2LYRA

Noe-based 3d structure of the monomeric partially-folded intermediate of cylr2 at 259k (-14 celsius degrees)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cold denaturation of a protein dimer monitored at atomic resolution.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Dna binding protein
molecule keywords CylR2
total genus 17
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2lyrA00
1ZVVA 2BNOA 1RZRD 4YG1A 2MQKA 3LFPA 2A6CA 4J1WA 1X2LA 2AXVA 2PIJA 4YG4A 2PUDA 1DW9A 4PU8A 5K98B 1PRVA 3KXAA 2AW6A 3TRBA 1L1MA 1ZZ9A 2ICTA 1E3OC 1LMB3 2JVLA 2LYPA 1NERA 1QP0A 3SCFA 2O4AA 2LYLA 4YARA 1RZRA 1WETA 3B7HA 3BD1A 3QF3A 1CQTA 3F52A 3OQOA 2O38A 3QQ6A 4MCTA 3MLFA 4GHJA 1DWKA 4Z5CA 3JXBC 1JH9A 4JQDA 1X57A 2PUFA 2BNMA 4PU7A 2GZUA 1QQAA 4FN3A 2LYKA 3CLCA 4JCYA 3FMYA 4X4GA 3D1NI 2XJ3A 2HINA 4YG7B 2O49A 4MCXA 2PUCA 4I6UA 2PE5A 1CJGA 1ZZCA 3ZHMA 1WH8A 2MEZA 3QWGA 3UFDA 1POUA 1RZSA 3KZ3A 4IVZA 4X4EA 2IV1A 1PNRA 1VPWA 2PUGA 2PPXA 2EF8A 1ZZ8A 2IVQA 3BDNA 3IVPA 2L8NA 3PXPA 2HSGA 3O9XA 1JFTA 2R1JL 1ADRA 1XWRA 2XIUA 3S8QA 5A7LA 2WIUB 3G5GA 3OQMA 1PRAA 4I6RA 1IC8A 4I6TA 4X4FA 2KEKA 4PU3C 3QYXA 4FBIA 2ICPA 1LCDA 4Z5HA 1O4XA 2PUBA 2LYRA 3GN5A 1ZUGA 4O8BA 1UTXA 3L1PA 1B0NA 3ZHIA 2KZ8A 2H8RA 4X4CA 3SCHA 2KEJA 1JFSA 3VK0A 4PU4C 3FYMA 3FYAA 1YSEA 3DNVB 1UXDA 4Y42A 3U3WA 4X4DA 2LYJA 1R69A 2AXUA 2D5VA 1LLIA 1QPZA 3LISA 1ZZ7A 3ZKCA 2JCGA 4X4HA 2PUAA 2PUEA 2IVBA 1LCCA 1RIOA 4NDWA 4Z58A 3R1FA 4Z59A 3G7DA 2AUWA 1ZS4A 2AXZA 2EBYA 2B5AA 1AU7A 2CROA 2IVGA 4I8TA 3BS3A 2FJRA 4IA8A 3GN5B 2BJCA 2GRLA 2CSFA 2WUSR 4X4IA 4J1XA 1QP4A 4Z5DA 1BDHA 3JXDL 2LCVA 3H5TA 1PRUA 3SCGA 1JWLA 1LQCA 2XCJA 1UXCA 3GBFA 3KJXA 1OSLA 1RPEL 1BDIA 4X4BA 1NEQA 3OQNA 1ZZ6A 1WIZA 2OFYA 4GQMA 2IUOA 2R63A 2EWTA 1OCTC 2BNNA 2XI8A 3JXCL 4YBAA 3F6WA 4F8DA 1S7EA 1PERL 4IWRA 1Y7YA 2L49A 3RZZA 1ZPQA 1HF0A 2OR1L 1ZZBA 1EFAA 3CECA 3F51A 3OMTA 2KEIA 1WH6A 1QQBA 2LYQA 4JCXA 1Y9QA 1QP7A 3EUSA 2GRMA 1SQ8A 4OB4A 3HZIB 1ZAYA 3OP9A 2KPJA 3CROL 1R63A 1GT0C 2XSDC 2IU7A 2AWIA 2LYSA
