2LYPA

Noe-based 3d structure of the monomer of cylr2 in equilibrium with predissociated homodimer at 266k (-7 celsius degrees)
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
66
structure length
66
Chain Sequence
MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cold denaturation of a protein dimer monitored at atomic resolution.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Dna binding protein
molecule keywords CylR2
total genus 20
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2lypA00
3F6WA 3ZHIA 1WETA 2ICTA 4MCTA 2AXVA 1RZRA 1ZZ7A 1RPEL 1DWKA 3GBFA 2PUFA 3CECA 3G7DA 3JXCL 4FN3A 2GZUA 3BD1A 4X4FA 2PUDA 1O4XA 1POUA 2MQKA 2IVQA 1WIZA 3GN5B 4JCYA 4F8DA 2R63A 3TRBA 1ZUGA 3MLFA 4Y42A 2PUBA 3ZKCA 4PU8A 3JXBC 1B0NA 2BNOA 1ZZ6A 3G5GA 3QYXA 1JFTA 1PRVA 2AWIA 1QP0A 1QP4A 2A6CA 1ZAYA 1RIOA 3GN5A 2JCGA 2JVLA 3LFPA 3EUSA 4YG7B 2GRMA 1L1MA 4YG4A 1X2LA 3D1NI 1RZSA 2CSFA 4FBIA 3CLCA 1LLIA 2PUEA 1UXCA 2GRLA 2H8RA 4IVZA 4Z5DA 1PRUA 2WIUB 1ZZBA 2L8NA 4PU3C 2D5VA 1SQ8A 1ZZ8A 4Z59A 2IVGA 3F51A 4YBAA 3UFDA 2KZ8A 2IUOA 4Z5HA 3BS3A 1NERA 4I8TA 1QPZA 3L1PA 3O9XA 1IC8A 3FYAA 3KXAA 3U3WA 1CJGA 2O38A 3BDNA 4IWRA 1ZZCA 3R1FA 4YG1A 2PIJA 1PERL 1EFAA 1AU7A 1XWRA 2L49A 3QF3A 3SCFA 3ZHMA 3QQ6A 2PPXA 3SCGA 3VK0A 1OSLA 2EBYA 1BDIA 4YARA 2PE5A 2AW6A 3SCHA 4J1WA 3PXPA 1ZZ9A 1DW9A 1OCTC 2EWTA 4X4HA 2HINA 1E3OC 4I6UA 1PRAA 2B5AA 2BNNA 3QWGA 4X4BA 4O8BA 2AXZA 4X4CA 3RZZA 1R63A 1UXDA 1GT0C 3H5TA 2XCJA 2EF8A 1ZPQA 3KJXA 2HSGA 3JXDL 1ZS4A 1WH6A 4I6RA 1PNRA 2BNMA 1LCDA 4IA8A 4J1XA 1LCCA 2XIUA 1QQBA 1CQTA 2LYKA 4I6TA 2KEKA 2IV1A 3OQOA 2PUAA 4X4DA 4OB4A 2KEJA 1QQAA 2OR1L 3OP9A 4X4IA 4PU4C 2XSDC 5K98B 3OMTA 1BDHA 4JCXA 1HF0A 1WH8A 2XJ3A 2ICPA 3FMYA 2KPJA 3KZ3A 1RZRD 1JH9A 3CROL 2CROA 2OFYA 2XI8A 2KEIA 1JWLA 2IVBA 4GQMA 4GHJA 5A7LA 1VPWA 3HZIB 1QP7A 1JFSA 1R69A 2LYLA 4X4GA 1LMB3 3S8QA 4X4EA 2PUGA 2LCVA 2IU7A 4NDWA 4PU7A 2O4AA 3B7HA 3FYMA 2R1JL 1Y7YA 1X57A 2AUWA 2LYJA 2O49A 2FJRA 3OQNA 3DNVB 3IVPA 1S7EA 1Y9QA 2PUCA 2AXUA 2LYPA 4JQDA 4Z58A 4Z5CA 1ZVVA 2LYSA 1ADRA 4MCXA 1LQCA 2LYQA 2BJCA 2LYRA 3OQMA 1UTXA 2WUSR 1NEQA 3F52A 3LISA 2MEZA 1YSEA
