2LYQA

Noe-based 3d structure of the monomeric intermediate of cylr2 at 262k (-11 celsius degrees)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cold denaturation of a protein dimer monitored at atomic resolution.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Dna binding protein
molecule keywords CylR2
total genus 17
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2lyqA00
1R63A 2PPXA 2ICPA 2KEKA 2WUSR 2FJRA 2IUOA 1BDHA 2IU7A 1QQAA 3S8QA 3IVPA 1VPWA 4IWRA 4X4GA 1AU7A 2BJCA 2AW6A 2IVBA 1RPEL 3GBFA 1UXCA 3KJXA 1SQ8A 1JFTA 1LMB3 3FMYA 3BS3A 3B7HA 4J1XA 1WH6A 2AXZA 4JCYA 1WH8A 2MEZA 2LYRA 4Z5CA 1JWLA 4IVZA 1RIOA 1QQBA 4FBIA 4IA8A 2XI8A 4YARA 1LCCA 1EFAA 1QP4A 1ADRA 2GRLA 3L1PA 3LISA 1LQCA 2B5AA 1X57A 3QF3A 3TRBA 2PUEA 2GZUA 3KZ3A 3BD1A 4PU4C 2CROA 2MQKA 2JCGA 2KPJA 2PIJA 4GQMA 3U3WA 1RZRA 1ZVVA 2PUDA 1PERL 1POUA 4I6UA 3OP9A 4GHJA 2GRMA 4I6TA 1R69A 3JXCL 3OQOA 1PNRA 4X4HA 2PUFA 3GN5B 2IVGA 5A7LA 4YG4A 4PU3C 2KZ8A 2EWTA 2XCJA 1NERA 3PXPA 4NDWA 3ZHIA 4X4BA 1O4XA 2H8RA 2LYQA 2ICTA 4YG1A 1UTXA 3RZZA 1RZSA 2LCVA 1LLIA 4Z59A 1X2LA 4PU8A 1WIZA 3DNVB 4X4IA 2PUAA 2PE5A 1ZZ8A 3H5TA 1RZRD 3HZIB 1QP7A 3JXBC 1E3OC 2BNNA 2CSFA 2L49A 4I6RA 1LCDA 4OB4A 2KEIA 3FYMA 4O8BA 4X4DA 2LYPA 1ZZ6A 1IC8A 2PUGA 2XIUA 3FYAA 1ZS4A 1ZUGA 3SCFA 1GT0C 3G5GA 2WIUB 1NEQA 1ZZ7A 4YG7B 1PRAA 2XSDC 3O9XA 4JCXA 2OR1L 2LYJA 4I8TA 2R1JL 4MCXA 3D1NI 1JH9A 2KEJA 1L1MA 2BNOA 3ZHMA 3MLFA 1OSLA 4FN3A 1ZZCA 4J1WA 1QP0A 1WETA 1JFSA 2LYLA 1XWRA 1UXDA 2AWIA 3QWGA 1BDIA 3GN5A 3JXDL 3F51A 2D5VA 2O4AA 1S7EA 2BNMA 3F52A 1ZPQA 3QQ6A 1YSEA 3OMTA 3UFDA 1PRUA 3ZKCA 2AXUA 2JVLA 4F8DA 4Y42A 3R1FA 4Z5HA 1ZAYA 1CQTA 3G7DA 4PU7A 2EF8A 2A6CA 2R63A 2PUCA 2LYKA 4JQDA 2LYSA 1Y9QA 2XJ3A 3CECA 3SCGA 3LFPA 4X4FA 2AXVA 2HSGA 2O49A 3SCHA 4Z5DA 1DW9A 1PRVA 2AUWA 3KXAA 3OQNA 3QYXA 2IVQA 2L8NA 1ZZ9A 2HINA 2O38A 1Y7YA 4YBAA 1ZZBA 2OFYA 5K98B 4X4EA 3VK0A 2EBYA 2IV1A 3CLCA 3OQMA 4X4CA 1OCTC 4MCTA 1HF0A 3EUSA 2PUBA 1CJGA 1QPZA 1B0NA 3BDNA 4Z58A 1DWKA 3CROL 3F6WA
