2LYSA

Noe-based 3d structure of the monomeric partially-folded intermediate of cylr2 at 257k (-16 celsius degrees)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
MIINNLKLIREKKKISQSELAALLEVSRQTINGIEKNKYNPSLQLALKIAYYLNTPLEDIFQWQPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cold denaturation of a protein dimer monitored at atomic resolution.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Dna binding protein
molecule keywords CylR2
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2lysA00
1ZZCA 4Z58A 1PRAA 2LYLA 4X4GA 2AXZA 2A6CA 2L8NA 1YSEA 1ZZBA 3KZ3A 4X4HA 1ZZ9A 1LLIA 2MEZA 1L1MA 4IWRA 2XJ3A 2R1JL 1PERL 2PUBA 2PUGA 4Y42A 3IVPA 1AU7A 2HSGA 4Z5DA 2AWIA 2O38A 4PU8A 2BNOA 4PU3C 2IV1A 2EBYA 3HZIB 1NEQA 2IUOA 2XCJA 1QP0A 3S8QA 4OB4A 1WIZA 3OQOA 1IC8A 2IVQA 3GN5A 3EUSA 1BDHA 2BNMA 2CSFA 4O8BA 4JCYA 1R63A 1O4XA 2KZ8A 3ZKCA 2OR1L 3KJXA 3OQMA 1RZRD 2JVLA 3BDNA 2GRMA 5A7LA 3GN5B 3UFDA 2PUAA 1JFSA 2L49A 2LCVA 3BS3A 4I6TA 1CJGA 1WH8A 2JCGA 2R63A 2B5AA 3LFPA 3RZZA 2GZUA 3B7HA 3CLCA 1QP4A 1PRVA 1JFTA 4Z5HA 1QQAA 2ICTA 3JXCL 2EWTA 1UXDA 1R69A 3PXPA 2IU7A 2PE5A 1WH6A 2O4AA 1PRUA 2IVGA 4Z59A 1UXCA 3ZHIA 2IVBA 2PIJA 2XSDC 4X4IA 2BNNA 1RIOA 3QF3A 1HF0A 3U3WA 1JWLA 2LYQA 3JXDL 1ZAYA 3CROL 2WIUB 4X4EA 1LCCA 1OCTC 1B0NA 2OFYA 2ICPA 2XI8A 1JH9A 1VPWA 1QQBA 1E3OC 1EFAA 4X4DA 2KEIA 1Y7YA 1ZZ8A 1GT0C 2PUCA 1DW9A 1RZRA 2LYKA 2H8RA 4Z5CA 2PUDA 1RZSA 4X4BA 4X4CA 2MQKA 4X4FA 3G7DA 4YBAA 4MCTA 1OSLA 3SCFA 2PUFA 3R1FA 4NDWA 5K98B 1LCDA 4I6RA 4IA8A 4F8DA 3TRBA 1RPEL 1ZUGA 2AUWA 3QYXA 1POUA 1ADRA 1ZS4A 1ZVVA 3GBFA 4JCXA 4YG7B 1LMB3 3G5GA 3BD1A 4IVZA 2GRLA 2LYJA 3FYMA 3OMTA 1ZZ6A 4J1WA 1QP7A 2XIUA 3SCHA 2LYSA 1LQCA 2EF8A 2KEJA 3LISA 1NERA 3O9XA 3L1PA 2HINA 4GHJA 1ZPQA 4PU7A 4I6UA 2PUEA 1Y9QA 2D5VA 1SQ8A 4YG1A 3VK0A 2AW6A 2AXUA 3KXAA 3SCGA 3DNVB 2WUSR 3FYAA 1QPZA 3QQ6A 3F6WA 3QWGA 4I8TA 2KEKA 4PU4C 4JQDA 3D1NI 2LYRA 3JXBC 4J1XA 2AXVA 3OQNA 1X57A 3CECA 3MLFA 2CROA 1ZZ7A 1WETA 1X2LA 1XWRA 2O49A 4FN3A 1DWKA 4YG4A 3H5TA 3OP9A 1BDIA 1PNRA 3F52A 2PPXA 1S7EA 4YARA 2KPJA 3F51A 3FMYA 3ZHMA 2BJCA 4GQMA 2FJRA 1UTXA 1CQTA 4FBIA 4MCXA 2LYPA
