADC 3QZ7A 4OJPA 4CE6A 5L1KA 1X9WA 1KLNA 7ICSA 4EX6A 4KLIA 2W04A 3O0FA 4EYHB 1ZQHA 2Y9TA 5ALTA 4RNNA 2HOIA 3ZDAA 2YQEA 2E8PA 4ECQA 1QQ7A 4QZDA 3WKCA 3NRZA 2YB4A 3PW5A 2F8LA 2EANA 3RBDA 1MA7A 3Q8KA 4DFPA 2WAQF 1JIHA 4O3QA 3UMBA 3M6ZA 4F93B 1VJ5A 1NZBA 5AK6A 4I2IA 3JPTA 5JUMA 1A76A 1ZQYA 3ISDA 2BZFA 5KFLA 1L7OA 1K1QA 3C1YA 5ALPA 4P0PA 2DKXA 2VIXA 3PW0A 4O5KA 3PW2A 5K4LA 2YX8A 2QARB 5J0PA 5AKJA 5EOZA 4NM2A 2K60A 5AKLA 1EXNA 3IP4B 2LMRA 2J6TA 1MC8A 1QLNA 3PO4A 4DL3A 1NJXA 4J9PA 1WG8A 5KG2A 3ZDEA 5KL8B 5C0YA 1TK0A 2KE7A 1P7DA 3GIIA 3PSPA 1MQ2A 4YP3A 2BPCA 1SB3C 3TARA 5KTQA 5J2FA 1ZQWA 4Y2TA 4RPZA 2B6GA 1NK5A 2IBKA 1L3TA 3ISBA 2WAQC 1ZJNA 5AIAA 3KD3A 5CHGA 2AXTU 4NXZA 4GLXA 4J9NA 4DL5A 1D8LA 3SEIA 3TANA 3MGHA 1ZD3A 5J0UA 3M9MB 2KTQA 3HKZF 7ICOA 3ICXA 3RH5A 8ICHA 4KN4A 1ZQFA 8ICRA 4KLHA 4IRKA 1Z3EB 4C80A 3ORYA 3ZI4A 1NKEA 1T94A 4DWIA 2W3SA 7ICTA 5L1MA 3VCBA 2W54A 2K8CB 5J0SA 3MDCA 3C21A 1URJA 4NY8A 1ECWA 4RQ4A 4DFDA 2EZZA 4GC6A 1V38A 3WK7A 3IDWA 2HVIA 3SI8A 4R65A 3RJHA 2ZTCA 7ICFA 4B9VA 1GO3F 1SZPA 4I2HA 3G6YA 2W9CA 4UASA 3LYSA 2BQ3A 4YMMA 5HR6A 4KLMA 1SZHA 3TFSA 4RQ2A 2JZBA 3RFAA 4I29A 4US9A 4EX7A 2EZYA 2OHFA 3HKZC 2ATLA 4ECZA 5KFCA 4R8UB 3RB4A 2W11A 1TFRA 4I2GA 2Z7JA 4OD0A 8ICFA 3UM9A 5DB6A 2KVCA 5KT5A 3C5FA 4DF4A 3FC4A 1D9FA 2R8HA 3TACB 5KFDA 3C5GA 4BGDA 2VA3A 1N56A 5KFOA 4BXOA 1BPDA 1UT8A 1NK8A 4RT3A 4RUAA 2FE9A 2P66A 1COKA 4O3NA 4F5PA 4UB8U 5T14A 4FS1A 2KFNA 5JU5A 3RB6A 2HHUA 2A3VA 8ICSA 3MABA 1ZQKA 2PFNA 4YCXA 2OXOA 4ECYA 2XIDA 2ZIWA 2G06A 5ALUA 7ICGA 4RQNA 5HMLA 1XNSA 1VDVA 2W9BB 2HHVA 1Y88A 2UVUA 2WB1F 4RNMA 5KFFA 4K4IA 3D2SA 5DB9A 2F1HA 5KT4A 1J2NA 4LVSA 4QWEA 1KBUA 1U9LA 2PFQA 3JPNA 1D8BA 2IOFK 5KFBA 2ALZA 1H38A 3PR4A 2W03A 2HBJA 1ZQVA 4P4OA 3SD7A 4KLUA 1KL9A 2F77X 5J29A 4DO9A 4KMOB 4US8A 3KBBA 3H4BA 5ALKA 4X5VA 4UBBA 3GIJA 4MFFA 1KSPA 2F8KA 1X6JA 1ZXIA 2IHMA 1UQVA 4F5QA 4O5EA 1PK1B 4IQWA 4R8UA 1WCNA 5KAFU 3BQ7A 2YTUA 4RQ8A 2WB1C 5F9NA 8ICYA 4RT2A 3TQ1A 4EELA 1NJWA 4DQIA 4TUQA 1XSPA 3OJSA 4IQTA 3KOOA 3PMLA 2WF7A 5J0TA 1TAUA 4GXJA 1Q3VA 1HUZA 7ICJA 5ALGA 3QE9Y 3BQ1A 4ED0A 3WK8A 5IIMA 3N28A 7ICVA 1DGSA 2H3FA 3GQCA 2QLTA 5L1IA 1F0MA 2NRXA 2JXJA 4QIWF 5CA7A
chains in the Genus database with same CATH topology
2G5HB 2ZIVB 2XIDA 2E1EA 2KKVA 3AL0B 2G5IB 2G08A 4GFJA 2ZIWA 2G06A 3LVVA 2M0NA 1T94A 3PSFA 4AYBF 4FZNA 4OJLA 3SQIA 1ED1A 1XNSA 4BUGA 3K1ZA 3SAHA 3VCBA 3GU3A 2WB1F 3KZXA 2K8CB 5KL1B 2YB4A 5CRXA 2F8LA 2VKQA 1MA7A 2KV2A 2VJ5A 3IN5A 2KJ8A 2D6FC 1URJA 2WAQF 1ECWA 3D2SA 4KX3A 2Q4TA 2YB1A 1HEKA 4ACOA 3M6ZA 2KHVA 2CRXA 2OYYA 1NZBA 2F76X 2LHTA 4BJQA 5A0LA 3H0MB 4NWIA 4PL2A 3SAFA 3NUQA 3F5AA 1KBUA 1PVRA 2G09A 1F44A 4P0PB 2KICA 2ZXHA 2KIWA 3IG5A 2MRLA 4P0PA 1D8BA 5HR7A 1GO3F 2VIXA 2ZIVA 2KEYA 4FZMA 4OJ5A 2F2AB 1TAMA 2W03A 1IIPA 2HBJA 3NRWA 3GZFA 3LYSA 1UPHA 2RHFA 3LVWA 2PMZC 3N7SC 4NV0A 2LBOA 3VC8A 2XVTA 2F77X 3F5EA 3F2BA 5HR6A 2YX8A 3SAGA 2RRDA 2DQNB 3F2CA 3H0RB 1SZHA 4OJOA 1A6SA 3RFAA 2G0AA 2R18A 2H3VA 2HBKA 4WJ3B 