chains in the Genus database with same CATH superfamily
2ICPA 5DSXA 1QQAA 3IVPA 1VPWA 3VWSA 1AU7A 1RPEL 2XXPA 3BS3A 1WH6A 2AXZA 1WH8A 2MEZA 1JWLA 4EQZA 2XI8A 3ZPXA 3TFLA 1X57A 2PUEA 2GZUA 3TEPA 2CROA 2PUDA 1POUA 4I6UA 4GHJA 2GRMA 4I6TA 3OQOA 2XCJA 3ZHIA 2H8RA 3UWPA 4YG1A 1UTXA 5DTQA 1RZSA 1QZXA 3DNVB 3M9LA 1RZRD 1E3OC 2BNNA 3NDBB 1LCDA 3FYMA 4O8BA 5DRTA 1ZUGA 2FFHA 3G5GA 4YG7B 1PRAA 2XSDC 4I8TA 3OKZA 3KL4A 2BNOA 2HCSA 1XWRA 1NW3A 3F52A 2LNMA 3UFDA 4F8DA 4Y42A 3G7DA 4PU7A 4JQDA 3CECA 3LFPA 2HSGA 3A9YA 2PXQA 2AUWA 3OQNA 5GAGi 1ZZ9A 2J7UA 1ZZBA 4EZIA 2EBYA 3OQMA 4MCTA 1HQ1A 1CJGA 3BDNA 5DT2A 2KEKA 2IUOA 2IU7A 2AW6A 3GBFA 1JFTA 4JCYA 4IVZA 1RIOA 4FBIA 2J7WA 4YARA 1LCCA 1QP4A 1ADRA 3LISA 2XXAA 1U2ZA 2PIJA 4GQMA 3U3WA 5GAHi 3GZCA 5A7LA 3PXPA 4X4BA 4NDWA 2ICTA 3RZZA 4Z59A 4PU8A 4X4IA 1ZZ8A 3H5TA 2L49A 4X4DA 1IC8A 3FYAA 1ZS4A 3SCFA 1GT0C 2PXFA 1NEQA 1ZZ7A 2PXBA 2PXLA 3D1NI 2KEJA 4WVLA 4FN3A 1ZZCA 1WETA 1JFSA 2AWIA 1UXDA 3QWGA 3GN5A 1S7EA 1ZPQA 2JVLA 1ZAYA 3R1FA 3SX0A 4HRAA 2XXQA 2PUCA 2LYKA 2LYSA 2XJ3A 3SCGA 4X4FA 3PE5A 3KXAA 3QYXA 2HINA 5K98B 3A9ZA 2L1PA 1OCTC 1HF0A 2PUBA 1B0NA 1R63A 2PPXA 3A9XA 2ODRD 2IVBA 1UXCA 3KJXA 1LMB3 3NXHA 2LLVA 4ER3A 2LYRA 2HFZA 1QQBA 4ER0A 2PXEA 3R09A 3NZLA 3L1PA 3QF3A 4ER5A 3GZDC 3BD1A 3KZ3A 4PU4C 4EKIA 5JUWA 2MQKA 2KPJA 1RZRA 3QOXA 1R69A 4ER6A 3JXCL 3G0TA 2IVGA 4PU3C 4YG4A 2PXTA 1NERA 1O4XA 5DTMA 2LCVA 1LLIA 1WIZA 3GUUA 3HZIB 2MXDA 2CSFA 4I6RA 4OB4A 2PUGA 2XIUA 2PXVA 4OBMA 2WIUB 3O9XA 2JQEA 2R1JL 1JH9A 3MLFA 1OSLA 2LYLA 2PXKA 3JXDL 2BNMA 3QQ6A 1YSEA 3OMTA 1PRUA 1QB2A 4Z5HA 4ER7A 2A6CA 3SCHA 3CLCA 3VK0A 2IV1A 2M4HA 3EUSA 2HCNA 4DE9A 1BDHA 3CROL 3QFIA 2WUSR 2PXDA 3ME5A 2FJRA 2PXUA 3S8QA 2YBDA 3DM5A 4IWRA 4X4GA 2V3CC 2BJCA 3TELA 1SQ8A 3FMYA 3B7HA 4J1XA 4Z5CA 5DTRA 4IA8A 1EFAA 3NROA 2GRLA 1LQCA 2B5AA 3TRBA 3SR4A 3QOWA 2JCGA 1ZVVA 1PERL 3OP9A 3MEJA 3LQXA 1PNRA 2PUFA 2LLWA 3GN5B 4X4HA 2KZ8A 2EWTA 2LYQA 4DE8A 1X2LA 1MFQC 2PUAA 2PE5A 1QP7A 3JXBC 2KEIA 2LYPA 1ZZ6A 5DRYA 4JCXA 2OR1L 2LYJA 4MCXA 3ZHMA 1L1MA 4J1WA 1QP0A 1BDIA 3OWQA 3F51A 2D5VA 2O4AA 1DULA 4EKGA 3ZKCA 2AXUA 2VEOA 1CQTA 2EF8A 2R63A 3GZDA 1Y9QA 2AXVA 2O49A 4Z5DA 1DW9A 4EK9A 1PRVA 2IVQA 2L8NA 2PXPA 2O38A 4YBAA 1Y7YA 2OFYA 4X4EA 4X4CA 1QPZA 4Q2JA 4Z58A 1DWKA 3F6WA