chains in the Genus database with same CATH superfamily
3ZHIA 2ICTA 2PXLA 3G7DA 2J7WA 2IVQA 3A9XA 4F8DA 2R63A 3TRBA 2XXPA 1B0NA 2BNOA 1QP4A 1L1MA 2JVLA 3EUSA 2V3CC 3D1NI 1RZSA 1LLIA 2PUEA 1UXCA 2GRLA 1DULA 4PU3C 3F51A 3QOXA 3MEJA 2IUOA 1NERA 3L1PA 3U3WA 1CJGA 3BDNA 1PERL 3R1FA 4YG1A 3SCFA 2PPXA 3VK0A 1BDIA 1QB2A 4Q2JA 1ZZ9A 2EWTA 2HCSA 4I6UA 3QWGA 4X4BA 3RZZA 2PXTA 1UXDA 3JXDL 3KJXA 2HSGA 2IV1A 4X4DA 2KEJA 1WH8A 2KPJA 3KZ3A 1HQ1A 2PXPA 2KEIA 3KL4A 3GUUA 1QP7A 4X4EA 3UWPA 2R1JL 1Y7YA 2LYJA 3DNVB 3ZPXA 2PUCA 1S7EA 4JQDA 2LYSA 1ADRA 2XXAA 2LYQA 2BJCA 2WUSR 3LISA 3PE5A 1RZRA 2PXBA 3GBFA 2PUFA 3JXCL 3BD1A 2L1PA 2MXDA 2MQKA 4JCYA 3GN5B 4WVLA 3LQXA 3MLFA 2PUBA 3ZKCA 3A9YA 4PU8A 2PXKA 2A6CA 4ER0A 3LFPA 4YG7B 2GRMA 4YG4A 1X2LA 2H8RA 1ZZBA 4Z59A 4YBAA 3UFDA 4Z5HA 4I8TA 3O9XA 2O38A 4IWRA 1AU7A 3QF3A 5DTRA 3QQ6A 1MFQC 2EBYA 4YARA 4EKGA 3PXPA 1DW9A 1OCTC 2HINA 2BNNA 4X4CA 3TFLA 4ER3A 1PNRA 4I6RA 2BNMA 4IA8A 1QQBA 2XIUA 2HCNA 2PUAA 4X4IA 4PU4C 4JCXA 2XJ3A 3FMYA 2ICPA 3DM5A 2IVBA 1LMB3 2PUGA 3QFIA 2LCVA 2O4AA 3B7HA 4EKIA 3IVPA 1Y9QA 2AXUA 4Z58A 4ER5A 2YBDA 4ER6A 1NEQA 3F52A 3ZHMA 5DRYA 1YSEA 1WETA 3G0TA 1ZZ7A 1RPEL 2PXFA 4FN3A 2PXUA 2PUDA 5DTQA 1O4XA 1POUA 2PXVA 1ZUGA 4Y42A 3JXBC 1ZZ6A 3G5GA 1PRVA 1ZAYA 2JCGA 2CSFA 4FBIA 5DT2A 2LLWA 2PXQA 5DRTA 3GZCA 4IVZA 1PRUA 2WIUB 2L8NA 1SQ8A 1ZZ8A 2IVGA 3BS3A 4EQZA 3SR4A 1QPZA 1IC8A 3FYAA 3KXAA 1XWRA 2J7UA 3TELA 3SX0A 2PXEA 3NZLA 2PE5A 3SCHA 4J1WA 1E3OC 1PRAA 2B5AA 3NROA 3H5TA 2XCJA 2EF8A 1ZPQA 1WH6A 1LCDA 3R09A 3M9LA 4OB4A 3TEPA 3OP9A 1U2ZA 2XSDC 3CROL 1JH9A 2OFYA 5GAHi 3NXHA 4GHJA 5A7LA 1VPWA 2LYLA 4X4GA 5DSXA 4NDWA 2IU7A 4HRAA 2LNMA 3FYMA 2AUWA 2FJRA 4OBMA 4Z5CA 2LYRA 1GT0C 3F6WA 3A9ZA 4MCTA 5DTMA 2AXVA 3OKZA 1DWKA 3CECA 3GZDC 1QZXA 2GZUA 4X4FA 2ODRD 3QOWA 3NDBB 1WIZA 2PXDA 3QYXA 1JFTA 2AWIA 1QP0A 2XXQA 1NW3A 1RIOA 3GN5A 4EZIA 2FFHA 3CLCA 4Z5DA 4EK9A 2D5VA 2KZ8A 3VWSA 1ZZCA 2PIJA 1EFAA 2L49A 3ME5A 2M4HA 2HFZA 2VEOA 3SCGA 5GAGi 1OSLA 2AW6A 4X4HA 4O8BA 2AXZA 2JQEA 1R63A 4DE9A 1ZS4A 3GZDA 4J1XA 1LCCA 1CQTA 2LYKA 4I6TA 2KEKA 3OQOA 1QQAA 2OR1L 4DE8A 1BDHA 5K98B 3OMTA 1HF0A 1RZRD 2CROA 2XI8A 1JWLA 4GQMA 3OWQA 3HZIB 1JFSA 1R69A 3S8QA 4ER7A 5JUWA 2LLVA 4PU7A 1X57A 2O49A 3OQNA 2LYPA 1ZVVA 4MCXA 1LQCA 3OQMA 1UTXA 2MEZA