4KMOB 4FE3A 3IP4B 2W7OA 2HMXA 3F2DA 3PZPA 4QJFB 2XI9A 2GH1A 2ZIXB 3M7DA 1Z19A 2OM6A 3HKZC 3PSIA 3CP8A 2E5SA 1OUQA 4CRXA 4NLBA 2E1FA 1WUDA 2HBLA 2H3ZA 2Y0SC 3E0FA 4QIWC 2W7PA 1Q3UA 2JHDA 1PVQA 2KKPA 3AQFA 2K4IA 5KL8B 4NLCA 4U7CA 2K89A 2KHQA 2KJ5A 3C29A 5C0YA 1P7DA 3ONNA 2JGAA 2Z7JA 1HIWA 2LYBA 3PSPA 2CN1A 4AYBC 2KJ9A 2HOQA 3D2NA 2LYAA 4FZLA 4PL1A 2KVCA 2KD1A 2ZG6A 1YT3A 2K4EA 2WB1C 2DGZA 3L3FX 4KX5A 1XO0A 3F53A 4JMUA 1A0PA 1L6NA 2WAQC 3OPXA 3C28A 2LKYA 3SMVA 2MA1A 3H0LB 2JH7A 2ZIUB 2ZIWB 4C0ZA 2K8AA 2N1RA 2G07A 2ZIXA 2ZIUA 3MGVA 2NV3A 3CRXA 2JMGA 1Q3VA 4IC9A 3ALRA 2PMZF 4P0QB 4A8EA 2JH1A 4O3MA 2BDUA 2K8BB 4OJPA 4P0QA 2VJ4A 4BX9C 3PSTA 3D2QA 3AQEA 4CDGA 1ZQ1C 4OJ6A 3N7PD 2H3IA 2KNJA 3DEEA 4QNLA 4ICAA 3N7RC 2RP5A 3M6KA 1DRGA 3T79A 2HBMA 1Z1BA 5T14A 2H3FA 2W04A 3O0FA 2HOFA 4OO1J 3IG8A 4CGZA 2ZXIA 3RF9A 2GOLA 2H3QA 3HKZF 3ICXA 2OH2A 2DF4B 4U6PA 1CRXA 2A3VA 1PVPA 3KFUF 2KOBA 2Y0SF 2CPRA 4QIWF 2K4HA 2HOIA 2XICA 3CYMA 2OXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1R A;  2H3Z A;  2NV3 A;  2JMG A;  4IC9 A;  2K4I A;  1TAM A;  1ED1 A;  1UPH A;  1HIW A;  2LYB A;  2H3I A;  4ICA A;  2LYA A;  2K4E A;  1A6S A;  1ECW A;  2H3F A;  2H3V A;  4JMU A;  2GOL A;  2HMX A;  2H3Q A;  1HEK A;  1L6N A;  2K4H A; 
#chains in the Genus database with same CATH topology
 3QU5 A;  1RM6 C;  1ZQG A;  1MSW D;  2P6R A;  1BNP A;  4YG2 A;  1Z00 B;  2QB0 B;  4M6W A;  5DDY A;  5J0R A;  3KHH A;  5CRX A;  2K4P A;  2IHN A;  4ECT A;  3G6X A;  9ICE A;  4QZG A;  1ZD5 A;  5DGA A;  8ICT A;  3Q8Q B;  4PL2 A;  3NUQ A;  1UA1 A;  3Q8R B;  3JPP A;  5HR7 A;  4G9B A;  4XQ8 A;  1XWL A;  4B9S A;  3SAG A;  4O0I A;  2DWQ A;  3EPI A;  3V7J A;  3CNH A;  4ED6 A;  1IM4 A;  2W7O A;  4RQ6 A;  3PVX A;  1M6Y A;  4UB3 A;  1Z19 A;  5KFS A;  1A77 A;  3I28 A;  4USA A;  2RDI A;  1HJP A;  4BWM A;  1UT5 A;  4QIW C;  3AQF A;  4HAI A;  1PK1 A;  2JGA A;  5J0W A;  4P2H A;  3D2N A;  3H7I A;  4GC7 A;  1PK3 A;  2PFO A;  1DK2 A;  3L3F X;  5AM0 A;  5AI9 A;  4KLS A;  4KN7 A;  5CR0 A;  2L5Y A;  2W9M A;  5KFH A;  2G07 A;  3C23 A;  2NRV A;  5AKG A;  1V97 A;  4O3M A;  1TE2 A;  2A1J A;  4UQG A;  4BX9 C;  1KFT A;  1ZQ1 C;  4BWJ A;  3Q8L A;  2Y1J A;  5ALQ A;  3GIL A;  2R8J A;  2BCR A;  9ICM A;  1LVH A;  5ALW A;  4Z6D A;  4F8R A;  4UAR A;  2XO7 A;  3AL0 B;  3ISC A;  1YZ7 A;  5KFY A;  4DSJ A;  1BPZ A;  1Z00 A;  1PUZ A;  3C2L A;  2ZUC A;  2KHV A;  4ED8 A;  3HWT A;  1UCV A;  4Q43 A;  4M9G A;  4M9J A;  2FJ6 A;  5CEH A;  3RJE A;  3IG5 A;  2MRL A;  2ODG A;  3AMZ A;  1XSN A;  3QU4 A;  3I76 A;  4RQ3 A;  1A6S A;  5KNI A;  1ZQP A;  3K4G A;  4RQ7 A;  4P4P A;  3M7D A;  4GIB A;  1S77 D;  2EQY A;  4ED7 A;  3JPR A;  4UB5 A;  4EBC A;  4M9N A;  4U7C A;  2K89 A;  8ICV A;  4ECU A;  3RTV A;  3ONN A;  2M9N A;  3HRD D;  4NLG A;  5BPC A;  2KD1 A;  2XY7 A;  4JV2 A;  4I2C A;  2ZJ8 A;  4TUS A;  3HIL A;  4AP9 A;  3H8M A;  4IQV A;  4EZ6 A;  3H0L B;  5J0O A;  2F3N A;  2WFA A;  2BHN A;  2ZIX A;  2FPK A;  4IL6 U;  4UB6 