2LYQA

Noe-based 3d structure of the monomeric intermediate of cylr2 at 262k (-11 celsius degrees)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cold denaturation of a protein dimer monitored at atomic resolution.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Dna binding protein
molecule keywords CylR2
total genus 17
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2lyqA00
4YG7B 2ICPA 1LMB3 4X4IA 2HINA 3OQNA 3SCHA 2R1JL 3QYXA 1OSLA 1LCCA 1ZUGA 3D1NI 4O8BA 1PERL 3CROL 1LQCA 2B5AA 2LYJA 2PUAA 3UFDA 4JQDA 3ZHIA 3EUSA 3U3WA 1L1MA 1PNRA 1ZAYA 4Z59A 3JXCL 3B7HA 2IVQA 4I8TA 1JH9A 2AXZA 1WIZA 1ZZ9A 2JVLA 2CROA 3OP9A 3ZHMA 4MCTA 4X4GA 2IV1A 1S7EA 2LCVA 3F51A 4X4DA 1ADRA 1RIOA 2IVBA 3BDNA 3JXBC 1LLIA 3G5GA 2EBYA 1BDHA 2AWIA 4GQMA 4X4HA 2PUEA 1ZS4A 1DWKA 3JXDL 3LFPA 2HSGA 2R63A 2GZUA 3CECA 1DW9A 2XCJA 1QQAA 1ZPQA 3G7DA 3BD1A 1X2LA 1RZSA 2H8RA 1Y9QA 3QF3A 4Z5HA 1NEQA 2MEZA 2EF8A 1ZZ7A 4YG1A 1QP7A 2PIJA 1VPWA 1IC8A 1OCTC 1Y7YA 2PUDA 2KZ8A 4OB4A 1JFSA 2ICTA 3KXAA 2IU7A 3IVPA 1PRVA 2D5VA 3TRBA 3GN5B 3HZIB 2O38A 4MCXA 1X57A 2CSFA 2EWTA 1R69A 4PU4C 4Z5CA 4X4EA 2AXUA 2PPXA 3KZ3A 4Y42A 2XJ3A 2PUBA 1WH8A 4IA8A 4J1XA 3S8QA 3FMYA 1B0NA 3FYMA 2XIUA 4FBIA 4YG4A 1PRUA 4I6TA 2BJCA 1JWLA 4PU3C 3LISA 2WUSR 2OR1L 4I6RA 1BDIA 1UTXA 2KEKA 1ZZBA 2BNMA 3PXPA 1XWRA 4X4BA 2LYPA 3OQOA 2KEIA 2FJRA 1ZZCA 2L49A 3F52A 4X4FA 4X4CA 4IWRA 2PE5A 1AU7A 3MLFA 3H5TA 1QP0A 2XI8A 4PU7A 1E3OC 3VK0A 2KPJA 1NERA 2IUOA 2WIUB 3QWGA 4FN3A 3L1PA 4GHJA 2PUCA 3GBFA 1WETA 2AUWA 4JCYA 3R1FA 2BNOA 2O49A 2AW6A 1CQTA 3F6WA 4Z5DA 2IVGA 1SQ8A 2LYKA 2KEJA 1LCDA 1UXCA 1YSEA 3FYAA 2A6CA 1RPEL 3CLCA 2XSDC 1O4XA 2OFYA 1JFTA 4NDWA 1QP4A 1RZRD 2BNNA 4IVZA 3QQ6A 3ZKCA 2GRMA 2LYQA 3OQMA 3DNVB 4YBAA 2LYLA 3GN5A 2PUGA 3BS3A 2L8NA 3OMTA 1WH6A 5K98B 1ZZ8A 2MQKA 2AXVA 1QPZA 4F8DA 2JCGA 3SCGA 1POUA 4JCXA 1RZRA 1R63A 2PUFA 1PRAA 4I6UA 1QQBA 4Z58A 1CJGA 1ZVVA 4YARA 1HF0A 1ZZ6A 1UXDA 2O4AA 2LYRA 1GT0C 4PU8A 3SCFA 2LYSA 3KJXA 4J1WA 1EFAA 2GRLA 3O9XA 5A7LA 3RZZA