chains in the Genus database with same CATH topology
3F6WA 3ZHIA 1WETA 2ICTA 4MCTA 2AXVA 1RZRA 1ZZ7A 1RPEL 1DWKA 3GBFA 2PUFA 3CECA 3G7DA 3JXCL 4FN3A 2GZUA 3BD1A 4X4FA 2PUDA 1O4XA 1POUA 2MQKA 2IVQA 1WIZA 3GN5B 4JCYA 4F8DA 2R63A 3TRBA 1ZUGA 3MLFA 4Y42A 2PUBA 3ZKCA 4PU8A 3JXBC 1B0NA 2BNOA 1ZZ6A 3G5GA 3QYXA 1JFTA 1PRVA 2AWIA 1QP0A 1QP4A 2A6CA 1ZAYA 1RIOA 3GN5A 2JCGA 2JVLA 3LFPA 3EUSA 4YG7B 2GRMA 1L1MA 4YG4A 1X2LA 3D1NI 1RZSA 2CSFA 4FBIA 3CLCA 1LLIA 2PUEA 1UXCA 2GRLA 2H8RA 4IVZA 4Z5DA 1PRUA 2WIUB 1ZZBA 2L8NA 4PU3C 2D5VA 1SQ8A 1ZZ8A 4Z59A 2IVGA 3F51A 4YBAA 3UFDA 2KZ8A 2IUOA 4Z5HA 3BS3A 1NERA 4I8TA 1QPZA 3L1PA 3O9XA 1IC8A 3FYAA 3KXAA 3U3WA 1CJGA 2O38A 3BDNA 4IWRA 1ZZCA 3R1FA 4YG1A 2PIJA 1PERL 1EFAA 1AU7A 1XWRA 2L49A 3QF3A 3SCFA 3ZHMA 3QQ6A 2PPXA 3SCGA 3VK0A 1OSLA 2EBYA 1BDIA 4YARA 2PE5A 2AW6A 3SCHA 4J1WA 3PXPA 1ZZ9A 1DW9A 1OCTC 2EWTA 4X4HA 2HINA 1E3OC 4I6UA 1PRAA 2B5AA 2BNNA 3QWGA 4X4BA 4O8BA 2AXZA 4X4CA 3RZZA 1R63A 1UXDA 1GT0C 3H5TA 2XCJA 2EF8A 1ZPQA 3KJXA 2HSGA 3JXDL 1ZS4A 1WH6A 4I6RA 1PNRA 2BNMA 1LCDA 4IA8A 4J1XA 1LCCA 2XIUA 1QQBA 1CQTA 2LYKA 4I6TA 2KEKA 2IV1A 3OQOA 2PUAA 4X4DA 4OB4A 2KEJA 1QQAA 2OR1L 3OP9A 4X4IA 4PU4C 2XSDC 5K98B 3OMTA 1BDHA 4JCXA 1HF0A 1WH8A 2XJ3A 2ICPA 3FMYA 2KPJA 3KZ3A 1RZRD 1JH9A 3CROL 2CROA 2OFYA 2XI8A 2KEIA 1JWLA 2IVBA 4GQMA 4GHJA 5A7LA 1VPWA 3HZIB 1QP7A 1JFSA 1R69A 2LYLA 4X4GA 1LMB3 3S8QA 4X4EA 2PUGA 2LCVA 2IU7A 4NDWA 4PU7A 2O4AA 3B7HA 3FYMA 2R1JL 1Y7YA 1X57A 2AUWA 2LYJA 2O49A 2FJRA 3OQNA 3DNVB 3IVPA 1S7EA 1Y9QA 2PUCA 2AXUA 2LYPA 4JQDA 4Z58A 4Z5CA 1ZVVA 2LYSA 1ADRA 4MCXA 1LQCA 2LYQA 2BJCA 2LYRA 3OQMA 1UTXA 2WUSR 1NEQA 3F52A 3LISA 2MEZA 1YSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F6W A;  3ZHI A;  1WET A;  2ICT A;  4MCT A;  2AXV A;  