U;  4J9L A;  9ICP A;  1JI7 A;  4ED1 A;  1SKR A;  3IRU A;  1SL1 A;  3RBE A;  4I2J A;  1KN5 A;  4OJ6 A;  3N7P D;  1CUK A;  2I9G A;  5H2F U;  4DCC A;  4PGX A;  4CGZ A;  2C28 A;  8ICX A;  3TAQ A;  4RPX A;  4YN4 A;  3ZD9 A;  1ARO P;  3ED5 A;  3BZK A;  5ALY A;  3UPQ A;  1FEZ A;  5DLG A;  5KT3 A;  3T5H A;  1L8O A;  1L7P A;  2QKQ A;  3LVV A;  1JX4 A;  4LZG A;  7ICN A;  4FZN A;  4OJL A;  1ED1 A;  3TI0 A;  3KZX A;  5KL1 B;  8ICI A;  4JK1 A;  2KV2 A;  2VJ5 A;  4DL2 A;  1S9F A;  3LK9 A;  5KFE A;  2PI4 A;  5DQI A;  2Q4T A;  7ICL A;  4Z6C A;  3RR7 A;  5KFP A;  4Y2R A;  3H0M B;  5DBB A;  3F5A A;  8ICB A;  1B43 A;  3BS5 B;  1DOQ A;  4M04 A;  1ZD2 P;  4QZC A;  5L1L A;  2HW3 A;  3R9K A;  5AK4 A;  1XS9 D;  4PPX A;  4OJO A;  1KFS A;  5AKZ A;  3RJJ A;  2H3V A;  1S0N A;  3OJU A;  5J2D A;  2AGP A;  2C2D A;  7ICI A;  5J2C A;  3MR2 A;  5ALX A;  2KMD A;  2MAX A;  2ZTE A;  4R63 A;  4NLC A;  2ES6 A;  3C29 A;  4C7Y A;  1U45 A;  3FDS A;  4LJX A;  4PL1 A;  4FFD A;  3SYZ A;  3E2E A;  4MF8 A;  4UBC A;  2BQU A;  3OTQ A;  5AM2 A;  3EPG A;  4I2D A;  1WCL A;  3OSN A;  3OPX A;  3GDX A;  2RLT A;  2MA1 A;  1KQQ A;  1JRP A;  1OW5 A;  5KAI U;  2ZIU B;  5ALR A;  1NK9 A;  2K8A A;  2N1R A;  2DPJ A;  2QB1 A;  1WYG A;  4ED3 A;  5AIC A;  4NL9 C;  5ALD A;  1BPY A;  3IM1 A;  1AQ6 A;  1XO1 A;  3QNM A;  3MDA A;  2WF5 A;  1DRG A;  2W3R A;  3T79 A;  4BDP A;  1QQ6 A;  4QZA A;  1U4B A;  3CW2 C;  4K4G A;  4OO1 J;  1FO4 A;  3RH6 A;  2KG5 A;  1L7N A;  1PVP A;  2JRZ A;  2KOB A;  3QEA Z;  2IA6 A;  1T4G A;  2VA8 A;  3THV A;  1JXE A;  3M8R A;  1N48 A;  3RR8 A;  2G08 A;  4GFJ A;  2KP7 A;  3GV7 B;  1LKY B;  4IR9 A;  3PSF A;  1V9P A;  5DQH A;  2ISO A;  2FLL A;  3IN5 A;  2KJ8 A;  2D6F C;  5F3X B;  2A1A A;  4UAU A;  4EEN A;  5J2J A;  3ZDB A;  3MR3 A;  4J9R A;  3SAF A;  3V6H A;  1PVR A;  3S6J A;  1COO A;  5G5H A;  4PH5 A;  1SXD A;  2KEY A;  4YR2 A;  2V9W A;  1TAM A;  2KVS A;  3GZF A;  1SV0 A;  5KG5 A;  8ICU A;  2MSN A;  5AM1 A;  1SV4 A;  3RJG A;  9ICU A;  5J2E A;  1S97 A;  5IIJ A;  4QJF B;  2HDO A;  1PZN A;  4PJ0 U;  1QSL A;  4DSE A;  4RNO A;  3K1R B;  3H4D A;  2KHQ A;  4GXI A;  5ALE A;  5AM5 A;  5IIL A;  4YQW A;  5KFT A;  3RJK A;  5B66 U;  2BCQ A;  4YD1 A;  2QAR A;  2KIV A;  3WKE A;  3B9J A;  4UB2 A;  4IRC A;  2ZIU A;  1IXR A;  3HP6 A;  1NI3 A;  2VA2 A;  3PST A;  2W43 A;  3NVW A;  5ALZ A;  4CDG A;  3NVZ A;  4KTQ A;  1Z1B A;  1TKD A;  1BPE A;  5KG6 A;  2EAP A;  3GV8 B;  1RQL A;  1NJZ A;  4C7Z A;  4C8N A;  2XIC A;  1L3V A;  5KFR A;  4RQ0 A;  3PR5 B;  3OHB A;  2KK0 A;  1QQ5 A;  7ICK A;  1BGX T;  4Z6F A;  4F4X A;  4DSL A;  1SV0 C;  4KLQ A;  5CWR A;  4YMN A;  2NYV A;  5BOL A;  9ICH A;  2F1I A;  3V7L A;  1UHU A;  4O5C A;  4QW9 A;  3BDP A;  4NWI A;  3N4M B;  2C22 A;  5ALV A;  5AM3 A;  1RPL A;  2KIW A;  9ICI A;  3QU9 A;  3GIK A;  2YY6 A;  4Q8F A;  1XU4 A;  3N7S C;  3OSP A;  4NV0 A;  3F2B A;  3FAH A;  2RRD A;  1ZQN A;  8ICQ A;  4M2Y A;  5L9X A;  2JEI A;  4WJ3 B;  2B21 A;  4PZO