chains in the Genus database with same CATH superfamily
1ZVVA 2V3CC 2BNOA 3TFLA 4J1WA 5GAHi 2PUDA 1DW9A 3ZPXA 2ODRD 1L1MA 1NERA 2LYLA 3B7HA 3QF3A 2O38A 2XXQA 4DE8A 2PUFA 2GZUA 2LYKA 4JCYA 4YG7B 1CJGA 1RZSA 4X4EA 5DTMA 1ZZ8A 1U2ZA 2XIUA 5A7LA 3OQMA 4I6TA 4X4FA 4PU3C 2PUBA 2LYRA 3GUUA 3QOXA 2H8RA 4X4CA 3VK0A 3FYAA 3DNVB 4X4DA 5DTQA 2LLWA 4ER5A 3LISA 1QPZA 1ZZ7A 4X4HA 1LCCA 2LLVA 4Z59A 2AUWA 3KL4A 1AU7A 2CROA 4I8TA 2FJRA 2VEOA 2WUSR 2LCVA 3H5TA 1LQCA 4HRAA 1MFQC 3OQNA 3SR4A 3PE5A 3RZZA 1ZPQA 3DM5A 3OKZA 1Y9QA 3EUSA 4OB4A 1GT0C 2MXDA 3LFPA 2PXPA 3NXHA 2M4HA 1QB2A 2PIJA 4PU8A 1PRVA 3KXAA 2AW6A 1ZZ9A 1LMB3 2JVLA 2LYPA 2O4AA 4YARA 1RZRA 1WETA 5JUWA 3MLFA 4Z5CA 1X57A 2PXQA 2BNMA 1QQAA 3D1NI 4MCXA 3QOWA 3ZHMA 3QWGA 3GZCA 1VPWA 2PPXA 2EF8A 2IVQA 3BDNA 2HSGA 2R1JL 2WIUB 1PRAA 2JQEA 4OBMA 1O4XA 3L1PA 4O8BA 2KZ8A 2PXKA 3SCHA 2KEJA 1JFSA 3GZDA 4EQZA 3FYMA 1YSEA 2HCSA 1R69A 2D5VA 3ZKCA 2HCNA 2PUAA 1RIOA 4NDWA 3G7DA 2EBYA 2YBDA 2HFZA 1DULA 4IA8A 2BJCA 1BDHA 4EK9A 1OSLA 4DE9A 3NDBB 1BDIA 2FFHA 1NEQA 1ZZ6A 2OFYA 4GQMA 2L1PA 1OCTC 2BNNA 3JXCL 4YBAA 1PERL 1S7EA 2L49A 1ZZBA 1EFAA 3MEJA 3CECA 3OMTA 1WH6A 1QQBA 1ZAYA 4EKIA 3LQXA 2KPJA 3ME5A 1R63A 2IU7A 1RZRD 4YG1A 3A9ZA 2A6CA 1X2LA 2AXVA 3TRBA 4ER0A 1CQTA 3F52A 3GZDC 3QQ6A 4GHJA 4JQDA 4PU7A 4FN3A 4X4GA 3TELA 2PUCA 2PE5A 5DT2A 3KZ3A 3TEPA 3IVPA 2L8NA 1JFTA 2PXTA 3S8QA 3G5GA 4FBIA 4Z5HA 4EZIA 3GN5A 5DRTA 1UTXA 3ZHIA 4PU4C 3VWSA 1UXDA 4Y42A 3U3WA 2AXUA 2PXEA 4ER7A 4Z58A 3UWPA 2AXZA 4WVLA 3BS3A 3GN5B 4J1XA 1QP4A 1PRUA 1UXCA 1RPEL 3NZLA 4X4BA 1WIZA 1NW3A 2R63A 5DRYA 1Y7YA 3F51A 3G0TA 3NROA 2LYQA 4JCXA 1QP7A 3CROL 2GRMA 1SQ8A 3HZIB 3OP9A 2AWIA 3M9LA 4ER3A 4Q2JA 2MQKA 3A9XA 4YG4A 5K98B 2PXFA 2ICTA 1E3OC 1QP0A 3SCFA 2J7UA 3BD1A 3OQOA 4ER6A 4MCTA 1DWKA 3JXBC 1JH9A 2PXVA 3CLCA 3FMYA 2XJ3A 2HINA 2O49A 2PXBA 4I6UA 1ZZCA 3A9YA 1WH8A 2MEZA 3UFDA 1QZXA 1POUA 4IVZA 2IV1A 2XXPA 1HQ1A 1PNRA 2PUGA 3PXPA 3O9XA 1ADRA 1XWRA 4I6RA 1IC8A 3QYXA 2KEKA 5DSXA 2ICPA 1LCDA 1ZUGA 1B0NA 2PXLA 2XXAA 3SX0A 2PXUA 2J7WA 2LYJA 1LLIA 5GAGi 2JCGA 2PUEA 2IVBA 3R1FA 1ZS4A 2B5AA 4EKGA 2IVGA 3QFIA 2GRLA 2CSFA 4X4IA 4Z5DA 3JXDL 1JWLA 3SCGA 2XCJA 3GBFA 3KJXA 5DTRA 2LNMA 2IUOA 2EWTA 2XI8A 3F6WA 4F8DA 4IWRA 3R09A 1HF0A 2OR1L 2KEIA 3OWQA 2XSDC 2LYSA 2PXDA
