2LYLA

Noe-based 3d structure of the predissociated homodimer of cylr2 in equilibrium with monomer at 266k (-7 celsius degrees)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
66
structure length
66
Chain Sequence
MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cold denaturation of a protein dimer monitored at atomic resolution.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Dna binding protein
molecule keywords CylR2
total genus 20
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2lylA00
2BNOA 1PRUA 1YSEA 1BDHA 2FJRA 2IVGA 1ZZCA 2LYQA 2ICPA 4X4DA 2EBYA 4MCTA 2WIUB 1ZVVA 1PRAA 2XI8A 1X2LA 3HZIB 1S7EA 2AXVA 3CROL 2O49A 4I6TA 3BD1A 3CLCA 3RZZA 1SQ8A 2D5VA 2PUBA 2PUFA 2LYJA 3FYMA 2A6CA 1ZPQA 2OR1L 2XSDC 1ZZ7A 2IVQA 4J1XA 2B5AA 1QP7A 4O8BA 1UXDA 1JWLA 2MEZA 2HSGA 4GQMA 1NEQA 5K98B 1LLIA 4I8TA 1LMB3 1JFSA 2KPJA 3FMYA 3DNVB 3OQOA 4IWRA 2AWIA 3QF3A 4X4IA 3BDNA 3LFPA 3TRBA 2KEIA 2GRMA 1WH8A 4JCXA 2O38A 2ICTA 3ZHIA 3EUSA 4YG4A 1WETA 2XCJA 3SCFA 3B7HA 2JVLA 1RZRA 3G5GA 2IU7A 2XIUA 1XWRA 1ZZBA 1ZUGA 2LYKA 1RPEL 2GRLA 1DW9A 2CSFA 2LYPA 1AU7A 3KZ3A 3LISA 1B0NA 3QYXA 1QPZA 1PRVA 1L1MA 4Z5HA 2KZ8A 2OFYA 1HF0A 1R63A 3JXCL 1NERA 3MLFA 4PU4C 2PUDA 1RZSA 1UXCA 2PUEA 1QQBA 4FN3A 2AXUA 2PUGA 2L49A 3O9XA 1CJGA 5A7LA 2XJ3A 3KJXA 3OMTA 2KEKA 3JXBC 3H5TA 3U3WA 2LYLA 1R69A 2O4AA 4IA8A 2R63A 3D1NI 2IUOA 3F6WA 3FYAA 4PU7A 4F8DA 1ZZ8A 1POUA 1O4XA 1GT0C 2MQKA 4JQDA 4X4HA 1WH6A 4YARA 4Z59A 2R1JL 3S8QA 1OCTC 3VK0A 4X4FA 1X57A 1RZRD 1E3OC 1VPWA 4X4BA 2GZUA 3L1PA 1LCCA 1CQTA 1ADRA 2BNMA 2BNNA 2H8RA 2EF8A 3F52A 4I6RA 4J1WA 3OQNA 3IVPA 4Y42A 4Z5DA 2AXZA 1PNRA 1ZZ9A 2HINA 2LCVA 3PXPA 2JCGA 1ZZ6A 1EFAA 4IVZA 3R1FA 2KEJA 2PE5A 4MCXA 1UTXA 2IV1A 1LQCA 2LYSA 3G7DA 2BJCA 3UFDA 4PU8A 1PERL 2AUWA 3OP9A 1QP0A 1OSLA 1QQAA 1WIZA 2IVBA 1Y7YA 1DWKA 1Y9QA 4OB4A 4YBAA 1RIOA 4YG7B 2LYRA 2PIJA 1JH9A 4NDWA 1BDIA 3SCHA 1IC8A 2PUAA 3SCGA 4JCYA 2AW6A 4PU3C 2L8NA 4I6UA 4X4CA 2WUSR 4X4EA 2PUCA 3GBFA 2CROA 4Z5CA 4Z58A 1JFTA 3QWGA 4GHJA 3KXAA 3ZHMA 3ZKCA 3BS3A 4FBIA 3GN5B 3JXDL 4X4GA 1ZS4A 3F51A 3GN5A 1ZAYA 2EWTA 3OQMA 1LCDA 1QP4A 3CECA 2PPXA 3QQ6A 4YG1A