chains in the Genus database with same CATH topology
1R63A 2PPXA 2ICPA 2KEKA 2WUSR 2FJRA 2IUOA 1BDHA 2IU7A 1QQAA 3S8QA 3IVPA 1VPWA 4IWRA 4X4GA 1AU7A 2BJCA 2AW6A 2IVBA 1RPEL 3GBFA 1UXCA 3KJXA 1SQ8A 1JFTA 1LMB3 3FMYA 3BS3A 3B7HA 4J1XA 1WH6A 2AXZA 4JCYA 1WH8A 2MEZA 2LYRA 4Z5CA 1JWLA 4IVZA 1RIOA 1QQBA 4FBIA 4IA8A 2XI8A 4YARA 1LCCA 1EFAA 1QP4A 1ADRA 2GRLA 3L1PA 3LISA 1LQCA 2B5AA 1X57A 3QF3A 3TRBA 2PUEA 2GZUA 3KZ3A 3BD1A 4PU4C 2CROA 2MQKA 2JCGA 2KPJA 2PIJA 4GQMA 3U3WA 1RZRA 1ZVVA 2PUDA 1PERL 1POUA 4I6UA 3OP9A 4GHJA 2GRMA 4I6TA 1R69A 3JXCL 3OQOA 1PNRA 4X4HA 2PUFA 3GN5B 2IVGA 5A7LA 4YG4A 4PU3C 2KZ8A 2EWTA 2XCJA 1NERA 3PXPA 4NDWA 3ZHIA 4X4BA 1O4XA 2H8RA 2LYQA 2ICTA 4YG1A 1UTXA 3RZZA 1RZSA 2LCVA 1LLIA 4Z59A 1X2LA 4PU8A 1WIZA 3DNVB 4X4IA 2PUAA 2PE5A 1ZZ8A 3H5TA 1RZRD 3HZIB 1QP7A 3JXBC 1E3OC 2BNNA 2CSFA 2L49A 4I6RA 1LCDA 4OB4A 2KEIA 3FYMA 4O8BA 4X4DA 2LYPA 1ZZ6A 1IC8A 2PUGA 2XIUA 3FYAA 1ZS4A 1ZUGA 3SCFA 1GT0C 3G5GA 2WIUB 1NEQA 1ZZ7A 4YG7B 1PRAA 2XSDC 3O9XA 4JCXA 2OR1L 2LYJA 4I8TA 2R1JL 4MCXA 3D1NI 1JH9A 2KEJA 1L1MA 2BNOA 3ZHMA 3MLFA 1OSLA 4FN3A 1ZZCA 4J1WA 1QP0A 1WETA 1JFSA 2LYLA 1XWRA 1UXDA 2AWIA 3QWGA 1BDIA 3GN5A 3JXDL 3F51A 2D5VA 2O4AA 1S7EA 2BNMA 3F52A 1ZPQA 3QQ6A 1YSEA 3OMTA 3UFDA 1PRUA 3ZKCA 2AXUA 2JVLA 4F8DA 4Y42A 3R1FA 4Z5HA 1ZAYA 1CQTA 3G7DA 4PU7A 2EF8A 2A6CA 2R63A 2PUCA 2LYKA 4JQDA 2LYSA 1Y9QA 2XJ3A 3CECA 3SCGA 3LFPA 4X4FA 2AXVA 2HSGA 2O49A 3SCHA 4Z5DA 1DW9A 1PRVA 2AUWA 3KXAA 3OQNA 3QYXA 2IVQA 2L8NA 1ZZ9A 2HINA 2O38A 1Y7YA 4YBAA 1ZZBA 2OFYA 5K98B 4X4EA 3VK0A 2EBYA 2IV1A 3CLCA 3OQMA 4X4CA 1OCTC 4MCTA 1HF0A 3EUSA 2PUBA 1CJGA 1QPZA 1B0NA 3BDNA 4Z58A 1DWKA 3CROL 3F6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R63 A;  2PPX A;  2ICP A;  2KEK A;  2WUS R;  2FJR A;  2IUO A;  1BDH A;  2IU7 A;  1QQA A;  3S8Q A;  3IVP A;  1VPW A;  4IWR A;  