2LYSA

Noe-based 3d structure of the monomeric partially-folded intermediate of cylr2 at 257k (-16 celsius degrees)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cold denaturation of a protein dimer monitored at atomic resolution.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Dna binding protein
molecule keywords CylR2
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2lysA00
2O49A 2IVBA 1BDIA 1R63A 5K98B 3RZZA 3FMYA 3OQNA 2WUSR 1AU7A 1PRAA 2MQKA 4Z58A 4Z5HA 1O4XA 3UFDA 4OB4A 4Z59A 1QP0A 3KZ3A 1ZZBA 1WH6A 1QP7A 4JQDA 3S8QA 1WIZA 4Z5DA 3SCHA 1LCDA 1LCCA 1CQTA 1ZAYA 2H8RA 4PU8A 2LCVA 2JCGA 1DW9A 1QP4A 1RZSA 2KZ8A 3L1PA 4X4EA 2D5VA 4MCXA 1NEQA 1POUA 2BNMA 3FYMA 2CSFA 2LYJA 2L8NA 4IVZA 1JFTA 1YSEA 4YBAA 2IUOA 3FYAA 2EWTA 2AW6A 1X2LA 4YARA 2BNNA 3O9XA 4J1XA 3JXBC 2BJCA 1X57A 2PUGA 1XWRA 4JCYA 1ADRA 2HSGA 3TRBA 2PE5A 1ZZ8A 2AWIA 2XIUA 2PUEA 3BD1A 3LISA 4X4BA 2AXVA 1LMB3 2L49A 1CJGA 1QQBA 3QF3A 2ICPA 4I6UA 4F8DA 1JH9A 3QQ6A 1RPEL 2PIJA 3MLFA 2PUAA 1UXCA 2XCJA 2GRMA 2LYPA 3F51A 1L1MA 2FJRA 1QQAA 1ZZ6A 2IV1A 3KXAA 2LYQA 1Y9QA 3BDNA 1QPZA 2AXZA 1RZRD 4YG7B 1UTXA 4X4FA 2ICTA 2R63A 3G7DA 4I6RA 1ZVVA 2PUFA 2AXUA 3QYXA 4JCXA 3GN5B 2MEZA 1NERA 2EBYA 4X4IA 3G5GA 4X4GA 1ZZ9A 4YG4A 3DNVB 2IVQA 1E3OC 1ZUGA 3GBFA 3IVPA 4X4HA 1PERL 1R69A 1S7EA 1LLIA 1GT0C 2XI8A 4GHJA 2A6CA 2EF8A 4MCTA 2LYLA 4PU7A 4PU4C 3R1FA 2PUCA 3SCGA 1OCTC 1ZPQA 2GZUA 2KPJA 1SQ8A 4GQMA 2IVGA 4I8TA 1B0NA 3JXDL 1RZRA 1JFSA 4YG1A 1WETA 4NDWA 3H5TA 4X4CA 2LYKA 4Y42A 3OQOA 1ZS4A 2KEIA 3D1NI 2KEKA 3OMTA 1HF0A 4IWRA 3ZHIA 2PPXA 3CECA 4PU3C 2BNOA 1VPWA 2OR1L 3CLCA 1IC8A 5A7LA 2LYSA 3F6WA 1ZZ7A 2AUWA 4FN3A 3LFPA 2KEJA 2JVLA 1LQCA 3F52A 2R1JL 3PXPA 1BDHA 3OQMA 2XJ3A 4Z5CA 1DWKA 2O38A 3VK0A 3JXCL 1PNRA 1Y7YA 4FBIA 2CROA 3ZKCA 1WH8A 3SCFA 4X4DA 2LYRA 3OP9A 3QWGA 4I6TA 3CROL 1UXDA 3GN5A 2WIUB 4J1WA 1ZZCA 3EUSA 2PUDA 2IU7A 4O8BA 1JWLA 2XSDC 2GRLA 1RIOA 2O4AA 3ZHMA 1PRVA 3HZIB 3B7HA 3BS3A 1PRUA 4IA8A 3U3WA 1OSLA 2PUBA 1EFAA 2OFYA 2B5AA 2HINA 3KJXA