chains in the Genus database with same CATH superfamily
4ER7A 4YG7B 1LMB3 3QOWA 2R1JL 1LCCA 1OSLA 4O8BA 2HCSA 4Q2JA 2LYJA 2PUAA 3UFDA 1U2ZA 3QFIA 4I8TA 2JVLA 3G0TA 4MCTA 2IV1A 1S7EA 1RIOA 3BDNA 5DTQA 4X4HA 3LFPA 3G7DA 3BD1A 4EKGA 1X2LA 1RZSA 4Z5HA 3MEJA 2MEZA 2EF8A 1QP7A 1IC8A 1OCTC 1Y7YA 2PUDA 2KZ8A 4OB4A 2ICTA 3IVPA 1PRVA 4MCXA 2EWTA 4PU4C 1R69A 4Z5CA 1NW3A 3KZ3A 3DM5A 2PUBA 3FMYA 1B0NA 2BJCA 2XIUA 1PRUA 4PU3C 1QZXA 3NDBB 2KEKA 3PXPA 1XWRA 2YBDA 4IWRA 5DT2A 5JUWA 3VK0A 5DTRA 3QWGA 3A9XA 1WETA 2AUWA 3F6WA 4DE8A 4Z5DA 2IVGA 1SQ8A 1LCDA 1UXCA 1YSEA 2MXDA 3ZKCA 3QQ6A 2LYQA 4YBAA 2PUGA 1QPZA 2LLVA 4Z58A 1CJGA 2O4AA 1GT0C 2LLWA 3KJXA 4HRAA 3RZZA 2HINA 3SCHA 1ZUGA 3CROL 1LQCA 3UWPA 2PXUA 4JQDA 2XXPA 3EUSA 3U3WA 4DE9A 3JXCL 1JH9A 3R09A 3OP9A 3F51A 2FFHA 3G5GA 1BDHA 2PXEA 2HFZA 5DSXA 2PXBA 2PUEA 1ZS4A 1DWKA 3JXDL 2HSGA 2R63A 3GUUA 1DW9A 1ZPQA 2VEOA 2H8RA 3QF3A 1NEQA 2PXKA 3KXAA 2IU7A 3TRBA 2O38A 3GZCA 2PXVA 4Y42A 2XJ3A 3OKZA 4FBIA 3FYMA 4YG4A 4I6TA 3LISA 2WUSR 4I6RA 2PXTA 2LYPA 2KEIA 1ZZCA 2L49A 4X4CA 2XI8A 2WIUB 4FN3A 3TEPA 2AW6A 4ER5A 2KEJA 4EKIA 2LYKA 3CLCA 3FYAA 1JFTA 4NDWA 2BNNA 1QB2A 2XXQA 3TFLA 5DRTA 2PXDA 2L8NA 2AXVA 4F8DA 2JCGA 3SCGA 3NROA 1POUA 5DRYA 1ZVVA 1ZZ6A 2PXQA 2LYRA 4OBMA 3O9XA 3TELA 5GAHi 2L1PA 2ICPA 4ER3A 2B5AA 3KL4A 4Z59A 3B7HA 2AXZA 1ZZ9A 5GAGi 2LCVA 4X4DA 2IVBA 3JXBC 1LLIA 4GQMA 3GZDC 2XCJA 3SX0A 1Y9QA 2HCNA 3A9YA 1VPWA 2PXPA 3NXHA 2D5VA 3HZIB 1X57A 4X4EA 4IA8A 4J1XA 2OR1L 1JWLA 1BDIA 1UTXA 1ZZBA 4X4BA 3F52A 2PE5A 3H5TA 4ER0A 1QP0A 3GZDA 3GBFA 3QOXA 2BNOA 3R1FA 2O49A 1CQTA 4EQZA 4ER6A 2PXFA 2XSDC 1O4XA 2OFYA 1QP4A 3NZLA 2GRMA 3BS3A 2PXLA 3OMTA 1WH6A 1RZRA 1R63A 1PRAA 3M9LA 2J7UA 4I6UA 1QQBA 1HF0A 1UXDA 4WVLA 2J7WA 3SCFA 1EFAA 5A7LA 3OQOA 4X4IA 3OQNA 2JQEA 3QYXA 3D1NI 1PERL 3ME5A 2V3CC 3ZHIA 1DULA 1L1MA 1PNRA 1ZAYA 2IVQA 1WIZA 3ZHMA 2CROA 4X4GA 1MFQC 1ADRA 1HQ1A 2EBYA 2AWIA 5DTMA 3ZPXA 2GZUA 3CECA 1QQAA 4EZIA 3A9ZA 4YG1A 1ZZ7A 2PIJA 1JFSA 3OWQA 3GN5B 2CSFA 2AXUA 2PPXA 1WH8A 3S8QA 2BNMA 2FJRA 4X4FA 3PE5A 1AU7A 3MLFA 2M4HA 4PU7A 1E3OC 2KPJA 1NERA 3LQXA 2IUOA 3L1PA 2PUCA 4GHJA 4JCYA 2ODRD 1RPEL 2A6CA 3SR4A 1RZRD 4IVZA 3OQMA 3DNVB 2LNMA 2LYLA 3GN5A 3VWSA 5K98B 1ZZ8A 2MQKA 4JCXA 2PUFA 4YARA 4EK9A 4PU8A 2XXAA 2LYSA 4J1WA 2GRLA