4X4G A;  1AU7 A;  2BJC A;  2AW6 A;  2IVB A;  1RPE L;  3GBF A;  1UXC A;  3KJX A;  1SQ8 A;  1JFT A;  1LMB 3;  3FMY A;  3BS3 A;  3B7H A;  4J1X A;  1WH6 A;  2AXZ A;  4JCY A;  1WH8 A;  2MEZ A;  2LYR A;  4Z5C A;  1JWL A;  4IVZ A;  1RIO A;  1QQB A;  4FBI A;  4IA8 A;  2XI8 A;  4YAR A;  1LCC A;  1EFA A;  1QP4 A;  1ADR A;  2GRL A;  3L1P A;  3LIS A;  1LQC A;  2B5A A;  1X57 A;  3QF3 A;  3TRB A;  2PUE A;  2GZU A;  3KZ3 A;  3BD1 A;  4PU4 C;  2CRO A;  2MQK A;  2JCG A;  2KPJ A;  2PIJ A;  4GQM A;  3U3W A;  1RZR A;  1ZVV A;  2PUD A;  1PER L;  1POU A;  4I6U A;  3OP9 A;  4GHJ A;  2GRM A;  4I6T A;  1R69 A;  3JXC L;  3OQO A;  1PNR A;  4X4H A;  2PUF A;  3GN5 B;  2IVG A;  5A7L A;  4YG4 A;  4PU3 C;  2KZ8 A;  2EWT A;  2XCJ A;  1NER A;  3PXP A;  4NDW A;  3ZHI A;  4X4B A;  1O4X A;  2H8R A;  2LYQ A;  2ICT A;  4YG1 A;  1UTX A;  3RZZ A;  1RZS A;  2LCV A;  1LLI A;  4Z59 A;  1X2L A;  4PU8 A;  1WIZ A;  3DNV B;  4X4I A;  2PUA A;  2PE5 A;  1ZZ8 A;  3H5T A;  1RZR D;  3HZI B;  1QP7 A;  3JXB C;  1E3O C;  2BNN A;  2CSF A;  2L49 A;  4I6R A;  1LCD A;  4OB4 A;  2KEI A;  3FYM A;  4O8B A;  4X4D A;  2LYP A;  1ZZ6 A;  1IC8 A;  2PUG A;  2XIU A;  3FYA A;  1ZS4 A;  1ZUG A;  3SCF A;  1GT0 C;  3G5G A;  2WIU B;  1NEQ A;  1ZZ7 A;  4YG7 B;  1PRA A;  2XSD C;  3O9X A;  4JCX A;  2OR1 L;  2LYJ A;  4I8T A;  2R1J L;  4MCX A;  3D1N I;  1JH9 A;  2KEJ A;  1L1M A;  2BNO A;  3ZHM A;  3MLF A;  1OSL A;  4FN3 A;  1ZZC A;  4J1W A;  1QP0 A;  1WET A;  1JFS A;  2LYL A;  1XWR A;  1UXD A;  2AWI A;  3QWG A;  1BDI A;  3GN5 A;  3JXD L;  3F51 A;  2D5V A;  2O4A A;  1S7E A;  2BNM A;  3F52 A;  1ZPQ A;  3QQ6 A;  1YSE A;  3OMT A;  3UFD A;  1PRU A;  3ZKC A;  2AXU A;  2JVL A;  4F8D A;  4Y42 A;  3R1F A;  4Z5H A;  1ZAY A;  1CQT A;  3G7D A;  4PU7 A;  2EF8 A;  2A6C A;  2R63 A;  2PUC A;  2LYK A;  4JQD A;  2LYS A;  1Y9Q A;  2XJ3 A;  3CEC A;  3SCG A;  3LFP A;  4X4F A;  2AXV A;  2HSG A;  2O49 A;  3SCH A;  4Z5D A;  1DW9 A;  1PRV A;  2AUW A;  3KXA A;  3OQN A;  3QYX A;  2IVQ A;  2L8N A;  1ZZ9 A;  2HIN A;  2O38 A;  1Y7Y A;  4YBA A;  1ZZB A;  2OFY A;  5K98 B;  4X4E A;  3VK0 A;  2EBY A;  2IV1 A;  3CLC A;  3OQM A;  4X4C A;  1OCT C;  4MCT A;  1HF0 A;  3EUS A;  2PUB A;  1CJG A;  1QPZ A;  1B0N A;  3BDN A;  4Z58 A;  1DWK A;  3CRO L;  3F6W A; 