chains in the Genus database with same CATH superfamily
1YSEA 1BDHA 4ER6A 1ZVVA 3QOWA 4MCTA 2XI8A 3QFIA 3HZIB 1S7EA 3GZDC 3MEJA 1SQ8A 2PUBA 2PUFA 2OR1L 1QP7A 1JWLA 4GQMA 1DULA 1LMB3 1JFSA 3FMYA 3DNVB 3OQOA 2AWIA 4X4IA 4Q2JA 3LFPA 2KEIA 4JCXA 2ICTA 3EUSA 1WETA 2HCSA 3G5GA 2XIUA 2PXTA 1RPEL 1ZZBA 2CSFA 3LISA 3QYXA 1QPZA 4PU4C 2PUEA 1QQBA 4FN3A 2PUGA 2L49A 3KJXA 3OMTA 2LYLA 3KL4A 2IUOA 3F6WA 4WVLA 1POUA 4JQDA 3NXHA 3VWSA 4YARA 3VK0A 1X57A 4I6RA 4J1WA 2XXQA 4Y42A 2AXZA 3G0TA 1ZZ9A 2LCVA 2KEJA 3UFDA 2AUWA 1OSLA 1Y7YA 1DWKA 4YG7B 2LYRA 4NDWA 1IC8A 4X4CA 4X4EA 2CROA 3OKZA 3GUUA 3QWGA 3BS3A 4X4GA 3GN5A 4ER3A 1QP4A 4YG1A 2BNOA 2IVGA 1ZZCA 4X4DA 2AXVA 3CROL 2O49A 3FYMA 2A6CA 1ZZ7A 2B5AA 1NEQA 4I8TA 2PXFA 2KPJA 3TRBA 2GRMA 2O38A 3ZHIA 3SCFA 2JVLA 3GZCA 2IU7A 2GRLA 1AU7A 1B0NA 2JQEA 3LQXA 4Z5HA 1HF0A 1R63A 3JXCL 1RZSA 1UXCA 1HQ1A 2AXUA 3O9XA 1CJGA 2XJ3A 1QZXA 3JXBC 5DTQA 3H5TA 3TEPA 2R63A 2PXBA 4PU7A 1ZZ8A 4X4HA 4Z59A 2R1JL 1OCTC 2LLWA 1RZRD 3L1PA 2BNMA 2L1PA 2XXAA 3DM5A 3OQNA 1ZZ6A 2IV1A 3G7DA 4PU8A 5DTMA 2PXEA 3OP9A 1WIZA 4OB4A 4EZIA 1RIOA 3SCGA 2PUCA 2PXKA 4EKGA 4HRAA 4Z5CA 4Z58A 4ER0A 2J7WA 3GN5B 3F51A 1ZAYA 2EWTA 1LCDA 3SX0A 3CECA 1MFQC 2LYQA 2ICPA 2LNMA 1X2LA 4I6TA 3CLCA 3RZZA 2M4HA 2LYJA 1ZPQA 2XSDC 2IVQA 5DRYA 2XXPA 2HSGA 1LLIA 3TELA 1WH8A 4DE9A 4YG4A 2XCJA 1XWRA 1NW3A 1ZUGA 1DW9A 2LYPA 1QB2A 5DTRA 3UWPA 2HCNA 2KZ8A 2V3CC 2PUDA 3TFLA 3MLFA 3PE5A 3U3WA 2J7UA 2HFZA 4IA8A 3D1NI 4F8DA 3OWQA 1GT0C 2MQKA 3S8QA 2MXDA 1VPWA 2GZUA 1LCCA 1CQTA 2EF8A 3F52A 3A9YA 4EKIA 4ER7A 4Z5DA 3NZLA 3SR4A 2ODRD 4MCXA 5GAGi 1LQCA 2LYSA 2BJCA 3R09A 1QP0A 1QQAA 2PXLA 2IVBA 1Y9QA 4DE8A 4YBAA 2PIJA 3SCHA 2AW6A 4PU3C 2L8NA 2WUSR 1JFTA 4GHJA 3ZHMA 4FBIA 2PXQA 2PXPA 3OQMA 5A7LA 1PRUA 2FJRA 2EBYA 2WIUB 1PRAA 5DSXA 5GAHi 3BD1A 2D5VA 4J1XA 4O8BA 1UXDA 2MEZA 5K98B 2PXUA 4IWRA 3QF3A 3BDNA 2PXVA 3GZDA 2PXDA 3B7HA 1RZRA 2LYKA 3ZPXA 3KZ3A 2FFHA 1PRVA 3M9LA 1L1MA 2OFYA 1NERA 4EQZA 2KEKA 1R69A 4ER5A 2O4AA 3FYAA 1O4XA 1WH6A 3A9ZA 4X4FA 1E3OC 2VEOA 4X4BA 1ADRA 2BNNA 2YBDA 2H8RA 3IVPA 1U2ZA 1PNRA 2HINA 3PXPA 2JCGA 1EFAA 4IVZA 3R1FA 2PE5A 4EK9A 1UTXA 5JUWA 1PERL 5DRTA 3NROA 3QOXA 1JH9A 1BDIA 4JCYA 2PUAA 4I6UA 5DT2A 3GBFA 3A9XA 3KXAA 3ME5A 3ZKCA 3JXDL 1ZS4A 3NDBB 4OBMA 2LLVA 2PPXA 3QQ6A