chains in the Genus database with same CATH superfamily
3UWPA 2O49A 2PXKA 2J7UA 1BDIA 4ER6A 1AU7A 2MQKA 1O4XA 4Z59A 1QP0A 5DRTA 1ZZBA 3NDBB 3S8QA 4DE8A 4Z5DA 4PU8A 2J7WA 1QP4A 2D5VA 4X4EA 1NEQA 1POUA 2BNNA 1X57A 2PXUA 3DM5A 1QQBA 3QF3A 4I6UA 3TFLA 3LQXA 2PIJA 2PUAA 1UXCA 3F51A 2LYPA 1L1MA 1NW3A 4EK9A 1RZRD 1UTXA 2R63A 4EKGA 3OWQA 2PUFA 2IVQA 1E3OC 1ZUGA 3GBFA 1PERL 2XI8A 4GHJA 1QZXA 2LYLA 3SCGA 1OCTC 2GZUA 1SQ8A 4I8TA 1B0NA 1RZRA 1JFSA 2HCNA 3H5TA 2LYKA 4Y42A 3OQOA 3R09A 1ZS4A 2KEIA 1VPWA 2OR1L 3CLCA 2LNMA 1IC8A 1ZZ7A 2AUWA 4FN3A 2R1JL 1LQCA 3PXPA 2LLVA 2XJ3A 5DTQA 3JXCL 2O38A 1Y7YA 2CROA 3TEPA 2LYRA 3OP9A 2L1PA 4I6TA 1UXDA 2XXAA 2WIUB 2IU7A 4O8BA 2PXVA 1PRVA 3U3WA 3BS3A 1OSLA 1PRUA 4WVLA 2PUBA 1EFAA 4FBIA 5K98B 4Z5HA 3UFDA 3KZ3A 1LCDA 1LCCA 1ZAYA 2H8RA 2KZ8A 4MCXA 2BNMA 2LYJA 2L8NA 4IVZA 1YSEA 2IUOA 3FYAA 2EWTA 2AW6A 4DE9A 3O9XA 4J1XA 2BJCA 4JCYA 1XWRA 2PXFA 2HSGA 3TRBA 3A9ZA 1ZZ8A 2AWIA 2PUEA 2ICPA 4ER0A 3MLFA 2XCJA 2FJRA 2IV1A 3BDNA 2ODRD 2AXZA 2PXEA 4YG7B 3G7DA 3QYXA 3GZCA 2EBYA 1HQ1A 3ZPXA 1ZZ9A 4OBMA 4EZIA 2PXTA 4ER3A 1S7EA 4MCTA 4PU4C 1MFQC 3OMTA 3CECA 2BNOA 5DT2A 5A7LA 2LYSA 3LFPA 2JVLA 4Z5CA 1U2ZA 2V3CC 4X4DA 3CROL 2PUDA 2XSDC 2GRLA 1RIOA 2O4AA 3B7HA 3M9LA 2OFYA 3A9YA 2IVBA 3RZZA 3FMYA 1PRAA 4Z58A 2PXLA 1QP7A 3SCHA 2JCGA 3G0TA 1RZSA 3L1PA 1DULA 2CSFA 1JFTA 3SR4A 4YBAA 4YARA 3JXBC 2XIUA 3A9XA 3GZDA 5GAHi 1QB2A 1RPEL 2GRMA 1QQAA 1ZZ6A 3QFIA 2LYQA 4X4FA 1ZVVA 2AXUA 4ER7A 4JCXA 3GN5B 1NERA 3G5GA 3DNVB 3IVPA 4X4HA 2HFZA 3NROA 2A6CA 2EF8A 1ZPQA 2KPJA 3NZLA 4GQMA 3JXDL 4YG1A 1WETA 2XXPA 3D1NI 2PPXA 4EQZA 2FFHA 5DTRA 5DRYA 2KEJA 3F52A 3OQMA 3KL4A 4EKIA 2PXDA 3GUUA 4J1WA 3EUSA 3QOWA 3PE5A 3ZHMA 3SX0A 2XXQA 4HRAA 2B5AA 1PNRA 2HINA 5DTMA 1R63A 3OQNA 2WUSR 2HCSA 3TELA 4OB4A 1WH6A 2PXQA 4JQDA 1WIZA 1CQTA 2LCVA 1DW9A 3FYMA 3VWSA 2VEOA 2PXPA 1X2LA 2PUGA 3GZDC 2YBDA 1ADRA 2PE5A 3BD1A 3LISA 4X4BA 2AXVA 1LMB3 2L49A 1CJGA 2MXDA 4F8DA 1JH9A 3QQ6A 5DSXA 3KXAA 1Y9QA 1QPZA 2ICTA 4I6RA 2MEZA 4X4IA 4Q2JA 4X4GA 4YG4A 1R69A 3ME5A 1LLIA 1GT0C 3NXHA 4PU7A 2PUCA 3R1FA 2IVGA 2M4HA 4NDWA 4X4CA 2KEKA 1HF0A 4IWRA 3ZHIA 4PU3C 2LLWA 3F6WA 3QOXA 1BDHA 1DWKA 3VK0A 5JUWA 2PXBA 5GAGi 3ZKCA 1WH8A 3SCFA 3QWGA 4ER5A 2JQEA 3MEJA 3GN5A 1ZZCA 1JWLA 3OKZA 3HZIB 4IA8A 3KJXA