chains in the Genus database with same CATH topology
1ZVVA 2BNOA 1RZRD 4YG1A 2MQKA 3LFPA 2A6CA 4J1WA 1X2LA 2AXVA 2PIJA 4YG4A 2PUDA 1DW9A 4PU8A 5K98B 1PRVA 3KXAA 2AW6A 3TRBA 1L1MA 1ZZ9A 2ICTA 1E3OC 1LMB3 2JVLA 2LYPA 1NERA 1QP0A 3SCFA 2O4AA 2LYLA 4YARA 1RZRA 1WETA 3B7HA 3BD1A 3QF3A 1CQTA 3F52A 3OQOA 2O38A 3QQ6A 4MCTA 3MLFA 4GHJA 1DWKA 4Z5CA 3JXBC 1JH9A 4JQDA 1X57A 2PUFA 2BNMA 4PU7A 2GZUA 1QQAA 4FN3A 2LYKA 3CLCA 4JCYA 3FMYA 4X4GA 3D1NI 2XJ3A 2HINA 4YG7B 2O49A 4MCXA 2PUCA 4I6UA 2PE5A 1CJGA 1ZZCA 3ZHMA 1WH8A 2MEZA 3QWGA 3UFDA 1POUA 1RZSA 3KZ3A 4IVZA 4X4EA 2IV1A 1PNRA 1VPWA 2PUGA 2PPXA 2EF8A 1ZZ8A 2IVQA 3BDNA 3IVPA 2L8NA 3PXPA 2HSGA 3O9XA 1JFTA 2R1JL 1ADRA 1XWRA 2XIUA 3S8QA 5A7LA 2WIUB 3G5GA 3OQMA 1PRAA 4I6RA 1IC8A 4I6TA 4X4FA 2KEKA 4PU3C 3QYXA 4FBIA 2ICPA 1LCDA 4Z5HA 1O4XA 2PUBA 2LYRA 3GN5A 1ZUGA 4O8BA 1UTXA 3L1PA 1B0NA 3ZHIA 2KZ8A 2H8RA 4X4CA 3SCHA 2KEJA 1JFSA 3VK0A 4PU4C 3FYMA 3FYAA 1YSEA 3DNVB 1UXDA 4Y42A 3U3WA 4X4DA 2LYJA 1R69A 2AXUA 2D5VA 1LLIA 1QPZA 3LISA 1ZZ7A 3ZKCA 2JCGA 4X4HA 2PUAA 2PUEA 2IVBA 1LCCA 1RIOA 4NDWA 4Z58A 3R1FA 4Z59A 3G7DA 2AUWA 1ZS4A 2AXZA 2EBYA 2B5AA 1AU7A 2CROA 2IVGA 4I8TA 3BS3A 2FJRA 4IA8A 3GN5B 2BJCA 2GRLA 2CSFA 2WUSR 4X4IA 4J1XA 1QP4A 4Z5DA 1BDHA 3JXDL 2LCVA 3H5TA 1PRUA 3SCGA 1JWLA 1LQCA 2XCJA 1UXCA 3GBFA 3KJXA 1OSLA 1RPEL 1BDIA 4X4BA 1NEQA 3OQNA 1ZZ6A 1WIZA 2OFYA 4GQMA 2IUOA 2R63A 2EWTA 1OCTC 2BNNA 2XI8A 3JXCL 4YBAA 3F6WA 4F8DA 1S7EA 1PERL 4IWRA 1Y7YA 2L49A 3RZZA 1ZPQA 1HF0A 2OR1L 1ZZBA 1EFAA 3CECA 3F51A 3OMTA 2KEIA 1WH6A 1QQBA 2LYQA 4JCXA 1Y9QA 1QP7A 3EUSA 2GRMA 1SQ8A 4OB4A 3HZIB 1ZAYA 3OP9A 2KPJA 3CROL 1R63A 1GT0C 2XSDC 2IU7A 2AWIA 2LYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZVV A;  2BNO A;  1RZR D;  4YG1 A;  2MQK A;  3LFP A;  2A6C A;  4J1W A;  1X2L A;  2AXV A;  2PIJ A;  4YG4 A;  2PUD A;  