chains in the Genus database with same CATH superfamily
4Z58A 1PRAA 2LYLA 2AXZA 3KZ3A 4X4HA 4IWRA 1LLIA 2XJ3A 2PXLA 2PUGA 2HSGA 2ODRD 2M4HA 2O38A 3S8QA 3OQOA 1IC8A 3GN5A 1BDHA 2BNMA 2CSFA 1R63A 4EKGA 5DT2A 3ZKCA 3GZDC 3TELA 1RZRD 2JVLA 2VEOA 3UFDA 4DE8A 1JFSA 2L49A 4I6TA 1WH8A 2JCGA 2HFZA 4EQZA 1QQAA 2IU7A 2PE5A 3ZHIA 5GAHi 3NZLA 2XSDC 1RIOA 3U3WA 1JH9A 1VPWA 2XXPA 2PUCA 1GT0C 2PUDA 1RZSA 4X4BA 4YBAA 5GAGi 3UWPA 1LCDA 4EZIA 3QYXA 1POUA 1ZVVA 1LMB3 1QP7A 2XIUA 3TEPA 2PXUA 1LQCA 2KEJA 2J7WA 3O9XA 4PU7A 3OKZA 2D5VA 3VK0A 3DNVB 3R09A 3QWGA 2KEKA 4PU4C 2LYRA 3OWQA 2AXVA 3MLFA 2XXQA 3OP9A 1PNRA 4ER6A 3F51A 3FMYA 1QB2A 3ME5A 1DULA 4YG7B 1HQ1A 2L8NA 5DRYA 1ZZ9A 2PUBA 1AU7A 4DE9A 3HZIB 1QP0A 4OB4A 3A9ZA 4JCYA 4O8BA 1O4XA 1QZXA 2OR1L 3KJXA 5A7LA 4EK9A 2PUAA 2FFHA 3RZZA 2GZUA 2PXEA 1UXDA 1R69A 2O4AA 1WH6A 1UXCA 2PIJA 3KL4A 4X4IA 1OCTC 3VWSA 3LQXA 1Y7YA 3A9YA 1ZZ8A 4ER0A 4Z5CA 4X4CA 2MQKA 4X4FA 1OSLA 3SCFA 4NDWA 2YBDA 1RPEL 2PXBA 1U2ZA 3G5GA 3BD1A 4IVZA 2GRLA 2LYJA 2PXTA 3OMTA 2LYSA 3LISA 1NERA 3L1PA 3SR4A 2HINA 4GHJA 2PUEA 1Y9QA 2MXDA 3MEJA 1QPZA 3F6WA 4I8TA 3D1NI 4WVLA 3OQNA 3CECA 3GZCA 2CROA 1ZZ7A 1XWRA 4FN3A 3H5TA 3F52A 2PPXA 4GQMA 1CQTA 4FBIA 2LYPA 1ZZCA 4X4GA 2A6CA 1YSEA 2MEZA 1L1MA 2R1JL 2HCSA 3PE5A 4Y42A 4Z5DA 2PXQA 2AWIA 2IV1A 2EBYA 2IUOA 1WIZA 3GZDA 3G0TA 2KZ8A 5DTQA 3BDNA 2GRMA 3GN5B 2LCVA 3BS3A 1CJGA 1JFTA 2ICTA 3JXCL 3QOXA 4ER5A 4Z59A 1NW3A 2IVBA 2BNNA 3QF3A 2LYQA 3JXDL 2WIUB 4X4EA 1B0NA 3NXHA 2ICPA 2XI8A 1EFAA 2PXVA 2XXAA 1DW9A 3M9LA 4MCTA 5K98B 4IA8A 3TRBA 1ZUGA 1ADRA 1ZS4A 3GBFA 4JCXA 3TFLA 4HRAA 4Q2JA 3FYMA 4J1WA 2EF8A 4I6UA 2AW6A 3SCGA 2WUSR 3NDBB 3FYAA 3JXBC 4J1XA 2LNMA 1WETA 2O49A 1DWKA 1S7EA 5JUWA 4ER7A 3ZHMA 2BJCA 3QFIA 1UTXA 3GUUA 1ZZBA 1PERL 3IVPA 3ZPXA 4PU8A 2BNOA 4PU3C 1NEQA 2XCJA 2IVQA 3EUSA 3OQMA 2PXDA 2LLWA 3QOWA 2R63A 2B5AA 3LFPA 3CLCA 3B7HA 2L1PA 1QP4A 1PRVA 4Z5HA 5DTRA 2EWTA 3PXPA 5DRTA 1PRUA 2IVGA 1HF0A 1JWLA 2J7UA 1ZAYA 3CROL 1LCCA 3NROA 2OFYA 1QQBA 1E3OC 4X4DA 2KEIA 1RZRA 2LYKA 2H8RA 3G7DA 2PUFA 3R1FA 4I6RA 3DM5A 4F8DA 2AUWA 5DSXA 4EKIA 2PXKA 2HCNA 1ZZ6A 2LLVA 3SCHA 5DTMA 1ZPQA 1SQ8A 4YG1A 2AXUA 3KXAA 2JQEA 3A9XA 3QQ6A 2PXFA 4JQDA 4ER3A 1X57A 3SX0A 1X2LA 4YG4A 2V3CC 2PXPA 4OBMA 1BDIA 4YARA 2KPJA 1MFQC 2FJRA 4MCXA