chains in the Genus database with same CATH topology
2O49A 2IVBA 1BDIA 1R63A 5K98B 3RZZA 3FMYA 3OQNA 2WUSR 1AU7A 1PRAA 2MQKA 4Z58A 4Z5HA 1O4XA 3UFDA 4OB4A 4Z59A 1QP0A 3KZ3A 1ZZBA 1WH6A 1QP7A 4JQDA 3S8QA 1WIZA 4Z5DA 3SCHA 1LCDA 1LCCA 1CQTA 1ZAYA 2H8RA 4PU8A 2LCVA 2JCGA 1DW9A 1QP4A 1RZSA 2KZ8A 3L1PA 4X4EA 2D5VA 4MCXA 1NEQA 1POUA 2BNMA 3FYMA 2CSFA 2LYJA 2L8NA 4IVZA 1JFTA 1YSEA 4YBAA 2IUOA 3FYAA 2EWTA 2AW6A 1X2LA 4YARA 2BNNA 3O9XA 4J1XA 3JXBC 2BJCA 1X57A 2PUGA 1XWRA 4JCYA 1ADRA 2HSGA 3TRBA 2PE5A 1ZZ8A 2AWIA 2XIUA 2PUEA 3BD1A 3LISA 4X4BA 2AXVA 1LMB3 2L49A 1CJGA 1QQBA 3QF3A 2ICPA 4I6UA 4F8DA 1JH9A 3QQ6A 1RPEL 2PIJA 3MLFA 2PUAA 1UXCA 2XCJA 2GRMA 2LYPA 3F51A 1L1MA 2FJRA 1QQAA 1ZZ6A 2IV1A 3KXAA 2LYQA 1Y9QA 3BDNA 1QPZA 2AXZA 1RZRD 4YG7B 1UTXA 4X4FA 2ICTA 2R63A 3G7DA 4I6RA 1ZVVA 2PUFA 2AXUA 3QYXA 4JCXA 3GN5B 2MEZA 1NERA 2EBYA 4X4IA 3G5GA 4X4GA 1ZZ9A 4YG4A 3DNVB 2IVQA 1E3OC 1ZUGA 3GBFA 3IVPA 4X4HA 1PERL 1R69A 1S7EA 1LLIA 1GT0C 2XI8A 4GHJA 2A6CA 2EF8A 4MCTA 2LYLA 4PU7A 4PU4C 3R1FA 2PUCA 3SCGA 1OCTC 1ZPQA 2GZUA 2KPJA 1SQ8A 4GQMA 2IVGA 4I8TA 1B0NA 3JXDL 1RZRA 1JFSA 4YG1A 1WETA 4NDWA 3H5TA 4X4CA 2LYKA 4Y42A 3OQOA 1ZS4A 2KEIA 3D1NI 2KEKA 3OMTA 1HF0A 4IWRA 3ZHIA 2PPXA 3CECA 4PU3C 2BNOA 1VPWA 2OR1L 3CLCA 1IC8A 5A7LA 2LYSA 3F6WA 1ZZ7A 2AUWA 4FN3A 3LFPA 2KEJA 2JVLA 1LQCA 3F52A 2R1JL 3PXPA 1BDHA 3OQMA 2XJ3A 4Z5CA 1DWKA 2O38A 3VK0A 3JXCL 1PNRA 1Y7YA 4FBIA 2CROA 3ZKCA 1WH8A 3SCFA 4X4DA 2LYRA 3OP9A 3QWGA 4I6TA 3CROL 1UXDA 3GN5A 2WIUB 4J1WA 1ZZCA 3EUSA 2PUDA 2IU7A 4O8BA 1JWLA 2XSDC 2GRLA 1RIOA 2O4AA 3ZHMA 1PRVA 3HZIB 3B7HA 3BS3A 1PRUA 4IA8A 3U3WA 1OSLA 2PUBA 1EFAA 2OFYA 2B5AA 2HINA 3KJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O49 A;  2IVB A;  1BDI A;  1R63 A;  5K98 B;  3RZZ A;  3FMY A;  3OQN A;  2WUS R;  1AU7 A;  1PRA A;  2MQK A;  4Z58 A;  4Z5H