chains in the Genus database with same CATH topology
2BNOA 1PRUA 1YSEA 1BDHA 2FJRA 2IVGA 1ZZCA 2LYQA 2ICPA 4X4DA 2EBYA 4MCTA 2WIUB 1ZVVA 1PRAA 2XI8A 1X2LA 3HZIB 1S7EA 2AXVA 3CROL 2O49A 4I6TA 3BD1A 3CLCA 3RZZA 1SQ8A 2D5VA 2PUBA 2PUFA 2LYJA 3FYMA 2A6CA 1ZPQA 2OR1L 2XSDC 1ZZ7A 2IVQA 4J1XA 2B5AA 1QP7A 4O8BA 1UXDA 1JWLA 2MEZA 2HSGA 4GQMA 1NEQA 5K98B 1LLIA 4I8TA 1LMB3 1JFSA 2KPJA 3FMYA 3DNVB 3OQOA 4IWRA 2AWIA 3QF3A 4X4IA 3BDNA 3LFPA 3TRBA 2KEIA 2GRMA 1WH8A 4JCXA 2O38A 2ICTA 3ZHIA 3EUSA 4YG4A 1WETA 2XCJA 3SCFA 3B7HA 2JVLA 1RZRA 3G5GA 2IU7A 2XIUA 1XWRA 1ZZBA 1ZUGA 2LYKA 1RPEL 2GRLA 1DW9A 2CSFA 2LYPA 1AU7A 3KZ3A 3LISA 1B0NA 3QYXA 1QPZA 1PRVA 1L1MA 4Z5HA 2KZ8A 2OFYA 1HF0A 1R63A 3JXCL 1NERA 3MLFA 4PU4C 2PUDA 1RZSA 1UXCA 2PUEA 1QQBA 4FN3A 2AXUA 2PUGA 2L49A 3O9XA 1CJGA 5A7LA 2XJ3A 3KJXA 3OMTA 2KEKA 3JXBC 3H5TA 3U3WA 2LYLA 1R69A 2O4AA 4IA8A 2R63A 3D1NI 2IUOA 3F6WA 3FYAA 4PU7A 4F8DA 1ZZ8A 1POUA 1O4XA 1GT0C 2MQKA 4JQDA 4X4HA 1WH6A 4YARA 4Z59A 2R1JL 3S8QA 1OCTC 3VK0A 4X4FA 1X57A 1RZRD 1E3OC 1VPWA 4X4BA 2GZUA 3L1PA 1LCCA 1CQTA 1ADRA 2BNMA 2BNNA 2H8RA 2EF8A 3F52A 4I6RA 4J1WA 3OQNA 3IVPA 4Y42A 4Z5DA 2AXZA 1PNRA 1ZZ9A 2HINA 2LCVA 3PXPA 2JCGA 1ZZ6A 1EFAA 4IVZA 3R1FA 2KEJA 2PE5A 4MCXA 1UTXA 2IV1A 1LQCA 2LYSA 3G7DA 2BJCA 3UFDA 4PU8A 1PERL 2AUWA 3OP9A 1QP0A 1OSLA 1QQAA 1WIZA 2IVBA 1Y7YA 1DWKA 1Y9QA 4OB4A 4YBAA 1RIOA 4YG7B 2LYRA 2PIJA 1JH9A 4NDWA 1BDIA 3SCHA 1IC8A 2PUAA 3SCGA 4JCYA 2AW6A 4PU3C 2L8NA 4I6UA 4X4CA 2WUSR 4X4EA 2PUCA 3GBFA 2CROA 4Z5CA 4Z58A 1JFTA 3QWGA 4GHJA 3KXAA 3ZHMA 3ZKCA 3BS3A 4FBIA 3GN5B 3JXDL 4X4GA 1ZS4A 3F51A 3GN5A 1ZAYA 2EWTA 3OQMA 1LCDA 1QP4A 3CECA 2PPXA 3QQ6A 4YG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BNO A;  1PRU A;  1YSE A;  1BDH A;  2FJR A;  2IVG A;  