A;  5HHH A;  4Y2J A;  4F3O A;  4JV1 A;  2P35 A;  2KSO B;  2E5S A;  3ETR A;  4YMO A;  5HP4 A;  4MEX A;  1WUD A;  1ZQD A;  1ZQZ A;  1NZP A;  1WWV A;  4QW8 A;  4YFK A;  4ECX A;  3QX7 A;  4KLF A;  3JPS A;  2ZJ5 A;  3KTQ A;  1JMS A;  4QWD A;  3V6K A;  4FBU A;  5AI5 A;  3EZ5 A;  1N60 A;  9ICW A;  4J03 A;  2LKY A;  5KT2 A;  3IV6 A;  2JH7 A;  9ICV A;  3CRX A;  3WKA A;  4XA5 A;  3ZDC A;  2JH1 A;  2YML A;  4ECR A;  4J9Q A;  4QNL A;  2DKZ A;  2JV3 A;  1NK0 A;  5JTI A;  3NTU A;  3UQ2 A;  4XUS A;  2ASD A;  5AI8 A;  2ZIV B;  4EBE A;  2G5I B;  2E8N A;  2H5X A;  1ZQX A;  5KFX A;  4CF5 A;  3Q8M A;  3BS7 A;  5DB7 A;  1L7M A;  4GXK A;  5HHI A;  1ZD4 A;  2WF9 A;  3MR6 A;  4KLD A;  2IMW P;  4Z6E A;  1X9X A;  4KX3 A;  4KIT B;  2C2R A;  8ICA A;  5DDM A;  4YR0 A;  4UW9 A;  3MBY A;  2F1J A;  2KIC A;  3K75 D;  4CCH A;  5J2G A;  1IV8 A;  4JWN A;  4PGY A;  4HYK A;  4C8K A;  1ZQA A;  3NRW A;  3KZI U;  2WTF A;  9ICR A;  1RG6 A;  1SWW A;  1X66 A;  2RHF A;  4UAW A;  2XVT A;  4NJ8 A;  2W9B A;  3LWL A;  1KKX A;  4UAZ A;  5J2H A;  2UVV A;  1IG6 A;  3QUC A;  4XRH A;  5J0Y A;  5AI4 A;  1N5X A;  4ECW A;  5AM4 A;  9ICF A;  5DGB A;  2E1F A;  3UXO A;  2KSO A;  2BDP A;  1TK8 A;  1ZRN A;  5JRT A;  5AHX A;  2ASL A;  2GLE A;  5AIB A;  4OCZ A;  2BGW A;  1L5U A;  4M47 A;  2LYB A;  4QZF A;  4NM1 A;  2KZM A;  2KJ9 A;  2MUT B;  2BPF A;  1X9S A;  1B22 A;  2JEG A;  1XO0 A;  2CXY A;  1SXE A;  3V6J A;  3PV8 A;  1B0X A;  2UVW A;  4IR1 A;  5D49 A;  5G5G A;  2BCU A;  3L4P A;  8ICW A;  4RQM A;  1B4F A;  1RYS A;  3BQT A;  3I1Y A;  1BPX A;  2HBM A;  2HOF A;  4Y2S A;  2GOL A;  2H3Q A;  5ALJ A;  5J2K A;  1LV5 A;  3KFU F;  4LZD A;  1ZQQ A;  4EEK A;  2KKV A;  4PGQ A;  3AN1 A;  3MFH A;  4Y2P A;  1NKC A;  1NK7 A;  2M0N A;  1ZYQ A;  4DQR A;  3SAH A;  3Q8P B;  4P4M A;  4DFM A;  4KLL A;  4O3P A;  4IRD A;  2D3D A;  2GWS A;  4Q44 A;  3TAP A;  3MC1 A;  3GV5 B;  4J9O A;  4QZB A;  3EWA A;  1F44 A;  2XCA A;  5ALF A;  4I2A A;  3UQ0 A;  5D4B A;  5KFA A;  4ECS A;  2PKE A;  4RU9 A;  2DQN B;  4RQ1 A;  3F2C A;  2QB0 A;  4RZR A;  5CP2 A;  3L5K A;  3ETL A;  2R18 A;  4O9M A;  2FPM A;  3PZP A;  5AI6 A;  3M9O B;  3RAX A;  1DGJ A;  1QTM A;  1ZQI A;  1Q46 A;  1ZJM A;  2F44 A;  1JRO A;  2H3Z A;  3PW4 A;  2W9A A;  3T5J A;  5AKK A;  2EAM A;  1ZOL A;  5DBC A;  5TZV A;  4KX5 A;  2FMQ A;  2MUT A;  7ICP A;  3PMN A;  4JMU A;  5EE0 A;  4JUZ A;  5ALM A;  5KFW A;  1HUO A;  2LM4 A;  2HHX A;  3WU2 U;  1WWU A;  4C0Z A;  1N61 A;  8ICP A;  3QUT A;  8ICJ A;  4QWC A;  2FI1 A;  4A8E A;  3D2Q A;  3SZ2 A;  1NK6 A;  3RAQ A;  2OEH A;  4DLE A;  3N7R C;  3KKA C;  3KHR A;  3V7K A;  3IG8 A;  4QWA A;  2XGQ A;  4F4W A;  1QCK A;  4QZ8 A;  2CPR A;  1YZ6 A;  3CYM A;  3SMV A;  3QZ8 A;  1Z1V A;  5KG7 A;  2LI6 A;  5KT6 A;  4DSK A;  2OCE A;  4B9L A;  4DOB A;  4Y2Y A;  1S0M A;  9ICC A;  2VKQ A;  1J2M A;  1SGG A;  3NAS A;  3PX0 A;  4DSI A;  3RRH A;  4FS2 A;  1K5O A;  1DXS A;  1QSS A;  4NL9 A;  1S8O A;  4O3R A;  4OJ5 A;  3RB0 A;  3WK5 A;  3H8J A;  5IIO A;  4C8O A;  1UPH A;  4EEY A;  5AKH A;  3F5E A;  4PZN A;  3PY8 A;  4RPY A;  3NS1 A;  4QZH A;  2HMX A;  2WF8 A;  2YMP A;  5CB1 A;  4DFK A;  8ICZ A;  4C8M A;  3H40 A;  2HSZ A;  2I6X A;  1DK3 A;  2DFL A;  2FDR A;  5KFG A;  4KLG A;  4Y2Q A;  3SEN A;  1HIW A;  4ELT A;  8ICE A;  1L3U A;  2LYA A;  3HJE A;  4FZL A;  3C2K A;  3C1Z A;  2K4E A;  3GIM A;  5FP0 A;  3KHL A;  2W8L A;  3FM9 A;  3BZC A;  3C2M A;  1T8E A;  9ICJ A;  2UVR A;  1O08 A;  4DL6 A;  2PMZ F;  2AGO A;  2K8B B;  4B9U A;  3H8W A;  1BNO A;  3AQE A;  1K1S A;  2H3I A;  3DEE A;  1C20 A;  4DOC A;  2AQ4 A;  3NGD A;  9ICL A;  1JAL A;  1VLB A;  5EE1 A;  3RF9 A;  1LB2 B;  2AGQ A;  4Q45 A;  4PHE A;  4YXM A;  1KDH A;  2Y0S F;  4ELV A;  4JB3 A;  2AHO B;  5KFJ A;  5C5J A;  8ICO A;  9ICK A;  4J9S A;  4DQQ A;  2W9C B;  3E58 A;  4AYB F;  4TUR A;  3K1Z A;  4CF4 A;  3TFR A;  4TQS A;  2W8K A;  2JZB B;  5EWG A;  2NRW A;  4M9H A;  2WHE A;  2HHW A;  4MFA A;  2NRZ A;  4F4K A;  2YB1 A;  4ACO A;  1SWV A;  2OYY A;  5E79 U;  4QZE A;  2F76 X;  2XY6 A;  2DBY A;  4DQP A;  1S0O A;  1NJY A;  1RYU A;  1ZQS A;  1V85 A;  4JV0 A;  2FPL A;  2NO4 A;  2O6K A;  9ICO A;  5J8Y A;  3LWM A;  1IIP A;  2PMZ C;  8ICN A;  2XC9 A;  1SKW A;  3H0R B;  4F50 A;  2EH9 A;  4F5N A;  4DFJ A;  2LYH A;  4YXJ A;  4FE3 A;  1SL0 A;  2GH1 A;  4BXO B;  7ICM A;  5IIK A;  4PHD A;  4CRX A;  4NLB A;  2Y0S C;  2KZ3 A;  4DSF A;  5DBA A;  1QSY A;  3BS5 A;  3QEB Z;  2IOF A;  4KMU A;  2DL0 A;  4F2R A;  5EE9 A;  2E8O A;  2CN1 A;  4AYB C;  5III A;  4F72 A;  2YMM A;  5AK3 A;  2XCP A;  1RZT A;  5ALS A;  2JR5 A;  3EW9 A;  3RJI A;  3GFK B;  4I28 A;  2JEJ A;  4EBD A;  3QUB A;  2ZIW B;  3RRG A;  4J9K A;  4IC9 A;  3T5L A;  4B9T A;  5EE3 A;  5IIN A;  2BPG A;  3Q8S B;  1X40 A;  1TK5 A;  2KNJ A;  4ICA A;  5GTH U;  2Y9U A;  8ICM A;  3BQ0 A;  5L1J A;  5D46 A;  1FFU A;  1ZQR A;  2ZUD A;  4UAT A;  4B6J A;  4NLZ A;  5J0X A;  2BQR A;  4R64 A;  3PW7 A;  2PFP A;  4EZ9 A;  5J2B A;  2HHS A;  3M1Y A;  4B9N A;  4DLG A;  4CF3 A;  5J8Y C;  3U26 A;  5EWE A;  1CEZ A;  3WK4 A;  2Y1I A;  5J0Q A;  1ZQJ A;  5KFM A;  1RXV A;  1SL2 A;  3HW8 A;  1HEK A;  2P6U A;  1Q8K A;  1F5S A;  4YVZ A;  2W55 A;  1XC9 A;  2I5H A;  2C2E A;  5EWF A;  3UXP A;  4FZM A;  2BCV A;  5KFQ A;  1N2X A;  2KN7 A;  2LBO A;  1LKY A;  2BR0 A;  4I27 A;  2HVH A;  2YMQ A;  3SV3 A;  4C4T A;  4MEY A;  1UA0 A;  1X42 A;  4KLO A;  5KFK A;  1O03 A;  3NVY A;  4F71 A;  1T7P A;  5J2I A;  2HHQ A;  1U49 A;  3PX4 A;  3BJY A;  4PHA A;  3CP8 A;  2FMS A;  2HBL A;  3WKD A;  1RDF A;  4G3I A;  3TKA A;  7ICR A;  2K4I A;  2EAO A;  3N97 B;  4R66 A;  2HOQ A;  1T3N A;  3H8S A;  5ALN A;  2FLP A;  4Q8E A;  1YT3 A;  2DGZ A;  1KRP A;  3F53 A;  3NVV A;  4TUP A;  5J2A A;  1L6N A;  4UB4 A;  5AKX A;  5KT7 A;  5AKI A;  4DF8 A;  3G6V A;  4Y2V A;  4DQS A;  3UMG A;  1CI4 A;  2JMG A;  3EUB 2;  3ALR A;  4MFC A;  5B5E U;  4M6W B;  3MR5 A;  5AKY A;  2BDU A;  4F4Y A;  2J6S A;  4B9M A;  4IS7 A;  1L3S A;  1JN3 