1RZR A;  1ZZ7 A;  1RPE L;  1DWK A;  3GBF A;  2PUF A;  3CEC A;  3G7D A;  3JXC L;  4FN3 A;  2GZU A;  3BD1 A;  4X4F A;  2PUD A;  1O4X A;  1POU A;  2MQK A;  2IVQ A;  1WIZ A;  3GN5 B;  4JCY A;  4F8D A;  2R63 A;  3TRB A;  1ZUG A;  3MLF A;  4Y42 A;  2PUB A;  3ZKC A;  4PU8 A;  3JXB C;  1B0N A;  2BNO A;  1ZZ6 A;  3G5G A;  3QYX A;  1JFT A;  1PRV A;  2AWI A;  1QP0 A;  1QP4 A;  2A6C A;  1ZAY A;  1RIO A;  3GN5 A;  2JCG A;  2JVL A;  3LFP A;  3EUS A;  4YG7 B;  2GRM A;  1L1M A;  4YG4 A;  1X2L A;  3D1N I;  1RZS A;  2CSF A;  4FBI A;  3CLC A;  1LLI A;  2PUE A;  1UXC A;  2GRL A;  2H8R A;  4IVZ A;  4Z5D A;  1PRU A;  2WIU B;  1ZZB A;  2L8N A;  4PU3 C;  2D5V A;  1SQ8 A;  1ZZ8 A;  4Z59 A;  2IVG A;  3F51 A;  4YBA A;  3UFD A;  2KZ8 A;  2IUO A;  4Z5H A;  3BS3 A;  1NER A;  4I8T A;  1QPZ A;  3L1P A;  3O9X A;  1IC8 A;  3FYA A;  3KXA A;  3U3W A;  1CJG A;  2O38 A;  3BDN A;  4IWR A;  1ZZC A;  3R1F A;  4YG1 A;  2PIJ A;  1PER L;  1EFA A;  1AU7 A;  1XWR A;  2L49 A;  3QF3 A;  3SCF A;  3ZHM A;  3QQ6 A;  2PPX A;  3SCG A;  3VK0 A;  1OSL A;  2EBY A;  1BDI A;  4YAR A;  2PE5 A;  2AW6 A;  3SCH A;  4J1W A;  3PXP A;  1ZZ9 A;  1DW9 A;  1OCT C;  2EWT A;  4X4H A;  2HIN A;  1E3O C;  4I6U A;  1PRA A;  2B5A A;  2BNN A;  3QWG A;  4X4B A;  4O8B A;  2AXZ A;  4X4C A;  3RZZ A;  1R63 A;  1UXD A;  1GT0 C;  3H5T A;  2XCJ A;  2EF8 A;  1ZPQ A;  3KJX A;  2HSG A;  3JXD L;  1ZS4 A;  1WH6 A;  4I6R A;  1PNR A;  2BNM A;  1LCD A;  4IA8 A;  4J1X A;  1LCC A;  2XIU A;  1QQB A;  1CQT A;  2LYK A;  4I6T A;  2KEK A;  2IV1 A;  3OQO A;  2PUA A;  4X4D A;  4OB4 A;  2KEJ A;  1QQA A;  2OR1 L;  3OP9 A;  4X4I A;  4PU4 C;  2XSD C;  5K98 B;  3OMT A;  1BDH A;  4JCX A;  1HF0 A;  1WH8 A;  2XJ3 A;  2ICP A;  3FMY A;  2KPJ A;  3KZ3 A;  1RZR D;  1JH9 A;  3CRO L;  2CRO A;  2OFY A;  2XI8 A;  2KEI A;  1JWL A;  2IVB A;  4GQM A;  4GHJ A;  5A7L A;  1VPW A;  3HZI B;  1QP7 A;  1JFS A;  1R69 A;  2LYL A;  4X4G A;  1LMB 3;  3S8Q A;  4X4E A;  2PUG A;  2LCV A;  2IU7 A;  4NDW A;  4PU7 A;  2O4A A;  3B7H A;  3FYM A;  2R1J L;  1Y7Y A;  1X57 A;  2AUW A;  2LYJ A;  2O49 A;  2FJR A;  3OQN A;  3DNV B;  3IVP A;  1S7E A;  1Y9Q A;  2PUC A;  2AXU A;  2LYP A;  4JQD A;  4Z58 A;  4Z5C A;  1ZVV A;  2LYS A;  1ADR A;  4MCX A;  1LQC A;  2LYQ A;  2BJC A;  2LYR A;  3OQM A;  1UTX A;  2WUS R;  1NEQ A;  3F52 A;  3LIS A;  2MEZ A;  1YSE A; 