1ZZC A;  2LYQ A;  2ICP A;  4X4D A;  2EBY A;  4MCT A;  2WIU B;  1ZVV A;  1PRA A;  2XI8 A;  1X2L A;  3HZI B;  1S7E A;  2AXV A;  3CRO L;  2O49 A;  4I6T A;  3BD1 A;  3CLC A;  3RZZ A;  1SQ8 A;  2D5V A;  2PUB A;  2PUF A;  2LYJ A;  3FYM A;  2A6C A;  1ZPQ A;  2OR1 L;  2XSD C;  1ZZ7 A;  2IVQ A;  4J1X A;  2B5A A;  1QP7 A;  4O8B A;  1UXD A;  1JWL A;  2MEZ A;  2HSG A;  4GQM A;  1NEQ A;  5K98 B;  1LLI A;  4I8T A;  1LMB 3;  1JFS A;  2KPJ A;  3FMY A;  3DNV B;  3OQO A;  4IWR A;  2AWI A;  3QF3 A;  4X4I A;  3BDN A;  3LFP A;  3TRB A;  2KEI A;  2GRM A;  1WH8 A;  4JCX A;  2O38 A;  2ICT A;  3ZHI A;  3EUS A;  4YG4 A;  1WET A;  2XCJ A;  3SCF A;  3B7H A;  2JVL A;  1RZR A;  3G5G A;  2IU7 A;  2XIU A;  1XWR A;  1ZZB A;  1ZUG A;  2LYK A;  1RPE L;  2GRL A;  1DW9 A;  2CSF A;  2LYP A;  1AU7 A;  3KZ3 A;  3LIS A;  1B0N A;  3QYX A;  1QPZ A;  1PRV A;  1L1M A;  4Z5H A;  2KZ8 A;  2OFY A;  1HF0 A;  1R63 A;  3JXC L;  1NER A;  3MLF A;  4PU4 C;  2PUD A;  1RZS A;  1UXC A;  2PUE A;  1QQB A;  4FN3 A;  2AXU A;  2PUG A;  2L49 A;  3O9X A;  1CJG A;  5A7L A;  2XJ3 A;  3KJX A;  3OMT A;  2KEK A;  3JXB C;  3H5T A;  3U3W A;  2LYL A;  1R69 A;  2O4A A;  4IA8 A;  2R63 A;  3D1N I;  2IUO A;  3F6W A;  3FYA A;  4PU7 A;  4F8D A;  1ZZ8 A;  1POU A;  1O4X A;  1GT0 C;  2MQK A;  4JQD A;  4X4H A;  1WH6 A;  4YAR A;  4Z59 A;  2R1J L;  3S8Q A;  1OCT C;  3VK0 A;  4X4F A;  1X57 A;  1RZR D;  1E3O C;  1VPW A;  4X4B A;  2GZU A;  3L1P A;  1LCC A;  1CQT A;  1ADR A;  2BNM A;  2BNN A;  2H8R A;  2EF8 A;  3F52 A;  4I6R A;  4J1W A;  3OQN A;  3IVP A;  4Y42 A;  4Z5D A;  2AXZ A;  1PNR A;  1ZZ9 A;  2HIN A;  2LCV A;  3PXP A;  2JCG A;  1ZZ6 A;  1EFA A;  4IVZ A;  3R1F A;  2KEJ A;  2PE5 A;  4MCX A;  1UTX A;  2IV1 A;  1LQC A;  2LYS A;  3G7D A;  2BJC A;  3UFD A;  4PU8 A;  1PER L;  2AUW A;  3OP9 A;  1QP0 A;  1OSL A;  1QQA A;  1WIZ A;  2IVB A;  1Y7Y A;  1DWK A;  1Y9Q A;  4OB4 A;  4YBA A;  1RIO A;  4YG7 B;  2LYR A;  2PIJ A;  1JH9 A;  4NDW A;  1BDI A;  3SCH A;  1IC8 A;  2PUA A;  3SCG A;  4JCY A;  2AW6 A;  4PU3 C;  2L8N A;  4I6U A;  4X4C A;  2WUS R;  4X4E A;  2PUC A;  3GBF A;  2CRO A;  4Z5C A;  4Z58 A;  1JFT A;  3QWG A;  4GHJ A;  3KXA A;  3ZHM A;  3ZKC A;  3BS3 A;  4FBI A;  3GN5 B;  3JXD L;  4X4G A;  1ZS4 A;  3F51 A;  3GN5 A;  1ZAY A;  2EWT A;  3OQM A;  1LCD A;  1QP4 A;  3CEC A;  2PPX A;  3QQ6 A;  4YG1 A; 