chains in the Genus database with same CATH topology
1ZZCA 4Z58A 1PRAA 2LYLA 4X4GA 2AXZA 2A6CA 2L8NA 1YSEA 1ZZBA 3KZ3A 4X4HA 1ZZ9A 1LLIA 2MEZA 1L1MA 4IWRA 2XJ3A 2R1JL 1PERL 2PUBA 2PUGA 4Y42A 3IVPA 1AU7A 2HSGA 4Z5DA 2AWIA 2O38A 4PU8A 2BNOA 4PU3C 2IV1A 2EBYA 3HZIB 1NEQA 2IUOA 2XCJA 1QP0A 3S8QA 4OB4A 1WIZA 3OQOA 1IC8A 2IVQA 3GN5A 3EUSA 1BDHA 2BNMA 2CSFA 4O8BA 4JCYA 1R63A 1O4XA 2KZ8A 3ZKCA 2OR1L 3KJXA 3OQMA 1RZRD 2JVLA 3BDNA 2GRMA 5A7LA 3GN5B 3UFDA 2PUAA 1JFSA 2L49A 2LCVA 3BS3A 4I6TA 1CJGA 1WH8A 2JCGA 2R63A 2B5AA 3LFPA 3RZZA 2GZUA 3B7HA 3CLCA 1QP4A 1PRVA 1JFTA 4Z5HA 1QQAA 2ICTA 3JXCL 2EWTA 1UXDA 1R69A 3PXPA 2IU7A 2PE5A 1WH6A 2O4AA 1PRUA 2IVGA 4Z59A 1UXCA 3ZHIA 2IVBA 2PIJA 2XSDC 4X4IA 2BNNA 1RIOA 3QF3A 1HF0A 3U3WA 1JWLA 2LYQA 3JXDL 1ZAYA 3CROL 2WIUB 4X4EA 1LCCA 1OCTC 1B0NA 2OFYA 2ICPA 2XI8A 1JH9A 1VPWA 1QQBA 1E3OC 1EFAA 4X4DA 2KEIA 1Y7YA 1ZZ8A 1GT0C 2PUCA 1DW9A 1RZRA 2LYKA 2H8RA 4Z5CA 2PUDA 1RZSA 4X4BA 4X4CA 2MQKA 4X4FA 3G7DA 4YBAA 4MCTA 1OSLA 3SCFA 2PUFA 3R1FA 4NDWA 5K98B 1LCDA 4I6RA 4IA8A 4F8DA 3TRBA 1RPEL 1ZUGA 2AUWA 3QYXA 1POUA 1ADRA 1ZS4A 1ZVVA 3GBFA 4JCXA 4YG7B 1LMB3 3G5GA 3BD1A 4IVZA 2GRLA 2LYJA 3FYMA 3OMTA 1ZZ6A 4J1WA 1QP7A 2XIUA 3SCHA 2LYSA 1LQCA 2EF8A 2KEJA 3LISA 1NERA 3O9XA 3L1PA 2HINA 4GHJA 1ZPQA 4PU7A 4I6UA 2PUEA 1Y9QA 2D5VA 1SQ8A 4YG1A 3VK0A 2AW6A 2AXUA 3KXAA 3SCGA 3DNVB 2WUSR 3FYAA 1QPZA 3QQ6A 3F6WA 3QWGA 4I8TA 2KEKA 4PU4C 4JQDA 3D1NI 2LYRA 3JXBC 4J1XA 2AXVA 3OQNA 1X57A 3CECA 3MLFA 2CROA 1ZZ7A 1WETA 1X2LA 1XWRA 2O49A 4FN3A 1DWKA 4YG4A 3H5TA 3OP9A 1BDIA 1PNRA 3F52A 2PPXA 1S7EA 4YARA 2KPJA 3F51A 3FMYA 3ZHMA 2BJCA 4GQMA 2FJRA 1UTXA 1CQTA 4FBIA 4MCXA 2LYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZZC A;  4Z58 A;  1PRA A;  2LYL A;  4X4G A;  2AXZ A;  2A6C A;  2L8N A;  1YSE A;  1ZZB A;  3KZ3 A;  4X4H A;  1ZZ9 A;  1LLI A;  2MEZ A;  1L1M