A;  3QXG A;  5KG3 A;  5KFN A;  5HNK A;  8ICC A;  2DF4 B;  2IOH A;  1CRX A;  4DOA A;  9ICQ A;  2G5H B;  1N5W A;  4F2S A;  9ICB A;  2NRT A;  3SQI A;  9ICT A;  3MFI A;  1KW4 A;  1ZQM A;  2A19 A;  1KTQ A;  2ESE A;  3KHG A;  4DL7 A;  5A0L A;  4ELU A;  1N63 A;  2MU2 A;  2ZXH A;  9ICG A;  5CJ7 A;  1X2I A;  3PO5 A;  3OHA A;  1D8Y A;  3AM9 A;  5BOM A;  1ZQU A;  5KFU A;  5AK5 A;  1NNL A;  1N62 A;  2OM6 A;  3PSI A;  1OUQ A;  3E0F A;  1S76 D;  2A1J B;  4DL4 A;  2JHD A;  1RXW A;  2J6U A;  4ZOH C;  3M9N B;  1J97 A;  3MGI A;  2HHT A;  2E8M A;  2ZJA A;  2KZZ A;  5AI0 A;  5KG1 A;  4NLK A;  4ED2 A;  9ICA A;  4UAV A;  3MGV A;  4P0Q B;  3ZD8 A;  4I2B A;  2VJ4 A;  5DG9 A;  4F5O A;  4M0A A;  2AQ0 A;  1SKS A;  1MQ3 A;  3JPQ A;  3A0B U;  3M8S A;  5DB8 A;  2RP5 A;  3AU6 A;  2PXI A;  4O3O A;  2EDU A;  2OH2 A;  2AU0 A;  3ZDD A;  2K4H A;  1ZQT A;  1QH9 A;  3RJF A;  3EYZ A;  4C8L A;  5ALO A;  4F91 B;  1NKB A;  1BVS A;  3LDA A;  1S0V A;  1RQN A;  2NO5 A;  4BUG A;  2KFZ A;  3GU3 A;  4JWM A;  7ICE A;  4YR3 A;  3AEV A;  2VAN A;  2LPE A;  2OWO A;  1KFD A;  2HCF A;  3T5K A;  4BJQ A;  1ZQC A;  1NOM A;  2G09 A;  3BQ2 A;  1KEJ A;  1TV9 A;  4FO6 A;  2ISP A;  2ZIV A;  5F9L A;  2F2A B;  1MN8 A;  5HMM A;  4DEZ A;  4TQR A;  3J81 j;  3KKA A;  4RQ5 A;  7ICU A;  3B0Y A;  1S10 A;  3FYH A;  5KFZ A;  3HPO A;  2G0A A;  9ICN A;  5KG0 A;  2HBK A;  3F2D A;  3PNC A;  2ZIX B;  4MHV A;  2HI0 A;  9ICS A;  1Q3U A;  1PVQ A;  2KKP A;  8ICG A;  2XGP A;  4I2F A;  4KLE A;  5ALL A;  4ZH4 A;  1TVA A;  5ALI A;  2FLN A;  4E0D A;  1Z4N A;  3T3F A;  5ALH A;  2ZG6 A;  4F4Z A;  3SR6 A;  4QZI A;  2EZX A;  4J9M A;  3D6J A;  4I2E A;  4M9L A;  4KLT A;  3C28 A;  1ZQE A;  1SIJ A;  1C7Y A;  2V4Q A;  1XSL A;  7ICH A;  1L8L A;  2XY5 A;  4EYI B;  1ZQB A;  3QU2 A;  4F5R A;  4P0Q A;  3UXN A;  4DS5 A;  3M6K A;  3DV9 A;  3V72 A;  5KFI A;  2BKE A;  4K4H A;  1JXL A;  4ECV A;  2ZXI A;  4U6P A;  1X9M A;  3A0H U;  2AH5 A;  2YN4 A;  1U48 A;  3TAD A;  2E1E A;  3HX0 A;  2Q0Z X;  1OXJ A;  4Y2U A;  1ZQO A;  1JUD A;  4C4S A;  2JEF A;  3HT3 A;  4UB1 A;  2I1Q A;  4IQU A;  4O3S A;  3QYP A;  3RH4 A;  3UMC A;  2BCS A;  4DS4 A;  5AKE A;  4F92 B;  5DKW A;  1D9D A;  3DDH A;  4RUC A;  2ZTD A;  2E3T A;  2CRX A;  3SV4 A;  2RQ5 A;  2LHT A;  1S5L U;  5DG7 A;  2V4R A;  8ICL A;  1FIQ A;  4PHP A;  2D8C A;  2LM1 A;  3PX6 A;  2DUY A;  4Y2X A;  4P0P B;  2B0C A;  4KLJ A;  3QU7 A;  4YD2 A;  3LVW A;  3VC8 A;  1NK4 A;  4MF2 A;  2ZUB A;  4QZ9 A;  5TIS U;  5DLF A;  4FBT A;  3QUQ A;  1U47 A;  4C4R A;  1T3Q A;  2FMP A;  5GTI U;  2XI9 A;  3B0X A;  3OGU A;  3IHQ B;  1X6I A;  3WK9 A;  5DQG A;  1ZQL A;  2AJQ A;  2W7P A;  7ICQ A;  2PI5 A;  4UAY A;  2KJ5 A;  2R8G A;  4QWB A;  3JPO A;  5KFV A;  8ICK A;  3WKB A;  2R8K A;  2DPI A;  1FFV A;  4NLN A;  1Z4O A;  3WK6 A;  1ZET A;  3RB3 A;  1TAQ A;  2R8I A;  2RDJ A;  1A0P A;  1BPB A;  9ICX A;  4CNQ A;  5DG8 A;  2WF6 A;  2GO7 A;  2ASJ A;  5KG4 A;  3AU2 A;  1ZRM A;  2NV3 A;  1RYR A;  3AUO A;  