#chains in the Genus database with same CATH topology
 1YSE A;  1BDH A;  4ER6 A;  1ZVV A;  3QOW A;  4MCT A;  2XI8 A;  3QFI A;  3HZI B;  1S7E A;  3GZD C;  3MEJ A;  1SQ8 A;  2PUB A;  2PUF A;  2OR1 L;  1QP7 A;  1JWL A;  4GQM A;  1DUL A;  1LMB 3;  1JFS A;  3FMY A;  3DNV B;  3OQO A;  2AWI A;  4X4I A;  4Q2J A;  3LFP A;  2KEI A;  4JCX A;  2ICT A;  3EUS A;  1WET A;  2HCS A;  3G5G A;  2XIU A;  2PXT A;  1RPE L;  1ZZB A;  2CSF A;  3LIS A;  3QYX A;  1QPZ A;  4PU4 C;  2PUE A;  1QQB A;  4FN3 A;  2PUG A;  2L49 A;  3KJX A;  3OMT A;  2LYL A;  3KL4 A;  2IUO A;  3F6W A;  4WVL A;  1POU A;  4JQD A;  3NXH A;  3VWS A;  4YAR A;  3VK0 A;  1X57 A;  4I6R A;  4J1W A;  2XXQ A;  4Y42 A;  2AXZ A;  3G0T A;  1ZZ9 A;  2LCV A;  2KEJ A;  3UFD A;  2AUW A;  1OSL A;  1Y7Y A;  1DWK A;  4YG7 B;  2LYR A;  4NDW A;  1IC8 A;  4X4C A;  4X4E A;  2CRO A;  3OKZ A;  3GUU A;  3QWG A;  3BS3 A;  4X4G A;  3GN5 A;  4ER3 A;  1QP4 A;  4YG1 A;  2BNO A;  2IVG A;  1ZZC A;  4X4D A;  2AXV A;  3CRO L;  2O49 A;  3FYM A;  2A6C A;  1ZZ7 A;  2B5A A;  1NEQ A;  4I8T A;  2PXF A;  2KPJ A;  3TRB A;  2GRM A;  2O38 A;  3ZHI A;  3SCF A;  2JVL A;  3GZC A;  2IU7 A;  2GRL A;  1AU7 A;  1B0N A;  2JQE A;  3LQX A;  4Z5H A;  1HF0 A;  1R63 A;  3JXC L;  1RZS A;  1UXC A;  1HQ1 A;  2AXU A;  3O9X A;  1CJG A;  2XJ3 A;  1QZX A;  3JXB C;  5DTQ A;  3H5T A;  3TEP A;  2R63 A;  2PXB A;  4PU7 A;  1ZZ8 A;  4X4H A;  4Z59 A;  2R1J L;  1OCT C;  2LLW A;  1RZR D;  3L1P A;  2BNM A;  2L1P A;  2XXA A;  3DM5 A;  3OQN A;  1ZZ6 A;  2IV1 A;  3G7D A;  4PU8 A;  5DTM A;  2PXE A;  3OP9 A;  1WIZ A;  4OB4 A;  4EZI A;  1RIO A;  3SCG A;  2PUC A;  2PXK A;  4EKG A;  4HRA A;  4Z5C A;  4Z58 A;  4ER0 A;  2J7W A;  3GN5 B;  3F51 A;  1ZAY A;  2EWT A;  1LCD A;  3SX0 A;  3CEC A;  1MFQ C;  2LYQ A;  2ICP A;  2LNM A;  1X2L A;  4I6T A;  3CLC A;  3RZZ A;  2M4H A;  2LYJ A;  1ZPQ A;  2XSD C;  2IVQ A;  5DRY A;  2XXP A;  2HSG A;  1LLI A;  3TEL A;  1WH8 A;  4DE9 A;  4YG4 A;  2XCJ A;  1XWR A;  1NW3 A;  1ZUG A;  1DW9 A;  2LYP A;  1QB2 A;  5DTR A;  3UWP A;  2HCN A;  2KZ8 A;  2V3C C;  2PUD A;  3TFL A;  3MLF A;  3PE5 A;  3U3W A;  2J7U A;  2HFZ A;  4IA8 A;  3D1N I;  4F8D A;  3OWQ A;  1GT0 C;  2MQK A;  3S8Q A;  2MXD A;  1VPW A;  2GZU A;  1LCC A;  1CQT A;  2EF8 A;  3F52 A;  3A9Y A;  4EKI A;  4ER7 A;  4Z5D A;  3NZL A;  3SR4 A;  2ODR D;  4MCX A;  5GAG i;  1LQC A;  2LYS A;  2BJC A;  3R09 A;  1QP0 A;  1QQA A;  2PXL A;  2IVB A;  1Y9Q A;  4DE8 A;  4YBA A;  2PIJ A;  3SCH A;  2AW6 A;  4PU3 C;  2L8N A;  2WUS R;  1JFT A;  4GHJ A;  3ZHM A;  4FBI A;  2PXQ A;  2PXP A;  3OQM A;  5A7L A;  1PRU A;  2FJR A;  2EBY A;  2WIU B;  1PRA A;  5DSX A;  5GAH i;  3BD1 A;  2D5V A;  4J1X A;  4O8B A;  1UXD A;  2MEZ A;  5K98 B;  2PXU A;  4IWR A;  3QF3 A;  3BDN A;  2PXV A;  3GZD A;  2PXD A;  3B7H A;  1RZR A;  2LYK A;  3ZPX A;  3KZ3 A;  2FFH A;  1PRV A;  3M9L A;  1L1M A;  2OFY A;  1NER A;  4EQZ A;  2KEK A;  1R69 A;  4ER5 A;  2O4A A;  3FYA A;  1O4X A;  1WH6 A;  3A9Z A;  4X4F A;  1E3O C;  2VEO A;  4X4B A;  1ADR A;  2BNN A;  2YBD A;  2H8R A;  3IVP A;  1U2Z A;  1PNR A;  2HIN A;  3PXP A;  2JCG A;  1EFA A;  4IVZ A;  3R1F A;  2PE5 A;  4EK9 A;  1UTX A;  5JUW A;  1PER L;  5DRT A;  3NRO A;  3QOX A;  1JH9 A;  1BDI A;  4JCY A;  2PUA A;  4I6U A;  5DT2 A;  3GBF A;  3A9X A;  3KXA A;  3ME5 A;  3ZKC A;  3JXD L;  1ZS4 A;  3NDB B;  4OBM A;  2LLV A;  2PPX A;  3QQ6 A; 
#chains in the Genus database with same CATH homology
 2BNO A;  1PRU A;  1YSE A;  1BDH A;  2FJR A;  2IVG A;  1ZZC A;  2LYQ A;  2ICP A;  4X4D A;  2EBY A;  4MCT A;  2WIU B;  1ZVV A;  1PRA A;  2XI8 A;  1X2L A;  3HZI B;  1S7E A;  2AXV A;  3CRO L;  2O49 A;  4I6T A;  3BD1 A;  3CLC A;  3RZZ A;  1SQ8 A;  2D5V A;  2PUB A;  2PUF A;  2LYJ A;  3FYM A;  2A6C A;  1ZPQ A;  2OR1 L;  2XSD C;  1ZZ7 A;  2IVQ A;  4J1X A;  2B5A A;  1QP7 A;  4O8B A;  1UXD