#chains in the Genus database with same CATH topology
 2ICP A;  5DSX A;  1QQA A;  3IVP A;  1VPW A;  3VWS A;  1AU7 A;  1RPE L;  2XXP A;  3BS3 A;  1WH6 A;  2AXZ A;  1WH8 A;  2MEZ A;  1JWL A;  4EQZ A;  2XI8 A;  3ZPX A;  3TFL A;  1X57 A;  2PUE A;  2GZU A;  3TEP A;  2CRO A;  2PUD A;  1POU A;  4I6U A;  4GHJ A;  2GRM A;  4I6T A;  3OQO A;  2XCJ A;  3ZHI A;  2H8R A;  3UWP A;  4YG1 A;  1UTX A;  5DTQ A;  1RZS A;  1QZX A;  3DNV B;  3M9L A;  1RZR D;  1E3O C;  2BNN A;  3NDB B;  1LCD A;  3FYM A;  4O8B A;  5DRT A;  1ZUG A;  2FFH A;  3G5G A;  4YG7 B;  1PRA A;  2XSD C;  4I8T A;  3OKZ A;  3KL4 A;  2BNO A;  2HCS A;  1XWR A;  1NW3 A;  3F52 A;  2LNM A;  3UFD A;  4F8D A;  4Y42 A;  3G7D A;  4PU7 A;  4JQD A;  3CEC A;  3LFP A;  2HSG A;  3A9Y A;  2PXQ A;  2AUW A;  3OQN A;  5GAG i;  1ZZ9 A;  2J7U A;  1ZZB A;  4EZI A;  2EBY A;  3OQM A;  4MCT A;  1HQ1 A;  1CJG A;  3BDN A;  5DT2 A;  2KEK A;  2IUO A;  2IU7 A;  2AW6 A;  3GBF A;  1JFT A;  4JCY A;  4IVZ A;  1RIO A;  4FBI A;  2J7W A;  4YAR A;  1LCC A;  1QP4 A;  1ADR A;  3LIS A;  2XXA A;  1U2Z A;  2PIJ A;  4GQM A;  3U3W A;  5GAH i;  3GZC A;  5A7L A;  3PXP A;  4X4B A;  4NDW A;  2ICT A;  3RZZ A;  4Z59 A;  4PU8 A;  4X4I A;  1ZZ8 A;  3H5T A;  2L49 A;  4X4D A;  1IC8 A;  3FYA A;  1ZS4 A;  3SCF A;  1GT0 C;  2PXF A;  1NEQ A;  1ZZ7 A;  2PXB A;  2PXL A;  3D1N I;  2KEJ A;  4WVL A;  4FN3 A;  1ZZC A;  1WET A;  1JFS A;  2AWI A;  1UXD A;  3QWG A;  3GN5 A;  1S7E A;  1ZPQ A;  2JVL A;  1ZAY A;  3R1F A;  3SX0 A;  4HRA A;  2XXQ A;  2PUC A;  2LYK A;  2LYS A;  2XJ3 A;  3SCG A;  4X4F A;  3PE5 A;  3KXA A;  3QYX A;  2HIN A;  5K98 B;  3A9Z A;  2L1P A;  1OCT C;  1HF0 A;  2PUB A;  1B0N A;  1R63 A;  2PPX A;  3A9X A;  2ODR D;  2IVB A;  1UXC A;  3KJX A;  1LMB 3;  3NXH A;  2LLV A;  4ER3 A;  2LYR A;  2HFZ A;  1QQB A;  