3TAD C;  3QZ7 A;  4OJP A;  4CE6 A;  5L1K A;  1X9W A;  1KLN A;  7ICS A;  4EX6 A;  4KLI A;  2W04 A;  3O0F A;  4EYH B;  1ZQH A;  2Y9T A;  5ALT A;  4RNN A;  2HOI A;  3ZDA A;  2YQE A;  2E8P A;  4ECQ A;  1QQ7 A;  4QZD A;  3WKC A;  3NRZ A;  2YB4 A;  3PW5 A;  2F8L A;  2EAN A;  3RBD A;  1MA7 A;  3Q8K A;  4DFP A;  2WAQ F;  1JIH A;  4O3Q A;  3UMB A;  3M6Z A;  4F93 B;  1VJ5 A;  1NZB A;  5AK6 A;  4I2I A;  3JPT A;  5JUM A;  1A76 A;  1ZQY A;  3ISD A;  2BZF A;  5KFL A;  1L7O A;  1K1Q A;  3C1Y A;  5ALP A;  4P0P A;  2DKX A;  2VIX A;  3PW0 A;  4O5K A;  3PW2 A;  5K4L A;  2YX8 A;  2QAR B;  5J0P A;  5AKJ A;  5EOZ A;  4NM2 A;  2K60 A;  5AKL A;  1EXN A;  3IP4 B;  2LMR A;  2J6T A;  1MC8 A;  1QLN A;  3PO4 A;  4DL3 A;  1NJX A;  4J9P A;  1WG8 A;  5KG2 A;  3ZDE A;  5KL8 B;  5C0Y A;  1TK0 A;  2KE7 A;  1P7D A;  3GII A;  3PSP A;  1MQ2 A;  4YP3 A;  2BPC A;  1SB3 C;  3TAR A;  5KTQ A;  5J2F A;  1ZQW A;  4Y2T A;  4RPZ A;  2B6G A;  1NK5 A;  2IBK A;  1L3T A;  3ISB A;  2WAQ C;  1ZJN A;  5AIA A;  3KD3 A;  5CHG A;  2AXT U;  4NXZ A;  4GLX A;  4J9N A;  4DL5 A;  1D8L A;  3SEI A;  3TAN A;  3MGH A;  1ZD3 A;  5J0U A;  3M9M B;  2KTQ A;  3HKZ F;  7ICO A;  3ICX A;  3RH5 A;  8ICH A;  4KN4 A;  1ZQF A;  8ICR A;  4KLH A;  4IRK A;  1Z3E B;  4C80 A;  3ORY A;  3ZI4 A;  1NKE A;  1T94 A;  4DWI A;  2W3S A;  7ICT A;  5L1M A;  3VCB A;  2W54 A;  2K8C B;  5J0S A;  3MDC A;  3C21 A;  1URJ A;  4NY8 A;  1ECW A;  4RQ4 A;  4DFD A;  2EZZ A;  4GC6 A;  1V38 A;  3WK7 A;  3IDW A;  2HVI A;  3SI8 A;  4R65 A;  3RJH A;  2ZTC A;  7ICF A;  4B9V A;  1GO3 F;  1SZP A;  4I2H A;  3G6Y A;  2W9C A;  4UAS A;  3LYS A;  2BQ3 A;  4YMM A;  5HR6 A;  4KLM A;  1SZH A;  3TFS A;  4RQ2 A;  2JZB A;  3RFA A;  4I29 A;  4US9 A;  4EX7 A;  2EZY A;  2OHF A;  3HKZ C;  2ATL A;  4ECZ A;  5KFC A;  4R8U B;  3RB4 A;  2W11 A;  1TFR A;  4I2G A;  2Z7J A;  4OD0 A;  8ICF A;  3UM9 A;  5DB6 A;  2KVC A;  5KT5 A;  3C5F A;  4DF4 A;  3FC4 A;  1D9F A;  2R8H A;  3TAC B;  5KFD A;  3C5G A;  4BGD A;  2VA3 A;  1N56 A;  5KFO A;  4BXO A;  1BPD A;  1UT8 A;  1NK8 A;  4RT3 A;  4RUA A;  2FE9 A;  2P66 A;  1COK A;  4O3N A;  4F5P A;  4UB8 U;  5T14 A;  4FS1 A;  2KFN A;  5JU5 A;  3RB6 A;  2HHU A;  2A3V A;  8ICS A;  3MAB A;  1ZQK A;  2PFN A;  4YCX A;  2OXO A;  4ECY A;  2XID A;  2ZIW A;  2G06 A;  5ALU A;  7ICG A;  4RQN A;  5HML A;  1XNS A;  1VDV A;  2W9B B;  2HHV A;  1Y88 A;  2UVU A;  2WB1 F;  4RNM A;  5KFF A;  4K4I A;  3D2S A;  5DB9 A;  2F1H A;  5KT4 A;  1J2N A;  4LVS A;  4QWE A;  1KBU A;  1U9L A;  2PFQ A;  3JPN A;  1D8B A;  2IOF K;  5KFB A;  2ALZ A;  1H38 A;  3PR4 A;  2W03 A;  2HBJ A;  1ZQV A;  4P4O A;  3SD7 A;  4KLU A;  1KL9 A;  2F77 X;  5J29 A;  4DO9 A;  4KMO B;  4US8 A;  3KBB A;  3H4B A;  5ALK A;  4X5V A;  4UBB A;  3GIJ A;  4MFF A;  1KSP A;  2F8K A;  1X6J A;  1ZXI A;  2IHM A;  1UQV A;  4F5Q A;  4O5E A;  1PK1 B;  4IQW A;  4R8U A;  1WCN A;  5KAF U;  3BQ7 A;  2YTU A;  4RQ8 A;  2WB1 C;  5F9N A;  8ICY A;  4RT2 A;  3TQ1 A;  4EEL A;  1NJW A;  4DQI A;  4TUQ A;  1XSP A;  3OJS A;  4IQT A;  3KOO A;  3PML A;  2WF7 A;  5J0T A;  1TAU A;  4GXJ A;  1Q3V A;  1HUZ A;  7ICJ A;  5ALG A;  3QE9 Y;  3BQ1 A;  4ED0 A;  3WK8 A;  5IIM A;  3N28 A;  7ICV A;  1DGS A;  2H3F A;  3GQC A;  2QLT A;  5L1I A;  1F0M A;  2NRX A;  2JXJ A;  4QIW F;  5CA7 A; 