1DW9 A;  4PU8 A;  5K98 B;  1PRV A;  3KXA A;  2AW6 A;  3TRB A;  1L1M A;  1ZZ9 A;  2ICT A;  1E3O C;  1LMB 3;  2JVL A;  2LYP A;  1NER A;  1QP0 A;  3SCF A;  2O4A A;  2LYL A;  4YAR A;  1RZR A;  1WET A;  3B7H A;  3BD1 A;  3QF3 A;  1CQT A;  3F52 A;  3OQO A;  2O38 A;  3QQ6 A;  4MCT A;  3MLF A;  4GHJ A;  1DWK A;  4Z5C A;  3JXB C;  1JH9 A;  4JQD A;  1X57 A;  2PUF A;  2BNM A;  4PU7 A;  2GZU A;  1QQA A;  4FN3 A;  2LYK A;  3CLC A;  4JCY A;  3FMY A;  4X4G A;  3D1N I;  2XJ3 A;  2HIN A;  4YG7 B;  2O49 A;  4MCX A;  2PUC A;  4I6U A;  2PE5 A;  1CJG A;  1ZZC A;  3ZHM A;  1WH8 A;  2MEZ A;  3QWG A;  3UFD A;  1POU A;  1RZS A;  3KZ3 A;  4IVZ A;  4X4E A;  2IV1 A;  1PNR A;  1VPW A;  2PUG A;  2PPX A;  2EF8 A;  1ZZ8 A;  2IVQ A;  3BDN A;  3IVP A;  2L8N A;  3PXP A;  2HSG A;  3O9X A;  1JFT A;  2R1J L;  1ADR A;  1XWR A;  2XIU A;  3S8Q A;  5A7L A;  2WIU B;  3G5G A;  3OQM A;  1PRA A;  4I6R A;  1IC8 A;  4I6T A;  4X4F A;  2KEK A;  4PU3 C;  3QYX A;  4FBI A;  2ICP A;  1LCD A;  4Z5H A;  1O4X A;  2PUB A;  2LYR A;  3GN5 A;  1ZUG A;  4O8B A;  1UTX A;  3L1P A;  1B0N A;  3ZHI A;  2KZ8 A;  2H8R A;  4X4C A;  3SCH A;  2KEJ A;  1JFS A;  3VK0 A;  4PU4 C;  3FYM A;  3FYA A;  1YSE A;  3DNV B;  1UXD A;  4Y42 A;  3U3W A;  4X4D A;  2LYJ A;  1R69 A;  2AXU A;  2D5V A;  1LLI A;  1QPZ A;  3LIS A;  1ZZ7 A;  3ZKC A;  2JCG A;  4X4H A;  2PUA A;  2PUE A;  2IVB A;  1LCC A;  1RIO A;  4NDW A;  4Z58 A;  3R1F A;  4Z59 A;  3G7D A;  2AUW A;  1ZS4 A;  2AXZ A;  2EBY A;  2B5A A;  1AU7 A;  2CRO A;  2IVG A;  4I8T A;  3BS3 A;  2FJR A;  4IA8 A;  3GN5 B;  2BJC A;  2GRL A;  2CSF A;  2WUS R;  4X4I A;  4J1X A;  1QP4 A;  4Z5D A;  1BDH A;  3JXD L;  2LCV A;  3H5T A;  1PRU A;  3SCG A;  1JWL A;  1LQC A;  2XCJ A;  1UXC A;  3GBF A;  3KJX A;  1OSL A;  1RPE L;  1BDI A;  4X4B A;  1NEQ A;  3OQN A;  1ZZ6 A;  1WIZ A;  2OFY A;  4GQM A;  2IUO A;  2R63 A;  2EWT A;  1OCT C;  2BNN A;  2XI8 A;  3JXC L;  4YBA A;  3F6W A;  4F8D A;  1S7E A;  1PER L;  4IWR A;  1Y7Y A;  2L49 A;  3RZZ A;  1ZPQ A;  1HF0 A;  2OR1 L;  1ZZB A;  1EFA A;  3CEC A;  3F51 A;  3OMT A;  2KEI A;  1WH6 A;  1QQB A;  2LYQ A;  4JCX A;  1Y9Q A;  1QP7 A;  3EUS A;  2GRM A;  1SQ8 A;  4OB4 A;  3HZI B;  1ZAY A;  3OP9 A;  2KPJ A;  3CRO L;  1R63 A;  1GT0 C;  2XSD C;  2IU7 A;  2AWI A;  2LYS A; 