chains in the Genus database with same CATH topology
4YG7B 2ICPA 1LMB3 4X4IA 2HINA 3OQNA 3SCHA 2R1JL 3QYXA 1OSLA 1LCCA 1ZUGA 3D1NI 4O8BA 1PERL 3CROL 1LQCA 2B5AA 2LYJA 2PUAA 3UFDA 4JQDA 3ZHIA 3EUSA 3U3WA 1L1MA 1PNRA 1ZAYA 4Z59A 3JXCL 3B7HA 2IVQA 4I8TA 1JH9A 2AXZA 1WIZA 1ZZ9A 2JVLA 2CROA 3OP9A 3ZHMA 4MCTA 4X4GA 2IV1A 1S7EA 2LCVA 3F51A 4X4DA 1ADRA 1RIOA 2IVBA 3BDNA 3JXBC 1LLIA 3G5GA 2EBYA 1BDHA 2AWIA 4GQMA 4X4HA 2PUEA 1ZS4A 1DWKA 3JXDL 3LFPA 2HSGA 2R63A 2GZUA 3CECA 1DW9A 2XCJA 1QQAA 1ZPQA 3G7DA 3BD1A 1X2LA 1RZSA 2H8RA 1Y9QA 3QF3A 4Z5HA 1NEQA 2MEZA 2EF8A 1ZZ7A 4YG1A 1QP7A 2PIJA 1VPWA 1IC8A 1OCTC 1Y7YA 2PUDA 2KZ8A 4OB4A 1JFSA 2ICTA 3KXAA 2IU7A 3IVPA 1PRVA 2D5VA 3TRBA 3GN5B 3HZIB 2O38A 4MCXA 1X57A 2CSFA 2EWTA 1R69A 4PU4C 4Z5CA 4X4EA 2AXUA 2PPXA 3KZ3A 4Y42A 2XJ3A 2PUBA 1WH8A 4IA8A 4J1XA 3S8QA 3FMYA 1B0NA 3FYMA 2XIUA 4FBIA 4YG4A 1PRUA 4I6TA 2BJCA 1JWLA 4PU3C 3LISA 2WUSR 2OR1L 4I6RA 1BDIA 1UTXA 2KEKA 1ZZBA 2BNMA 3PXPA 1XWRA 4X4BA 2LYPA 3OQOA 2KEIA 2FJRA 1ZZCA 2L49A 3F52A 4X4FA 4X4CA 4IWRA 2PE5A 1AU7A 3MLFA 3H5TA 1QP0A 2XI8A 4PU7A 1E3OC 3VK0A 2KPJA 1NERA 2IUOA 2WIUB 3QWGA 4FN3A 3L1PA 4GHJA 2PUCA 3GBFA 1WETA 2AUWA 4JCYA 3R1FA 2BNOA 2O49A 2AW6A 1CQTA 3F6WA 4Z5DA 2IVGA 1SQ8A 2LYKA 2KEJA 1LCDA 1UXCA 1YSEA 3FYAA 2A6CA 1RPEL 3CLCA 2XSDC 1O4XA 2OFYA 1JFTA 4NDWA 1QP4A 1RZRD 2BNNA 4IVZA 3QQ6A 3ZKCA 2GRMA 2LYQA 3OQMA 3DNVB 4YBAA 2LYLA 3GN5A 2PUGA 3BS3A 2L8NA 3OMTA 1WH6A 5K98B 1ZZ8A 2MQKA 2AXVA 1QPZA 4F8DA 2JCGA 3SCGA 1POUA 4JCXA 1RZRA 1R63A 2PUFA 1PRAA 4I6UA 1QQBA 4Z58A 1CJGA 1ZVVA 4YARA 1HF0A 1ZZ6A 1UXDA 2O4AA 2LYRA 1GT0C 4PU8A 3SCFA 2LYSA 3KJXA 4J1WA 1EFAA 2GRLA 3O9XA 5A7LA 3RZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YG7 B;  2ICP A;  1LMB 3;  4X4I A;  2HIN A;  3OQN A;  3SCH A;  2R1J L;  3QYX A;  1OSL A;  1LCC A;  1ZUG A;  3D1N I;  4O8B A;  