#chains in the Genus database with same CATH homology
 2G5H B;  2ZIV B;  2XID A;  2E1E A;  2KKV A;  3AL0 B;  2G5I B;  2G08 A;  4GFJ A;  2ZIW A;  2G06 A;  3LVV A;  2M0N A;  1T94 A;  3PSF A;  4AYB F;  4FZN A;  4OJL A;  3SQI A;  1ED1 A;  1XNS A;  4BUG A;  3K1Z A;  3SAH A;  3VCB A;  3GU3 A;  2WB1 F;  3KZX A;  2K8C B;  5KL1 B;  2YB4 A;  5CRX A;  2F8L A;  2VKQ A;  1MA7 A;  2KV2 A;  2VJ5 A;  3IN5 A;  2KJ8 A;  2D6F C;  1URJ A;  2WAQ F;  1ECW A;  3D2S A;  4KX3 A;  2Q4T A;  2YB1 A;  1HEK A;  4ACO A;  3M6Z A;  2KHV A;  2CRX A;  2OYY A;  1NZB A;  2F76 X;  2LHT A;  4BJQ A;  5A0L A;  3H0M B;  4NWI A;  4PL2 A;  3SAF A;  3NUQ A;  3F5A A;  1KBU A;  1PVR A;  2G09 A;  1F44 A;  4P0P B;  2KIC A;  2ZXH A;  2KIW A;  3IG5 A;  2MRL A;  4P0P A;  1D8B A;  5HR7 A;  1GO3 F;  2VIX A;  2ZIV A;  2KEY A;  4FZM A;  4OJ5 A;  2F2A B;  1TAM A;  2W03 A;  1IIP A;  2HBJ A;  3NRW A;  3GZF A;  3LYS A;  1UPH A;  2RHF A;  3LVW A;  2PMZ C;  3N7S C;  4NV0 A;  2LBO A;  3VC8 A;  2XVT A;  2F77 X;  3F5E A;  3F2B A;  5HR6 A;  2YX8 A;  3SAG A;  2RRD A;  2DQN B;  3F2C A;  3H0R B;  1SZH A;  4OJO A;  1A6S A;  3RFA A;  2G0A A;  2R18 A;  2H3V A;  2HBK A;  4WJ3 B;  4KMO B;  4FE3 A;  3IP4 B;  2W7O A;  2HMX A;  3F2D A;  3PZP A;  4QJF B;  2XI9 A;  2GH1 A;  2ZIX B;  3M7D A;  1Z19 A;  2OM6 A;  3HKZ C;  3PSI A;  3CP8 A;  2E5S A;  1OUQ A;  4CRX A;  4NLB A;  2E1F A;  1WUD A;  2HBL A;  2H3Z A;  2Y0S C;  3E0F A;  4QIW C;  2W7P A;  1Q3U A;  2JHD A;  1PVQ A;  2KKP A;  3AQF A;  2K4I A;  5KL8 B;  4NLC A;  4U7C A;  2K89 A;  2KHQ A;  2KJ5 A;  3C29 A;  5C0Y A;  1P7D A;  3ONN A;  2JGA A;  2Z7J A;  1HIW A;  2LYB A;  3PSP A;  2CN1 A;  4AYB C;  2KJ9 A;  2HOQ A;  3D2N A;  2LYA A;  4FZL A;  4PL1 A;  2KVC A;  2KD1 A;  2ZG6 A;  1YT3 A;  2K4E A;  2WB1 C;  2DGZ A;  3L3F X;  4KX5 A;  1XO0 A;  3F53 A;  4JMU A;  1A0P A;  1L6N A;  2WAQ C;  3OPX A;  3C28 A;  2LKY A;  3SMV A;  2MA1 A;  3H0L B;  2JH7 A;  2ZIU B;  2ZIW B;  4C0Z A;  2K8A A;  2N1R A;  2G07 A;  2ZIX A;  2ZIU A;  3MGV A;  2NV3 A;  3CRX A;  2JMG A;  1Q3V A;  4IC9 A;  3ALR A;  2PMZ F;  4P0Q B;  4A8E A;  2JH1 A;  4O3M A;  2BDU A;  2K8B B;  4OJP A;  4P0Q A;  2VJ4 A;  4BX9 C;  3PST A;  3D2Q A;  3AQE A;  4CDG A;  1ZQ1 C;  4OJ6 A;  3N7P D;  2H3I A;  2KNJ A;  3DEE A;  4QNL A;  4ICA A;  3N7R C;  2RP5 A;  3M6K A;  1DRG A;  3T79 A;  2HBM A;  1Z1B A;  5T14 A;  2H3F A;  2W04 A;  3O0F A;  2HOF A;  4OO1 J;  3IG8 A;  4CGZ A;  2ZXI A;  3RF9 A;  2GOL A;  2H3Q A;  3HKZ F;  3ICX A;  2OH2 A;  2DF4 B;  4U6P A;  1CRX A;  2A3V A;  1PVP A;  3KFU F;  2KOB A;  2Y0S F;  2CPR A;  4QIW F;  2K4H A;  2HOI A;  2XIC A;  3CYM A;  2OXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...