A;  1O4X A;  3UFD A;  4OB4 A;  4Z59 A;  1QP0 A;  3KZ3 A;  1ZZB A;  1WH6 A;  1QP7 A;  4JQD A;  3S8Q A;  1WIZ A;  4Z5D A;  3SCH A;  1LCD A;  1LCC A;  1CQT A;  1ZAY A;  2H8R A;  4PU8 A;  2LCV A;  2JCG A;  1DW9 A;  1QP4 A;  1RZS A;  2KZ8 A;  3L1P A;  4X4E A;  2D5V A;  4MCX A;  1NEQ A;  1POU A;  2BNM A;  3FYM A;  2CSF A;  2LYJ A;  2L8N A;  4IVZ A;  1JFT A;  1YSE A;  4YBA A;  2IUO A;  3FYA A;  2EWT A;  2AW6 A;  1X2L A;  4YAR A;  2BNN A;  3O9X A;  4J1X A;  3JXB C;  2BJC A;  1X57 A;  2PUG A;  1XWR A;  4JCY A;  1ADR A;  2HSG A;  3TRB A;  2PE5 A;  1ZZ8 A;  2AWI A;  2XIU A;  2PUE A;  3BD1 A;  3LIS A;  4X4B A;  2AXV A;  1LMB 3;  2L49 A;  1CJG A;  1QQB A;  3QF3 A;  2ICP A;  4I6U A;  4F8D A;  1JH9 A;  3QQ6 A;  1RPE L;  2PIJ A;  3MLF A;  2PUA A;  1UXC A;  2XCJ A;  2GRM A;  2LYP A;  3F51 A;  1L1M A;  2FJR A;  1QQA A;  1ZZ6 A;  2IV1 A;  3KXA A;  2LYQ A;  1Y9Q A;  3BDN A;  1QPZ A;  2AXZ A;  1RZR D;  4YG7 B;  1UTX A;  4X4F A;  2ICT A;  2R63 A;  3G7D A;  4I6R A;  1ZVV A;  2PUF A;  2AXU A;  3QYX A;  4JCX A;  3GN5 B;  2MEZ A;  1NER A;  2EBY A;  4X4I A;  3G5G A;  4X4G A;  1ZZ9 A;  4YG4 A;  3DNV B;  2IVQ A;  1E3O C;  1ZUG A;  3GBF A;  3IVP A;  4X4H A;  1PER L;  1R69 A;  1S7E A;  1LLI A;  1GT0 C;  2XI8 A;  4GHJ A;  2A6C A;  2EF8 A;  4MCT A;  2LYL A;  4PU7 A;  4PU4 C;  3R1F A;  2PUC A;  3SCG A;  1OCT C;  1ZPQ A;  2GZU A;  2KPJ A;  1SQ8 A;  4GQM A;  2IVG A;  4I8T A;  1B0N A;  3JXD L;  1RZR A;  1JFS A;  4YG1 A;  1WET A;  4NDW A;  3H5T A;  4X4C A;  2LYK A;  4Y42 A;  3OQO A;  1ZS4 A;  2KEI A;  3D1N I;  2KEK A;  3OMT A;  1HF0 A;  4IWR A;  3ZHI A;  2PPX A;  3CEC A;  4PU3 C;  2BNO A;  1VPW A;  2OR1 L;  3CLC A;  1IC8 A;  5A7L A;  2LYS A;  3F6W A;  1ZZ7 A;  2AUW A;  4FN3 A;  3LFP A;  2KEJ A;  2JVL A;  1LQC A;  3F52 A;  2R1J L;  3PXP A;  1BDH A;  3OQM A;  2XJ3 A;  4Z5C A;  1DWK A;  2O38 A;  3VK0 A;  3JXC L;  1PNR A;  1Y7Y A;  4FBI A;  2CRO A;  3ZKC A;  1WH8 A;  3SCF A;  4X4D A;  2LYR A;  3OP9 A;  3QWG A;  4I6T A;  3CRO L;  1UXD A;  3GN5 A;  2WIU B;  4J1W A;  1ZZC A;  3EUS A;  2PUD A;  2IU7 A;  4O8B A;  1JWL A;  2XSD C;  2GRL A;  1RIO A;  2O4A A;  3ZHM A;  1PRV A;  3HZI B;  3B7H A;  3BS3 A;  1PRU A;  4IA8 A;  3U3W A;  1OSL A;  2PUB A;  1EFA A;  2OFY A;  2B5A A;  2HIN A;  3KJX A; 