1PER L;  3CRO L;  1LQC A;  2B5A A;  2LYJ A;  2PUA A;  3UFD A;  4JQD A;  3ZHI A;  3EUS A;  3U3W A;  1L1M A;  1PNR A;  1ZAY A;  4Z59 A;  3JXC L;  3B7H A;  2IVQ A;  4I8T A;  1JH9 A;  2AXZ A;  1WIZ A;  1ZZ9 A;  2JVL A;  2CRO A;  3OP9 A;  3ZHM A;  4MCT A;  4X4G A;  2IV1 A;  1S7E A;  2LCV A;  3F51 A;  4X4D A;  1ADR A;  1RIO A;  2IVB A;  3BDN A;  3JXB C;  1LLI A;  3G5G A;  2EBY A;  1BDH A;  2AWI A;  4GQM A;  4X4H A;  2PUE A;  1ZS4 A;  1DWK A;  3JXD L;  3LFP A;  2HSG A;  2R63 A;  2GZU A;  3CEC A;  1DW9 A;  2XCJ A;  1QQA A;  1ZPQ A;  3G7D A;  3BD1 A;  1X2L A;  1RZS A;  2H8R A;  1Y9Q A;  3QF3 A;  4Z5H A;  1NEQ A;  2MEZ A;  2EF8 A;  1ZZ7 A;  4YG1 A;  1QP7 A;  2PIJ A;  1VPW A;  1IC8 A;  1OCT C;  1Y7Y A;  2PUD A;  2KZ8 A;  4OB4 A;  1JFS A;  2ICT A;  3KXA A;  2IU7 A;  3IVP A;  1PRV A;  2D5V A;  3TRB A;  3GN5 B;  3HZI B;  2O38 A;  4MCX A;  1X57 A;  2CSF A;  2EWT A;  1R69 A;  4PU4 C;  4Z5C A;  4X4E A;  2AXU A;  2PPX A;  3KZ3 A;  4Y42 A;  2XJ3 A;  2PUB A;  1WH8 A;  4IA8 A;  4J1X A;  3S8Q A;  3FMY A;  1B0N A;  3FYM A;  2XIU A;  4FBI A;  4YG4 A;  1PRU A;  4I6T A;  2BJC A;  1JWL A;  4PU3 C;  3LIS A;  2WUS R;  2OR1 L;  4I6R A;  1BDI A;  1UTX A;  2KEK A;  1ZZB A;  2BNM A;  3PXP A;  1XWR A;  4X4B A;  2LYP A;  3OQO A;  2KEI A;  2FJR A;  1ZZC A;  2L49 A;  3F52 A;  4X4F A;  4X4C A;  4IWR A;  2PE5 A;  1AU7 A;  3MLF A;  3H5T A;  1QP0 A;  2XI8 A;  4PU7 A;  1E3O C;  3VK0 A;  2KPJ A;  1NER A;  2IUO A;  2WIU B;  3QWG A;  4FN3 A;  3L1P A;  4GHJ A;  2PUC A;  3GBF A;  1WET A;  2AUW A;  4JCY A;  3R1F A;  2BNO A;  2O49 A;  2AW6 A;  1CQT A;  3F6W A;  4Z5D A;  2IVG A;  1SQ8 A;  2LYK A;  2KEJ A;  1LCD A;  1UXC A;  1YSE A;  3FYA A;  2A6C A;  1RPE L;  3CLC A;  2XSD C;  1O4X A;  2OFY A;  1JFT A;  4NDW A;  1QP4 A;  1RZR D;  2BNN A;  4IVZ A;  3QQ6 A;  3ZKC A;  2GRM A;  2LYQ A;  3OQM A;  3DNV B;  4YBA A;  2LYL A;  3GN5 A;  2PUG A;  3BS3 A;  2L8N A;  3OMT A;  1WH6 A;  5K98 B;  1ZZ8 A;  2MQK A;  2AXV A;  1QPZ A;  4F8D A;  2JCG A;  3SCG A;  1POU A;  4JCX A;  1RZR A;  1R63 A;  2PUF A;  1PRA A;  4I6U A;  1QQB A;  4Z58 A;  1CJG A;  1ZVV A;  4YAR A;  1HF0 A;  1ZZ6 A;  1UXD A;  2O4A A;  2LYR A;  1GT0 C;  4PU8 A;  3SCF A;  2LYS A;  3KJX A;  4J1W A;  1EFA A;  2GRL A;  3O9X A;  5A7L A;  3RZZ A; 