#chains in the Genus database with same CATH topology
 1ZVV A;  2V3C C;  2BNO A;  3TFL A;  4J1W A;  5GAH i;  2PUD A;  1DW9 A;  3ZPX A;  2ODR D;  1L1M A;  1NER A;  2LYL A;  3B7H A;  3QF3 A;  2O38 A;  2XXQ A;  4DE8 A;  2PUF A;  2GZU A;  2LYK A;  4JCY A;  4YG7 B;  1CJG A;  1RZS A;  4X4E A;  5DTM A;  1ZZ8 A;  1U2Z A;  2XIU A;  5A7L A;  3OQM A;  4I6T A;  4X4F A;  4PU3 C;  2PUB A;  2LYR A;  3GUU A;  3QOX A;  2H8R A;  4X4C A;  3VK0 A;  3FYA A;  3DNV B;  4X4D A;  5DTQ A;  2LLW A;  4ER5 A;  3LIS A;  1QPZ A;  1ZZ7 A;  4X4H A;  1LCC A;  2LLV A;  4Z59 A;  2AUW A;  3KL4 A;  1AU7 A;  2CRO A;  4I8T A;  2FJR A;  2VEO A;  2WUS R;  2LCV A;  3H5T A;  1LQC A;  4HRA A;  1MFQ C;  3OQN A;  3SR4 A;  3PE5 A;  3RZZ A;  1ZPQ A;  3DM5 A;  3OKZ A;  1Y9Q A;  3EUS A;  4OB4 A;  1GT0 C;  2MXD A;  3LFP A;  2PXP A;  3NXH A;  2M4H A;  1QB2 A;  2PIJ A;  4PU8 A;  1PRV A;  3KXA A;  2AW6 A;  1ZZ9 A;  1LMB 3;  2JVL A;  2LYP A;  2O4A A;  4YAR A;  1RZR A;  1WET A;  5JUW A;  3MLF A;  4Z5C A;  1X57 A;  2PXQ A;  2BNM A;  1QQA A;  3D1N I;  4MCX A;  3QOW A;  3ZHM A;  3QWG A;  3GZC A;  1VPW A;  2PPX A;  2EF8 A;  2IVQ A;  3BDN A;  2HSG A;  2R1J L;  2WIU B;  1PRA A;  2JQE A;  4OBM A;  1O4X A;  3L1P A;  4O8B A;  2KZ8 A;  2PXK A;  3SCH A;  2KEJ A;  1JFS A;  3GZD A;  4EQZ A;  3FYM A;  1YSE A;  2HCS A;  1R69 A;  2D5V A;  3ZKC A;  2HCN A;  2PUA A;  1RIO A;  4NDW A;  3G7D A;  2EBY A;  2YBD A;  2HFZ A;  1DUL A;  4IA8 A;  2BJC A;  1BDH A;  4EK9 A;  1OSL A;  4DE9 A;  3NDB B;  1BDI A;  2FFH A;  1NEQ A;  1ZZ6 A;  2OFY A;  4GQM A;  2L1P A;  1OCT C;  2BNN A;  3JXC L;  4YBA A;  1PER L;  1S7E A;  2L49 A;  1ZZB A;  1EFA A;  3MEJ A;  3CEC A;  3OMT A;  1WH6 A;  1QQB A;  1ZAY A;  4EKI A;  3LQX A;  2KPJ A;  3ME5 A;  1R63 A;  2IU7 A;  1RZR D;  4YG1 A;  3A9Z A;  2A6C