#chains in the Genus database with same CATH topology
 3UWP A;  2O49 A;  2PXK A;  2J7U A;  1BDI A;  4ER6 A;  1AU7 A;  2MQK A;  1O4X A;  4Z59 A;  1QP0 A;  5DRT A;  1ZZB A;  3NDB B;  3S8Q A;  4DE8 A;  4Z5D A;  4PU8 A;  2J7W A;  1QP4 A;  2D5V A;  4X4E A;  1NEQ A;  1POU A;  2BNN A;  1X57 A;  2PXU A;  3DM5 A;  1QQB A;  3QF3 A;  4I6U A;  3TFL A;  3LQX A;  2PIJ A;  2PUA A;  1UXC A;  3F51 A;  2LYP A;  1L1M A;  1NW3 A;  4EK9 A;  1RZR D;  1UTX A;  2R63 A;  4EKG A;  3OWQ A;  2PUF A;  2IVQ A;  1E3O C;  1ZUG A;  3GBF A;  1PER L;  2XI8 A;  4GHJ A;  1QZX A;  2LYL A;  3SCG A;  1OCT C;  2GZU A;  1SQ8 A;  4I8T A;  1B0N A;  1RZR A;  1JFS A;  2HCN A;  3H5T A;  2LYK A;  4Y42 A;  3OQO A;  3R09 A;  1ZS4 A;  2KEI A;  1VPW A;  2OR1 L;  3CLC A;  2LNM A;  1IC8 A;  1ZZ7 A;  2AUW A;  4FN3 A;  2R1J L;  1LQC A;  3PXP A;  2LLV A;  2XJ3 A;  5DTQ A;  3JXC L;  2O38 A;  1Y7Y A;  2CRO A;  3TEP A;  2LYR A;  3OP9 A;  2L1P A;  4I6T A;  1UXD A;  2XXA A;  2WIU B;  2IU7 A;  4O8B A;  2PXV A;  1PRV A;  3U3W A;  3BS3 A;  1OSL A;  1PRU A;  4WVL A;  2PUB A;  1EFA A;  4FBI A;  5K98 B;  4Z5H A;  3UFD A;  3KZ3 A;  1LCD A;  1LCC A;  1ZAY A;  2H8R A;  2KZ8 A;  4MCX A;  2BNM A;  2LYJ A;  2L8N A;  4IVZ A;  1YSE A;  2IUO A;  3FYA A;  2EWT A;  2AW6 A;  4DE9 A;  3O9X A;  4J1X A;  2BJC A;  4JCY A;  1XWR A;  2PXF A;  2HSG A;  3TRB A;  3A9Z A;  1ZZ8 A;  2AWI A;  2PUE A;  2ICP A;  4ER0 A;  3MLF A;  2XCJ A;  2FJR A;  2IV1 A;  3BDN A;  2ODR D;  2AXZ A;  2PXE A;  4YG7 B;  3G7D A;  3QYX A;  3GZC A;  2EBY A;  1HQ1 A;  3ZPX A;  1ZZ9 A;  4OBM A;  4EZI A;  2PXT A;  4ER3 A;  1S7E A;  4MCT A;  4PU4 C;  1MFQ C;  3OMT A;  3CEC A;  2BNO A;  5DT2 A;  5A7L A;  2LYS A;  3LFP A;  2JVL A;  4Z5C A;  1U2Z A;  2V3C C;  4X4D A;  3CRO L;  2PUD A;  2XSD C;  2GRL A;  1RIO A;  2O4A A;  