#chains in the Genus database with same CATH topology
 4ER7 A;  4YG7 B;  1LMB 3;  3QOW A;  2R1J L;  1LCC A;  1OSL A;  4O8B A;  2HCS A;  4Q2J A;  2LYJ A;  2PUA A;  3UFD A;  1U2Z A;  3QFI A;  4I8T A;  2JVL A;  3G0T A;  4MCT A;  2IV1 A;  1S7E A;  1RIO A;  3BDN A;  5DTQ A;  4X4H A;  3LFP A;  3G7D A;  3BD1 A;  4EKG A;  1X2L A;  1RZS A;  4Z5H A;  3MEJ A;  2MEZ A;  2EF8 A;  1QP7 A;  1IC8 A;  1OCT C;  1Y7Y A;  2PUD A;  2KZ8 A;  4OB4 A;  2ICT A;  3IVP A;  1PRV A;  4MCX A;  2EWT A;  4PU4 C;  1R69 A;  4Z5C A;  1NW3 A;  3KZ3 A;  3DM5 A;  2PUB A;  3FMY A;  1B0N A;  2BJC A;  2XIU A;  1PRU A;  4PU3 C;  1QZX A;  3NDB B;  2KEK A;  3PXP A;  1XWR A;  2YBD A;  4IWR A;  5DT2 A;  5JUW A;  3VK0 A;  5DTR A;  3QWG A;  3A9X A;  1WET A;  2AUW A;  3F6W A;  4DE8 A;  4Z5D A;  2IVG A;  1SQ8 A;  1LCD A;  1UXC A;  1YSE A;  2MXD A;  3ZKC A;  3QQ6 A;  2LYQ A;  4YBA A;  2PUG A;  1QPZ A;  2LLV A;  4Z58 A;  1CJG A;  2O4A A;  1GT0 C;  2LLW A;  3KJX A;  4HRA A;  3RZZ A;  2HIN A;  3SCH A;  1ZUG A;  3CRO L;  1LQC A;  3UWP A;  2PXU A;  4JQD A;  2XXP A;  3EUS A;  3U3W A;  4DE9 A;  3JXC L;  1JH9 A;  3R09 A;  3OP9 A;  3F51 A;  2FFH A;  3G5G A;  1BDH A;  2PXE A;  2HFZ A;  5DSX A;  2PXB A;  2PUE A;  1ZS4 A;  1DWK A;  3JXD L;  2HSG A;  2R63 A;  3GUU A;  1DW9 A;  1ZPQ A;  2VEO A;  2H8R A;  3QF3 A;  1NEQ A;  2PXK A;  3KXA A;  2IU7 A;  3TRB A;  2O38 A;  3GZC A;  2PXV A;  4Y42 A;  2XJ3 A;  3OKZ A;  4FBI A;  3FYM A;  4YG4 A;  4I6T A;  3LIS A;  2WUS R;  4I6R A;  2PXT A;  2LYP A;  2KEI A;  1ZZC A;  2L49 A;  4X4C A;  2XI8 A;  2WIU B;  4FN3 A;  3TEP A;  2AW6 A;  4ER5 A;  2KEJ A;  4EKI A;  2LYK A;  3CLC A;  3FYA A;  1JFT A;  4NDW A;  2BNN A;  1QB2 A;  2XXQ A;  3TFL A;  5DRT A;  2PXD A;  2L8N A;  2AXV A;  4F8D A;  2JCG A;  3SCG A;  3NRO A;  1POU A;  5DRY A;  