#chains in the Genus database with same CATH topology
 3ZHI A;  2ICT A;  2PXL A;  3G7D A;  2J7W A;  2IVQ A;  3A9X A;  4F8D A;  2R63 A;  3TRB A;  2XXP A;  1B0N A;  2BNO A;  1QP4 A;  1L1M A;  2JVL A;  3EUS A;  2V3C C;  3D1N I;  1RZS A;  1LLI A;  2PUE A;  1UXC A;  2GRL A;  1DUL A;  4PU3 C;  3F51 A;  3QOX A;  3MEJ A;  2IUO A;  1NER A;  3L1P A;  3U3W A;  1CJG A;  3BDN A;  1PER L;  3R1F A;  4YG1 A;  3SCF A;  2PPX A;  3VK0 A;  1BDI A;  1QB2 A;  4Q2J A;  1ZZ9 A;  2EWT A;  2HCS A;  4I6U A;  3QWG A;  4X4B A;  3RZZ A;  2PXT A;  1UXD A;  3JXD L;  3KJX A;  2HSG A;  2IV1 A;  4X4D A;  2KEJ A;  1WH8 A;  2KPJ A;  3KZ3 A;  1HQ1 A;  2PXP A;  2KEI A;  3KL4 A;  3GUU A;  1QP7 A;  4X4E A;  3UWP A;  2R1J L;  1Y7Y A;  2LYJ A;  3DNV B;  3ZPX A;  2PUC A;  1S7E A;  4JQD A;  2LYS A;  1ADR A;  2XXA A;  2LYQ A;  2BJC A;  2WUS R;  3LIS A;  3PE5 A;  1RZR A;  2PXB A;  3GBF A;  2PUF A;  3JXC L;  3BD1 A;  2L1P A;  2MXD A;  2MQK A;  4JCY A;  3GN5 B;  4WVL A;  3LQX A;  3MLF A;  2PUB A;  3ZKC A;  3A9Y A;  4PU8 A;  2PXK A;  2A6C A;  4ER0 A;  3LFP A;  4YG7 B;  2GRM A;  4YG4 A;  1X2L A;  2H8R A;  1ZZB A;  4Z59 A;  4YBA A;  3UFD A;  4Z5H A;  4I8T A;  3O9X A;  2O38 A;  4IWR A;  1AU7 A;  3QF3 A;  5DTR A;  3QQ6 A;  1MFQ C;  2EBY A;  4YAR A;  4EKG A;  3PXP A;  1DW9 A;  1OCT C;  2HIN A;  2BNN A;  4X4C A;  3TFL A;  4ER3 A;  1PNR A;  4I6R A;  2BNM A;  4IA8 A;  1QQB A;  2XIU A;  2HCN A;  2PUA A;  4X4I A;  4PU4 C;  4JCX A;  2XJ3 A;  3FMY A;  2ICP A;  3DM5 A;  2IVB A;  1LMB 3;  2PUG A;  3QFI A;  2LCV A;  2O4A A;  3B7H A;  4EKI A;  3IVP A;  1Y9Q A;  2AXU A;  4Z58 A;  4ER5 A;  2YBD A;  4ER6 A;  1NEQ A;  3F52 A;  3ZHM A;  5DRY A;  1YSE A;  1WET A;  3G0T A;  1ZZ7 A;  1RPE L;  2PXF A;  4FN3 A;  2PXU A;  2PUD A;  5DTQ A;  1O4X