A;  1X2L A;  2AXV A;  3TRB A;  4ER0 A;  1CQT A;  3F52 A;  3GZD C;  3QQ6 A;  4GHJ A;  4JQD A;  4PU7 A;  4FN3 A;  4X4G A;  3TEL A;  2PUC A;  2PE5 A;  5DT2 A;  3KZ3 A;  3TEP A;  3IVP A;  2L8N A;  1JFT A;  2PXT A;  3S8Q A;  3G5G A;  4FBI A;  4Z5H A;  4EZI A;  3GN5 A;  5DRT A;  1UTX A;  3ZHI A;  4PU4 C;  3VWS A;  1UXD A;  4Y42 A;  3U3W A;  2AXU A;  2PXE A;  4ER7 A;  4Z58 A;  3UWP A;  2AXZ A;  4WVL A;  3BS3 A;  3GN5 B;  4J1X A;  1QP4 A;  1PRU A;  1UXC A;  1RPE L;  3NZL A;  4X4B A;  1WIZ A;  1NW3 A;  2R63 A;  5DRY A;  1Y7Y A;  3F51 A;  3G0T A;  3NRO A;  2LYQ A;  4JCX A;  1QP7 A;  3CRO L;  2GRM A;  1SQ8 A;  3HZI B;  3OP9 A;  2AWI A;  3M9L A;  4ER3 A;  4Q2J A;  2MQK A;  3A9X A;  4YG4 A;  5K98 B;  2PXF A;  2ICT A;  1E3O C;  1QP0 A;  3SCF A;  2J7U A;  3BD1 A;  3OQO A;  4ER6 A;  4MCT A;  1DWK A;  3JXB C;  1JH9 A;  2PXV A;  3CLC A;  3FMY A;  2XJ3 A;  2HIN A;  2O49 A;  2PXB A;  4I6U A;  1ZZC A;  3A9Y A;  1WH8 A;  2MEZ A;  3UFD A;  1QZX A;  1POU A;  4IVZ A;  2IV1 A;  2XXP A;  1HQ1 A;  1PNR A;  2PUG A;  3PXP A;  3O9X A;  1ADR A;  1XWR A;  4I6R A;  1IC8 A;  3QYX A;  2KEK A;  5DSX A;  2ICP A;  1LCD A;  1ZUG A;  1B0N A;  2PXL A;  2XXA A;  3SX0 A;  2PXU A;  2J7W A;  2LYJ A;  1LLI A;  5GAG i;  2JCG A;  2PUE A;  2IVB A;  3R1F A;  1ZS4 A;  2B5A A;  4EKG A;  2IVG A;  3QFI A;  2GRL A;  2CSF A;  4X4I A;  4Z5D A;  3JXD L;  1JWL A;  3SCG A;  2XCJ A;  3GBF A;  3KJX A;  5DTR A;  2LNM A;  2IUO A;  2EWT A;  2XI8 A;  3F6W A;  4F8D A;  4IWR A;  3R09 A;  1HF0 A;  2OR1 L;  2KEI A;  3OWQ A;  2XSD C;  2LYS A;  2PXD A; 
#chains in the Genus database with same CATH homology
 1ZVV A;  2BNO A;  1RZR D;  4YG1 A;  2MQK A;  3LFP A;  2A6C A;  4J1W A;  1X2L A;  2AXV A;  2PIJ A;  4YG4 A;  2PUD A;  1DW9 A;  4PU8 A;  5K98 B;  1PRV A;  3KXA A;  2AW6 A;  3TRB A;  1L1M A;  1ZZ9 A;  2ICT A;  1E3O C;  1LMB 3;  2JVL A;  2LYP A;  1NER A;  1QP0 A;  3SCF A;  2O4A A;  2LYL A;  4YAR A;  1RZR A;  1WET A;  3B7H A;  3BD1 A;  3QF3 A;  1CQT A;  3F52 A;  3OQO A;  2O38 A;  3QQ6 A;  4MCT A;  3MLF A;  4GHJ A;  1DWK A;  4Z5C A;  3JXB C;  1JH9 A;  4JQD A;  1X57 A;  2PUF A;  2BNM A;  4PU7 A;  2GZU A;  1QQA A;  4FN3 A;  2LYK A;  3CLC A;  4JCY A;  3FMY A;  4X4G A;  3D1N I;  2XJ3 A;  2HIN A;  4YG7 B;  2O49 A;  4MCX A;  2PUC A;  4I6U A;  2PE5 A;  1CJG A;  1ZZC A;  3ZHM A;  1WH8 A;  2MEZ A;  3QWG A;  3UFD A;  1POU A;  1RZS A;  3KZ3 A;  4IVZ A;  4X4E A;  2IV1 A;  1PNR A;  1VPW A;  2PUG A;  2PPX A;  2EF8 A;  1ZZ8 A;  2IVQ A;  3BDN A;  3IVP A;  2L8N A;  3PXP A;  2HSG A;  3O9X A;  1JFT A;  2R1J L;  1ADR A;  1XWR A;  2XIU A;  3S8Q A;  5A7L A;  2WIU B;  3G5G A;  3OQM A;  1PRA A;  4I6R A;  1IC8 A;  4I6T A;  4X4F A;  2KEK A;  4PU3 C;  3QYX A;  4FBI A;  2ICP A;  1LCD A;  4Z5H A;  1O4X A;  2PUB A;  2LYR A;  3GN5 A;  1ZUG A;  4O8B A;  1UTX A;  3L1P A;  1B0N A;  3ZHI A;  2KZ8 A;  2H8R A;  4X4C A;  3SCH A;  2KEJ A;  1JFS A;  3VK0 A;  4PU4 C;  3FYM A;  3FYA A;  1YSE A;  3DNV B;  1UXD A;  4Y42 A;  3U3W A;  4X4D A;  2LYJ A;  1R69 A;  2AXU A;  2D5V A;  1LLI A;  1QPZ A;  3LIS A;  1ZZ7 A;  3ZKC A;  2JCG A;  4X4H A;  2PUA A;  2PUE A;  2IVB A;  1LCC A;  1RIO A;  4NDW A;  4Z58 A;  3R1F A;  4Z59 A;  3G7D A;  2AUW A;  1ZS4 A;  2AXZ A;  2EBY A;  2B5A A;  1AU7 A;  2CRO A;  2IVG A;  4I8T A;  3BS3 A;  2FJR A;  4IA8 A;  3GN5 B;  2BJC A;  2GRL A;  2CSF A;  2WUS R;  4X4I A;  4J1X A;  1QP4 A;  4Z5D A;  1BDH A;  3JXD L;  2LCV A;  3H5T A;  1PRU A;  3SCG A;  1JWL A;  1LQC A;  2XCJ A;  1UXC A;  3GBF A;  3KJX A;  1OSL A;  1RPE L;  1BDI A;  4X4B A;  1NEQ A;  3OQN A;  1ZZ6 A;  1WIZ A;  2OFY A;  4GQM A;  2IUO A;  2R63 A;  2EWT A;  1OCT C;  2BNN A;  2XI8 A;  3JXC L;  4YBA A;  3F6W A;  4F8D A;  1S7E A;  1PER L;  4IWR A;  1Y7Y A;  2L49 A;  3RZZ A;  1ZPQ A;  1HF0 A;  2OR1 L;  1ZZB A;  1EFA A;  3CEC A;  3F51 A;  3OMT A;  2KEI A;  1WH6 A;  1QQB A;  2LYQ A;  4JCX A;  1Y9Q A;  1QP7 A;  3EUS A;  2GRM A;  1SQ8 A;  4OB4 A;  3HZI B;  1ZAY A;  3OP9 A;  2KPJ A;  3CRO L;  1R63 A;  1GT0 C;  2XSD C;  2IU7 A;  2AWI A;  2LYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...