1ZVV A;  1ZZ6 A;  2PXQ A;  2LYR A;  4OBM A;  3O9X A;  3TEL A;  5GAH i;  2L1P A;  2ICP A;  4ER3 A;  2B5A A;  3KL4 A;  4Z59 A;  3B7H A;  2AXZ A;  1ZZ9 A;  5GAG i;  2LCV A;  4X4D A;  2IVB A;  3JXB C;  1LLI A;  4GQM A;  3GZD C;  2XCJ A;  3SX0 A;  1Y9Q A;  2HCN A;  3A9Y A;  1VPW A;  2PXP A;  3NXH A;  2D5V A;  3HZI B;  1X57 A;  4X4E A;  4IA8 A;  4J1X A;  2OR1 L;  1JWL A;  1BDI A;  1UTX A;  1ZZB A;  4X4B A;  3F52 A;  2PE5 A;  3H5T A;  4ER0 A;  1QP0 A;  3GZD A;  3GBF A;  3QOX A;  2BNO A;  3R1F A;  2O49 A;  1CQT A;  4EQZ A;  4ER6 A;  2PXF A;  2XSD C;  1O4X A;  2OFY A;  1QP4 A;  3NZL A;  2GRM A;  3BS3 A;  2PXL A;  3OMT A;  1WH6 A;  1RZR A;  1R63 A;  1PRA A;  3M9L A;  2J7U A;  4I6U A;  1QQB A;  1HF0 A;  1UXD A;  4WVL A;  2J7W A;  3SCF A;  1EFA A;  5A7L A;  3OQO A;  4X4I A;  3OQN A;  2JQE A;  3QYX A;  3D1N I;  1PER L;  3ME5 A;  2V3C C;  3ZHI A;  1DUL A;  1L1M A;  1PNR A;  1ZAY A;  2IVQ A;  1WIZ A;  3ZHM A;  2CRO A;  4X4G A;  1MFQ C;  1ADR A;  1HQ1 A;  2EBY A;  2AWI A;  5DTM A;  3ZPX A;  2GZU A;  3CEC A;  1QQA A;  4EZI A;  3A9Z A;  4YG1 A;  1ZZ7 A;  2PIJ A;  1JFS A;  3OWQ A;  3GN5 B;  2CSF A;  2AXU A;  2PPX A;  1WH8 A;  3S8Q A;  2BNM A;  2FJR A;  4X4F A;  3PE5 A;  1AU7 A;  3MLF A;  2M4H A;  4PU7 A;  1E3O C;  2KPJ A;  1NER A;  3LQX A;  2IUO A;  3L1P A;  2PUC A;  4GHJ A;  4JCY A;  2ODR D;  1RPE L;  2A6C A;  3SR4 A;  1RZR D;  4IVZ A;  3OQM A;  3DNV B;  2LNM A;  2LYL A;  3GN5 A;  3VWS A;  5K98 B;  1ZZ8 A;  2MQK A;  4JCX A;  2PUF A;  4YAR A;  4EK9 A;  4PU8 A;  2XXA A;  2LYS A;  4J1W A;  2GRL A; 
#chains in the Genus database with same CATH homology
 4YG7 B;  2ICP A;  1LMB 3;  4X4I A;  2HIN A;  3OQN A;  3SCH A;  2R1J L;  3QYX A;  1OSL A;  1LCC A;  1ZUG A;  3D1N I;  4O8B A;  1PER L;  3CRO L;  1LQC A;  2B5A A;  2LYJ A;  2PUA A;  3UFD A;  4JQD A;  3ZHI A;  3EUS A;  3U3W A;  1L1M A;  1PNR A;  1ZAY A;  4Z59 A;  3JXC L;  3B7H A;  2IVQ A;  4I8T A;  1JH9 A;  2AXZ A;  1WIZ A;  1ZZ9 A;  2JVL A;  2CRO A;  3OP9 A;  3ZHM A;  4MCT A;  4X4G A;  2IV1 A;  1S7E