A;  1POU A;  2PXV A;  1ZUG A;  4Y42 A;  3JXB C;  1ZZ6 A;  3G5G A;  1PRV A;  1ZAY A;  2JCG A;  2CSF A;  4FBI A;  5DT2 A;  2LLW A;  2PXQ A;  5DRT A;  3GZC A;  4IVZ A;  1PRU A;  2WIU B;  2L8N A;  1SQ8 A;  1ZZ8 A;  2IVG A;  3BS3 A;  4EQZ A;  3SR4 A;  1QPZ A;  1IC8 A;  3FYA A;  3KXA A;  1XWR A;  2J7U A;  3TEL A;  3SX0 A;  2PXE A;  3NZL A;  2PE5 A;  3SCH A;  4J1W A;  1E3O C;  1PRA A;  2B5A A;  3NRO A;  3H5T A;  2XCJ A;  2EF8 A;  1ZPQ A;  1WH6 A;  1LCD A;  3R09 A;  3M9L A;  4OB4 A;  3TEP A;  3OP9 A;  1U2Z A;  2XSD C;  3CRO L;  1JH9 A;  2OFY A;  5GAH i;  3NXH A;  4GHJ A;  5A7L A;  1VPW A;  2LYL A;  4X4G A;  5DSX A;  4NDW A;  2IU7 A;  4HRA A;  2LNM A;  3FYM A;  2AUW A;  2FJR A;  4OBM A;  4Z5C A;  2LYR A;  1GT0 C;  3F6W A;  3A9Z A;  4MCT A;  5DTM A;  2AXV A;  3OKZ A;  1DWK A;  3CEC A;  3GZD C;  1QZX A;  2GZU A;  4X4F A;  2ODR D;  3QOW A;  3NDB B;  1WIZ A;  2PXD A;  3QYX A;  1JFT A;  2AWI A;  1QP0 A;  2XXQ A;  1NW3 A;  1RIO A;  3GN5 A;  4EZI A;  2FFH A;  3CLC A;  4Z5D A;  4EK9 A;  2D5V A;  2KZ8 A;  3VWS A;  1ZZC A;  2PIJ A;  1EFA A;  2L49 A;  3ME5 A;  2M4H A;  2HFZ A;  2VEO A;  3SCG A;  5GAG i;  1OSL A;  2AW6 A;  4X4H A;  4O8B A;  2AXZ A;  2JQE A;  1R63 A;  4DE9 A;  1ZS4 A;  3GZD A;  4J1X A;  1LCC A;  1CQT A;  2LYK A;  4I6T A;  2KEK A;  3OQO A;  1QQA A;  2OR1 L;  4DE8 A;  1BDH A;  5K98 B;  3OMT A;  1HF0 A;  1RZR D;  2CRO A;  2XI8 A;  1JWL A;  4GQM A;  3OWQ A;  3HZI B;  1JFS A;  1R69 A;  3S8Q A;  4ER7 A;  5JUW A;  2LLV A;  4PU7 A;  1X57 A;  2O49 A;  3OQN A;  2LYP A;  1ZVV A;  4MCX A;  1LQC A;  3OQM A;  1UTX A;  2MEZ A; 
#chains in the Genus database with same CATH homology
 3F6W A;  3ZHI A;  1WET A;  2ICT A;  4MCT A;  2AXV A;  1RZR A;  1ZZ7 A;  1RPE L;  1DWK A;  3GBF A;  2PUF A;  3CEC A;  3G7D A;  3JXC L;  4FN3 A;  2GZU A;  3BD1 A;  4X4F A;  2PUD A;  1O4X A;  1POU A;  2MQK A;  2IVQ A;  1WIZ A;  3GN5 B;  4JCY A;  4F8D A;  2R63 A;  3TRB A;  1ZUG A;  3MLF A;  4Y42 A;  2PUB A;  3ZKC A;  4PU8 A;  3JXB C;  1B0N A;  2BNO A;  1ZZ6 A;  3G5G A;  3QYX A;  1JFT