A;  4IWR A;  2XJ3 A;  2R1J L;  1PER L;  2PUB A;  2PUG A;  4Y42 A;  3IVP A;  1AU7 A;  2HSG A;  4Z5D A;  2AWI A;  2O38 A;  4PU8 A;  2BNO A;  4PU3 C;  2IV1 A;  2EBY A;  3HZI B;  1NEQ A;  2IUO A;  2XCJ A;  1QP0 A;  3S8Q A;  4OB4 A;  1WIZ A;  3OQO A;  1IC8 A;  2IVQ A;  3GN5 A;  3EUS A;  1BDH A;  2BNM A;  2CSF A;  4O8B A;  4JCY A;  1R63 A;  1O4X A;  2KZ8 A;  3ZKC A;  2OR1 L;  3KJX A;  3OQM A;  1RZR D;  2JVL A;  3BDN A;  2GRM A;  5A7L A;  3GN5 B;  3UFD A;  2PUA A;  1JFS A;  2L49 A;  2LCV A;  3BS3 A;  4I6T A;  1CJG A;  1WH8 A;  2JCG A;  2R63 A;  2B5A A;  3LFP A;  3RZZ A;  2GZU A;  3B7H A;  3CLC A;  1QP4 A;  1PRV A;  1JFT A;  4Z5H A;  1QQA A;  2ICT A;  3JXC L;  2EWT A;  1UXD A;  1R69 A;  3PXP A;  2IU7 A;  2PE5 A;  1WH6 A;  2O4A A;  1PRU A;  2IVG A;  4Z59 A;  1UXC A;  3ZHI A;  2IVB A;  2PIJ A;  2XSD C;  4X4I A;  2BNN A;  1RIO A;  3QF3 A;  1HF0 A;  3U3W A;  1JWL A;  2LYQ A;  3JXD L;  1ZAY A;  3CRO L;  2WIU B;  4X4E A;  1LCC A;  1OCT C;  1B0N A;  2OFY A;  2ICP A;  2XI8 A;  1JH9 A;  1VPW A;  1QQB A;  1E3O C;  1EFA A;  4X4D A;  2KEI A;  1Y7Y A;  1ZZ8 A;  1GT0 C;  2PUC A;  1DW9 A;  1RZR A;  2LYK A;  2H8R A;  4Z5C A;  2PUD A;  1RZS A;  4X4B A;  4X4C A;  2MQK A;  4X4F A;  3G7D A;  4YBA A;  4MCT A;  1OSL A;  3SCF A;  2PUF A;  3R1F A;  4NDW A;  5K98 B;  1LCD A;  4I6R A;  4IA8 A;  4F8D A;  3TRB A;  1RPE L;  1ZUG A;  2AUW A;  3QYX A;  1POU A;  1ADR A;  1ZS4 A;  1ZVV A;  3GBF A;  4JCX A;  4YG7 B;  1LMB 3;  3G5G A;  3BD1 A;  4IVZ A;  2GRL A;  2LYJ A;  3FYM A;  3OMT A;  1ZZ6 A;  4J1W A;  1QP7 A;  2XIU A;  3SCH A;  2LYS A;  1LQC A;  2EF8 A;  2KEJ A;  3LIS A;  1NER A;  3O9X A;  3L1P A;  2HIN A;  4GHJ A;  1ZPQ A;  4PU7 A;  4I6U A;  2PUE A;  1Y9Q A;  2D5V A;  1SQ8 A;  4YG1 A;  3VK0 A;  2AW6 A;  2AXU A;  3KXA A;  3SCG A;  3DNV B;  2WUS R;  3FYA A;  1QPZ A;  3QQ6 A;  3F6W A;  3QWG A;  4I8T A;  2KEK A;  4PU4 C;  4JQD A;  3D1N I;  2LYR A;  3JXB C;  4J1X A;  2AXV A;  3OQN A;  1X57 A;  3CEC A;  3MLF A;  2CRO A;  1ZZ7 A;  1WET A;  1X2L A;  1XWR A;  2O49 A;  4FN3 A;  1DWK A;  4YG4 A;  3H5T A;  3OP9 A;  1BDI A;  1PNR A;  3F52 A;  2PPX A;  1S7E A;  4YAR A;  2KPJ A;  3F51 A;  3FMY A;  3ZHM A;  2BJC A;  4GQM A;  2FJR A;  1UTX A;  1CQT A;  4FBI A;  4MCX A;  2LYP A; 