A;  2LCV A;  3F51 A;  4X4D A;  1ADR A;  1RIO A;  2IVB A;  3BDN A;  3JXB C;  1LLI A;  3G5G A;  2EBY A;  1BDH A;  2AWI A;  4GQM A;  4X4H A;  2PUE A;  1ZS4 A;  1DWK A;  3JXD L;  3LFP A;  2HSG A;  2R63 A;  2GZU A;  3CEC A;  1DW9 A;  2XCJ A;  1QQA A;  1ZPQ A;  3G7D A;  3BD1 A;  1X2L A;  1RZS A;  2H8R A;  1Y9Q A;  3QF3 A;  4Z5H A;  1NEQ A;  2MEZ A;  2EF8 A;  1ZZ7 A;  4YG1 A;  1QP7 A;  2PIJ A;  1VPW A;  1IC8 A;  1OCT C;  1Y7Y A;  2PUD A;  2KZ8 A;  4OB4 A;  1JFS A;  2ICT A;  3KXA A;  2IU7 A;  3IVP A;  1PRV A;  2D5V A;  3TRB A;  3GN5 B;  3HZI B;  2O38 A;  4MCX A;  1X57 A;  2CSF A;  2EWT A;  1R69 A;  4PU4 C;  4Z5C A;  4X4E A;  2AXU A;  2PPX A;  3KZ3 A;  4Y42 A;  2XJ3 A;  2PUB A;  1WH8 A;  4IA8 A;  4J1X A;  3S8Q A;  3FMY A;  1B0N A;  3FYM A;  2XIU A;  4FBI A;  4YG4 A;  1PRU A;  4I6T A;  2BJC A;  1JWL A;  4PU3 C;  3LIS A;  2WUS R;  2OR1 L;  4I6R A;  1BDI A;  1UTX A;  2KEK A;  1ZZB A;  2BNM A;  3PXP A;  1XWR A;  4X4B A;  2LYP A;  3OQO A;  2KEI A;  2FJR A;  1ZZC A;  2L49 A;  3F52 A;  4X4F A;  4X4C A;  4IWR A;  2PE5 A;  1AU7 A;  3MLF A;  3H5T A;  1QP0 A;  2XI8 A;  4PU7 A;  1E3O C;  3VK0 A;  2KPJ A;  1NER A;  2IUO A;  2WIU B;  3QWG A;  4FN3 A;  3L1P A;  4GHJ A;  2PUC A;  3GBF A;  1WET A;  2AUW A;  4JCY A;  3R1F A;  2BNO A;  2O49 A;  2AW6 A;  1CQT A;  3F6W A;  4Z5D A;  2IVG A;  1SQ8 A;  2LYK A;  2KEJ A;  1LCD A;  1UXC A;  1YSE A;  3FYA A;  2A6C A;  1RPE L;  3CLC A;  2XSD C;  1O4X A;  2OFY A;  1JFT A;  4NDW A;  1QP4 A;  1RZR D;  2BNN A;  4IVZ A;  3QQ6 A;  3ZKC A;  2GRM A;  2LYQ A;  3OQM A;  3DNV B;  4YBA A;  2LYL A;  3GN5 A;  2PUG A;  3BS3 A;  2L8N A;  3OMT A;  1WH6 A;  5K98 B;  1ZZ8 A;  2MQK A;  2AXV A;  1QPZ A;  4F8D A;  2JCG A;  3SCG A;  1POU A;  4JCX A;  1RZR A;  1R63 A;  2PUF A;  1PRA A;  4I6U A;  1QQB A;  4Z58 A;  1CJG A;  1ZVV A;  4YAR A;  1HF0 A;  1ZZ6 A;  1UXD A;  2O4A A;  2LYR A;  1GT0 C;  4PU8 A;  3SCF A;  2LYS A;  3KJX A;  4J1W A;  1EFA A;  2GRL A;  3O9X A;  5A7L A;  3RZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...