A;  1PRV A;  2AWI A;  1QP0 A;  1QP4 A;  2A6C A;  1ZAY A;  1RIO A;  3GN5 A;  2JCG A;  2JVL A;  3LFP A;  3EUS A;  4YG7 B;  2GRM A;  1L1M A;  4YG4 A;  1X2L A;  3D1N I;  1RZS A;  2CSF A;  4FBI A;  3CLC A;  1LLI A;  2PUE A;  1UXC A;  2GRL A;  2H8R A;  4IVZ A;  4Z5D A;  1PRU A;  2WIU B;  1ZZB A;  2L8N A;  4PU3 C;  2D5V A;  1SQ8 A;  1ZZ8 A;  4Z59 A;  2IVG A;  3F51 A;  4YBA A;  3UFD A;  2KZ8 A;  2IUO A;  4Z5H A;  3BS3 A;  1NER A;  4I8T A;  1QPZ A;  3L1P A;  3O9X A;  1IC8 A;  3FYA A;  3KXA A;  3U3W A;  1CJG A;  2O38 A;  3BDN A;  4IWR A;  1ZZC A;  3R1F A;  4YG1 A;  2PIJ A;  1PER L;  1EFA A;  1AU7 A;  1XWR A;  2L49 A;  3QF3 A;  3SCF A;  3ZHM A;  3QQ6 A;  2PPX A;  3SCG A;  3VK0 A;  1OSL A;  2EBY A;  1BDI A;  4YAR A;  2PE5 A;  2AW6 A;  3SCH A;  4J1W A;  3PXP A;  1ZZ9 A;  1DW9 A;  1OCT C;  2EWT A;  4X4H A;  2HIN A;  1E3O C;  4I6U A;  1PRA A;  2B5A A;  2BNN A;  3QWG A;  4X4B A;  4O8B A;  2AXZ A;  4X4C A;  3RZZ A;  1R63 A;  1UXD A;  1GT0 C;  3H5T A;  2XCJ A;  2EF8 A;  1ZPQ A;  3KJX A;  2HSG A;  3JXD L;  1ZS4 A;  1WH6 A;  4I6R A;  1PNR A;  2BNM A;  1LCD A;  4IA8 A;  4J1X A;  1LCC A;  2XIU A;  1QQB A;  1CQT A;  2LYK A;  4I6T A;  2KEK A;  2IV1 A;  3OQO A;  2PUA A;  4X4D A;  4OB4 A;  2KEJ A;  1QQA A;  2OR1 L;  3OP9 A;  4X4I A;  4PU4 C;  2XSD C;  5K98 B;  3OMT A;  1BDH A;  4JCX A;  1HF0 A;  1WH8 A;  2XJ3 A;  2ICP A;  3FMY A;  2KPJ A;  3KZ3 A;  1RZR D;  1JH9 A;  3CRO L;  2CRO A;  2OFY A;  2XI8 A;  2KEI A;  1JWL A;  2IVB A;  4GQM A;  4GHJ A;  5A7L A;  1VPW A;  3HZI B;  1QP7 A;  1JFS A;  1R69 A;  2LYL A;  4X4G A;  1LMB 3;  3S8Q A;  4X4E A;  2PUG A;  2LCV A;  2IU7 A;  4NDW A;  4PU7 A;  2O4A A;  3B7H A;  3FYM A;  2R1J L;  1Y7Y A;  1X57 A;  2AUW A;  2LYJ A;  2O49 A;  2FJR A;  3OQN A;  3DNV B;  3IVP A;  1S7E A;  1Y9Q A;  2PUC A;  2AXU A;  2LYP A;  4JQD A;  4Z58 A;  4Z5C A;  1ZVV A;  2LYS A;  1ADR A;  4MCX A;  1LQC A;  2LYQ A;  2BJC A;  2LYR A;  3OQM A;  1UTX A;  2WUS R;  1NEQ A;  3F52 A;  3LIS A;  2MEZ A;  1YSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...