4ER0 A;  2PXE A;  3R09 A;  3NZL A;  3L1P A;  3QF3 A;  4ER5 A;  3GZD C;  3BD1 A;  3KZ3 A;  4PU4 C;  4EKI A;  5JUW A;  2MQK A;  2KPJ A;  1RZR A;  3QOX A;  1R69 A;  4ER6 A;  3JXC L;  3G0T A;  2IVG A;  4PU3 C;  4YG4 A;  2PXT A;  1NER A;  1O4X A;  5DTM A;  2LCV A;  1LLI A;  1WIZ A;  3GUU A;  3HZI B;  2MXD A;  2CSF A;  4I6R A;  4OB4 A;  2PUG A;  2XIU A;  2PXV A;  4OBM A;  2WIU B;  3O9X A;  2JQE A;  2R1J L;  1JH9 A;  3MLF A;  1OSL A;  2LYL A;  2PXK A;  3JXD L;  2BNM A;  3QQ6 A;  1YSE A;  3OMT A;  1PRU A;  1QB2 A;  4Z5H A;  4ER7 A;  2A6C A;  3SCH A;  3CLC A;  3VK0 A;  2IV1 A;  2M4H A;  3EUS A;  2HCN A;  4DE9 A;  1BDH A;  3CRO L;  3QFI A;  2WUS R;  2PXD A;  3ME5 A;  2FJR A;  2PXU A;  3S8Q A;  2YBD A;  3DM5 A;  4IWR A;  4X4G A;  2V3C C;  2BJC A;  3TEL A;  1SQ8 A;  3FMY A;  3B7H A;  4J1X A;  4Z5C A;  5DTR A;  4IA8 A;  1EFA A;  3NRO A;  2GRL A;  1LQC A;  2B5A A;  3TRB A;  3SR4 A;  3QOW A;  2JCG A;  1ZVV A;  1PER L;  3OP9 A;  3MEJ A;  3LQX A;  1PNR A;  2PUF A;  2LLW A;  3GN5 B;  4X4H A;  2KZ8 A;  2EWT A;  2LYQ A;  4DE8 A;  1X2L A;  1MFQ C;  2PUA A;  2PE5 A;  1QP7 A;  3JXB C;  2KEI A;  2LYP A;  1ZZ6 A;  5DRY A;  4JCX A;  2OR1 L;  2LYJ A;  4MCX A;  3ZHM A;  1L1M A;  4J1W A;  1QP0 A;  1BDI A;  3OWQ A;  3F51 A;  2D5V A;  2O4A A;  1DUL A;  4EKG A;  3ZKC A;  2AXU A;  2VEO A;  1CQT A;  2EF8 A;  2R63 A;  3GZD A;  1Y9Q A;  2AXV A;  2O49 A;  4Z5D A;  1DW9 A;  4EK9 A;  1PRV A;  2IVQ A;  2L8N A;  2PXP A;  2O38 A;  4YBA A;  1Y7Y A;  2OFY A;  4X4E A;  4X4C A;  1QPZ A;  4Q2J A;  4Z58 A;  1DWK A;  3F6W A; 
#chains in the Genus database with same CATH homology
 1R63 A;  2PPX A;  2ICP A;  2KEK A;  2WUS R;  2FJR A;  2IUO A;  1BDH A;  2IU7 A;  1QQA A;  3S8Q A;  3IVP A;  1VPW A;  4IWR A;  4X4G A;  1AU7 A;  2BJC A;  2AW6 A;  2IVB A;  1RPE L;  3GBF A;  1UXC A;  3KJX A;  1SQ8 A;  1JFT A;  1LMB 3;  3FMY A;  3BS3 A;  3B7H A;  4J1X A;  1WH6 A;  2AXZ A;  4JCY A;  1WH8 A;  2MEZ A;  2LYR A;  4Z5C A;  1JWL A;  4IVZ A;  1RIO A;  1QQB A;  4FBI A;  4IA8 A;  2XI8 A;  4YAR