A;  1JWL A;  2MEZ A;  2HSG A;  4GQM A;  1NEQ A;  5K98 B;  1LLI A;  4I8T A;  1LMB 3;  1JFS A;  2KPJ A;  3FMY A;  3DNV B;  3OQO A;  4IWR A;  2AWI A;  3QF3 A;  4X4I A;  3BDN A;  3LFP A;  3TRB A;  2KEI A;  2GRM A;  1WH8 A;  4JCX A;  2O38 A;  2ICT A;  3ZHI A;  3EUS A;  4YG4 A;  1WET A;  2XCJ A;  3SCF A;  3B7H A;  2JVL A;  1RZR A;  3G5G A;  2IU7 A;  2XIU A;  1XWR A;  1ZZB A;  1ZUG A;  2LYK A;  1RPE L;  2GRL A;  1DW9 A;  2CSF A;  2LYP A;  1AU7 A;  3KZ3 A;  3LIS A;  1B0N A;  3QYX A;  1QPZ A;  1PRV A;  1L1M A;  4Z5H A;  2KZ8 A;  2OFY A;  1HF0 A;  1R63 A;  3JXC L;  1NER A;  3MLF A;  4PU4 C;  2PUD A;  1RZS A;  1UXC A;  2PUE A;  1QQB A;  4FN3 A;  2AXU A;  2PUG A;  2L49 A;  3O9X A;  1CJG A;  5A7L A;  2XJ3 A;  3KJX A;  3OMT A;  2KEK A;  3JXB C;  3H5T A;  3U3W A;  2LYL A;  1R69 A;  2O4A A;  4IA8 A;  2R63 A;  3D1N I;  2IUO A;  3F6W A;  3FYA A;  4PU7 A;  4F8D A;  1ZZ8 A;  1POU A;  1O4X A;  1GT0 C;  2MQK A;  4JQD A;  4X4H A;  1WH6 A;  4YAR A;  4Z59 A;  2R1J L;  3S8Q A;  1OCT C;  3VK0 A;  4X4F A;  1X57 A;  1RZR D;  1E3O C;  1VPW A;  4X4B A;  2GZU A;  3L1P A;  1LCC A;  1CQT A;  1ADR A;  2BNM A;  2BNN A;  2H8R A;  2EF8 A;  3F52 A;  4I6R A;  4J1W A;  3OQN A;  3IVP A;  4Y42 A;  4Z5D A;  2AXZ A;  1PNR A;  1ZZ9 A;  2HIN A;  2LCV A;  3PXP A;  2JCG A;  1ZZ6 A;  1EFA A;  4IVZ A;  3R1F A;  2KEJ A;  2PE5 A;  4MCX A;  1UTX A;  2IV1 A;  1LQC A;  2LYS A;  3G7D A;  2BJC A;  3UFD A;  4PU8 A;  1PER L;  2AUW A;  3OP9 A;  1QP0 A;  1OSL A;  1QQA A;  1WIZ A;  2IVB A;  1Y7Y A;  1DWK A;  1Y9Q A;  4OB4 A;  4YBA A;  1RIO A;  4YG7 B;  2LYR A;  2PIJ A;  1JH9 A;  4NDW A;  1BDI A;  3SCH A;  1IC8 A;  2PUA A;  3SCG A;  4JCY A;  2AW6 A;  4PU3 C;  2L8N A;  4I6U A;  4X4C A;  2WUS R;  4X4E A;  2PUC A;  3GBF A;  2CRO A;  4Z5C A;  4Z58 A;  1JFT A;  3QWG A;  4GHJ A;  3KXA A;  3ZHM A;  3ZKC A;  3BS3 A;  4FBI A;  3GN5 B;  3JXD L;  4X4G A;  1ZS4 A;  3F51 A;  3GN5 A;  1ZAY A;  2EWT A;  3OQM A;  1LCD A;  1QP4 A;  3CEC A;  2PPX A;  3QQ6 A;  4YG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...