3B7H A;  3M9L A;  2OFY A;  3A9Y A;  2IVB A;  3RZZ A;  3FMY A;  1PRA A;  4Z58 A;  2PXL A;  1QP7 A;  3SCH A;  2JCG A;  3G0T A;  1RZS A;  3L1P A;  1DUL A;  2CSF A;  1JFT A;  3SR4 A;  4YBA A;  4YAR A;  3JXB C;  2XIU A;  3A9X A;  3GZD A;  5GAH i;  1QB2 A;  1RPE L;  2GRM A;  1QQA A;  1ZZ6 A;  3QFI A;  2LYQ A;  4X4F A;  1ZVV A;  2AXU A;  4ER7 A;  4JCX A;  3GN5 B;  1NER A;  3G5G A;  3DNV B;  3IVP A;  4X4H A;  2HFZ A;  3NRO A;  2A6C A;  2EF8 A;  1ZPQ A;  2KPJ A;  3NZL A;  4GQM A;  3JXD L;  4YG1 A;  1WET A;  2XXP A;  3D1N I;  2PPX A;  4EQZ A;  2FFH A;  5DTR A;  5DRY A;  2KEJ A;  3F52 A;  3OQM A;  3KL4 A;  4EKI A;  2PXD A;  3GUU A;  4J1W A;  3EUS A;  3QOW A;  3PE5 A;  3ZHM A;  3SX0 A;  2XXQ A;  4HRA A;  2B5A A;  1PNR A;  2HIN A;  5DTM A;  1R63 A;  3OQN A;  2WUS R;  2HCS A;  3TEL A;  4OB4 A;  1WH6 A;  2PXQ A;  4JQD A;  1WIZ A;  1CQT A;  2LCV A;  1DW9 A;  3FYM A;  3VWS A;  2VEO A;  2PXP A;  1X2L A;  2PUG A;  3GZD C;  2YBD A;  1ADR A;  2PE5 A;  3BD1 A;  3LIS A;  4X4B A;  2AXV A;  1LMB 3;  2L49 A;  1CJG A;  2MXD A;  4F8D A;  1JH9 A;  3QQ6 A;  5DSX A;  3KXA A;  1Y9Q A;  1QPZ A;  2ICT A;  4I6R A;  2MEZ A;  4X4I A;  4Q2J A;  4X4G A;  4YG4 A;  1R69 A;  3ME5 A;  1LLI A;  1GT0 C;  3NXH A;  4PU7 A;  2PUC A;  3R1F A;  2IVG A;  2M4H A;  4NDW A;  4X4C A;  2KEK A;  1HF0 A;  4IWR A;  3ZHI A;  4PU3 C;  2LLW A;  3F6W A;  3QOX A;  1BDH A;  1DWK A;  3VK0 A;  5JUW A;  2PXB A;  5GAG i;  3ZKC A;  1WH8 A;  3SCF A;  3QWG A;  4ER5 A;  2JQE A;  3MEJ A;  3GN5 A;  1ZZC A;  1JWL A;  3OKZ A;  3HZI B;  4IA8 A;  3KJX A; 
#chains in the Genus database with same CATH homology
 2O49 A;  2IVB A;  1BDI A;  1R63 A;  5K98 B;  3RZZ A;  3FMY A;  3OQN A;  2WUS R;  1AU7 A;  1PRA A;  2MQK A;  4Z58 A;  4Z5H A;  1O4X A;  3UFD A;  4OB4 A;  4Z59 A;  1QP0 A;  3KZ3 A;  1ZZB A;  1WH6 A;  1QP7 A;  4JQD A;  3S8Q A;  1WIZ A;  4Z5D A;  3SCH A;  1LCD A;  1LCC A;  1CQT A;  1ZAY A;  2H8R A;  4PU8 A;  2LCV A;  2JCG A;  1DW9 A;  1QP4 A;  1RZS A;  2KZ8 A;  3L1P A;  4X4E A;  2D5V A;  4MCX A;  1NEQ A;  1POU A;  2BNM A;  3FYM A;  2CSF A;  2LYJ A;  2L8N A;  4IVZ A;  1JFT A;  1YSE A;  4YBA A;  2IUO A;  3FYA A;  2EWT A;  2AW6 A;  1X2L A;  4YAR A;  2BNN A;  3O9X A;  4J1X A;  3JXB C;  2BJC A;  1X57 A;  2PUG A;  1XWR A;  4JCY A;  1ADR A;  2HSG A;  3TRB A;  2PE5 A;  1ZZ8 A;  2AWI A;  2XIU A;  2PUE A;  3BD1 A;  3LIS A;  4X4B A;  2AXV A;  1LMB 3;  2L49 A;  1CJG A;  1QQB A;  3QF3 A;  2ICP A;  4I6U A;  4F8D A;  1JH9 A;  3QQ6 A;  1RPE L;  2PIJ A;  3MLF A;  2PUA A;  1UXC A;  2XCJ A;  2GRM A;  2LYP A;  3F51 A;  1L1M A;  2FJR A;  1QQA A;  1ZZ6 A;  2IV1 A;  3KXA A;  2LYQ A;  1Y9Q A;  3BDN A;  1QPZ A;  2AXZ A;  1RZR D;  4YG7 B;  1UTX A;  4X4F A;  2ICT A;  2R63 A;  3G7D A;  4I6R A;  1ZVV A;  2PUF A;  2AXU A;  3QYX A;  4JCX A;  3GN5 B;  2MEZ A;  1NER A;  2EBY A;  4X4I A;  3G5G A;  4X4G A;  1ZZ9 A;  4YG4 A;  3DNV B;  2IVQ A;  1E3O C;  1ZUG A;  3GBF A;  3IVP A;  4X4H A;  1PER L;  1R69 A;  1S7E A;  1LLI A;  1GT0 C;  2XI8 A;  4GHJ A;  2A6C A;  2EF8 A;  4MCT A;  2LYL A;  4PU7 A;  4PU4 C;  3R1F A;  2PUC A;  3SCG A;  1OCT C;  1ZPQ A;  2GZU A;  2KPJ A;  1SQ8 A;  4GQM A;  2IVG A;  4I8T A;  1B0N A;  3JXD L;  1RZR A;  1JFS A;  4YG1 A;  1WET A;  4NDW A;  3H5T A;  4X4C A;  2LYK A;  4Y42 A;  3OQO A;  1ZS4 A;  2KEI A;  3D1N I;  2KEK A;  3OMT A;  1HF0 A;  4IWR A;  3ZHI A;  2PPX A;  3CEC A;  4PU3 C;  2BNO A;  1VPW A;  2OR1 L;  3CLC A;  1IC8 A;  5A7L A;  2LYS A;  3F6W A;  1ZZ7 A;  2AUW A;  4FN3 A;  3LFP A;  2KEJ A;  2JVL A;  1LQC A;  3F52 A;  2R1J L;  3PXP A;  1BDH A;  3OQM A;  2XJ3 A;  4Z5C A;  1DWK A;  2O38 A;  3VK0 A;  3JXC L;  1PNR A;  1Y7Y A;  4FBI A;  2CRO A;  3ZKC A;  1WH8 A;  3SCF A;  4X4D A;  2LYR A;  3OP9 A;  3QWG A;  4I6T A;  3CRO L;  1UXD A;  3GN5 A;  2WIU B;  4J1W A;  1ZZC A;  3EUS A;  2PUD A;  2IU7 A;  4O8B A;  1JWL A;  2XSD C;  2GRL A;  1RIO A;  2O4A A;  3ZHM A;  1PRV A;  3HZI B;  3B7H A;  3BS3 A;  1PRU A;  4IA8 A;  3U3W A;  1OSL A;  2PUB A;  1EFA A;  2OFY A;  2B5A A;  2HIN A;  3KJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...