A;  1LCC A;  1EFA A;  1QP4 A;  1ADR A;  2GRL A;  3L1P A;  3LIS A;  1LQC A;  2B5A A;  1X57 A;  3QF3 A;  3TRB A;  2PUE A;  2GZU A;  3KZ3 A;  3BD1 A;  4PU4 C;  2CRO A;  2MQK A;  2JCG A;  2KPJ A;  2PIJ A;  4GQM A;  3U3W A;  1RZR A;  1ZVV A;  2PUD A;  1PER L;  1POU A;  4I6U A;  3OP9 A;  4GHJ A;  2GRM A;  4I6T A;  1R69 A;  3JXC L;  3OQO A;  1PNR A;  4X4H A;  2PUF A;  3GN5 B;  2IVG A;  5A7L A;  4YG4 A;  4PU3 C;  2KZ8 A;  2EWT A;  2XCJ A;  1NER A;  3PXP A;  4NDW A;  3ZHI A;  4X4B A;  1O4X A;  2H8R A;  2LYQ A;  2ICT A;  4YG1 A;  1UTX A;  3RZZ A;  1RZS A;  2LCV A;  1LLI A;  4Z59 A;  1X2L A;  4PU8 A;  1WIZ A;  3DNV B;  4X4I A;  2PUA A;  2PE5 A;  1ZZ8 A;  3H5T A;  1RZR D;  3HZI B;  1QP7 A;  3JXB C;  1E3O C;  2BNN A;  2CSF A;  2L49 A;  4I6R A;  1LCD A;  4OB4 A;  2KEI A;  3FYM A;  4O8B A;  4X4D A;  2LYP A;  1ZZ6 A;  1IC8 A;  2PUG A;  2XIU A;  3FYA A;  1ZS4 A;  1ZUG A;  3SCF A;  1GT0 C;  3G5G A;  2WIU B;  1NEQ A;  1ZZ7 A;  4YG7 B;  1PRA A;  2XSD C;  3O9X A;  4JCX A;  2OR1 L;  2LYJ A;  4I8T A;  2R1J L;  4MCX A;  3D1N I;  1JH9 A;  2KEJ A;  1L1M A;  2BNO A;  3ZHM A;  3MLF A;  1OSL A;  4FN3 A;  1ZZC A;  4J1W A;  1QP0 A;  1WET A;  1JFS A;  2LYL A;  1XWR A;  1UXD A;  2AWI A;  3QWG A;  1BDI A;  3GN5 A;  3JXD L;  3F51 A;  2D5V A;  2O4A A;  1S7E A;  2BNM A;  3F52 A;  1ZPQ A;  3QQ6 A;  1YSE A;  3OMT A;  3UFD A;  1PRU A;  3ZKC A;  2AXU A;  2JVL A;  4F8D A;  4Y42 A;  3R1F A;  4Z5H A;  1ZAY A;  1CQT A;  3G7D A;  4PU7 A;  2EF8 A;  2A6C A;  2R63 A;  2PUC A;  2LYK A;  4JQD A;  2LYS A;  1Y9Q A;  2XJ3 A;  3CEC A;  3SCG A;  3LFP A;  4X4F A;  2AXV A;  2HSG A;  2O49 A;  3SCH A;  4Z5D A;  1DW9 A;  1PRV A;  2AUW A;  3KXA A;  3OQN A;  3QYX A;  2IVQ A;  2L8N A;  1ZZ9 A;  2HIN A;  2O38 A;  1Y7Y A;  4YBA A;  1ZZB A;  2OFY A;  5K98 B;  4X4E A;  3VK0 A;  2EBY A;  2IV1 A;  3CLC A;  3OQM A;  4X4C A;  1OCT C;  4MCT A;  1HF0 A;  3EUS A;  2PUB A;  1CJG A;  1QPZ A;  1B0N A;  3BDN A;  4Z58 A;  1DWK A;  3CRO L;  3F6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...