#chains in the Genus database with same CATH topology
 4Z58 A;  1PRA A;  2LYL A;  2AXZ A;  3KZ3 A;  4X4H A;  4IWR A;  1LLI A;  2XJ3 A;  2PXL A;  2PUG A;  2HSG A;  2ODR D;  2M4H A;  2O38 A;  3S8Q A;  3OQO A;  1IC8 A;  3GN5 A;  1BDH A;  2BNM A;  2CSF A;  1R63 A;  4EKG A;  5DT2 A;  3ZKC A;  3GZD C;  3TEL A;  1RZR D;  2JVL A;  2VEO A;  3UFD A;  4DE8 A;  1JFS A;  2L49 A;  4I6T A;  1WH8 A;  2JCG A;  2HFZ A;  4EQZ A;  1QQA A;  2IU7 A;  2PE5 A;  3ZHI A;  5GAH i;  3NZL A;  2XSD C;  1RIO A;  3U3W A;  1JH9 A;  1VPW A;  2XXP A;  2PUC A;  1GT0 C;  2PUD A;  1RZS A;  4X4B A;  4YBA A;  5GAG i;  3UWP A;  1LCD A;  4EZI A;  3QYX A;  1POU A;  1ZVV A;  1LMB 3;  1QP7 A;  2XIU A;  3TEP A;  2PXU A;  1LQC A;  2KEJ A;  2J7W A;  3O9X A;  4PU7 A;  3OKZ A;  2D5V A;  3VK0 A;  3DNV B;  3R09 A;  3QWG A;  2KEK A;  4PU4 C;  2LYR A;  3OWQ A;  2AXV A;  3MLF A;  2XXQ A;  3OP9 A;  1PNR A;  4ER6 A;  3F51 A;  3FMY A;  1QB2 A;  3ME5 A;  1DUL A;  4YG7 B;  1HQ1 A;  2L8N A;  5DRY A;  1ZZ9 A;  2PUB A;  1AU7 A;  4DE9 A;  3HZI B;  1QP0 A;  4OB4 A;  3A9Z A;  4JCY A;  4O8B A;  1O4X A;  1QZX A;  2OR1 L;  3KJX A;  5A7L A;  4EK9 A;  2PUA A;  2FFH A;  3RZZ A;  2GZU A;  2PXE A;  1UXD A;  1R69 A;  2O4A A;  1WH6 A;  1UXC A;  2PIJ A;  3KL4 A;  4X4I A;  1OCT C;  3VWS A;  3LQX A;  1Y7Y A;  3A9Y A;  1ZZ8 A;  4ER0 A;  4Z5C A;  4X4C A;  2MQK A;  4X4F A;  1OSL A;  3SCF A;  4NDW A;  2YBD A;  1RPE L;  2PXB A;  1U2Z A;  3G5G A;  3BD1 A;  4IVZ A;  2GRL A;  2LYJ A;  2PXT A;  3OMT A;  2LYS A;  3LIS A;  1NER A;  3L1P A;  3SR4 A;  2HIN A;  4GHJ A;  2PUE A;  1Y9Q A;  2MXD A;  3MEJ A;  1QPZ A;  3F6W A;  4I8T A;  3D1N I;  4WVL A;  3OQN A;  3CEC A;  3GZC A;  2CRO A;  1ZZ7 A;  1XWR A;  4FN3 A;  3H5T A;  3F52 A;  2PPX A;  4GQM A;  1CQT A;  4FBI A;  2LYP A;  1ZZC A;  4X4G A;  2A6C A;  1YSE A;  2MEZ A;  1L1M A;  2R1J L;  2HCS A;  3PE5 A;  4Y42 A;  4Z5D A;  2PXQ A;  2AWI A;  2IV1 A;  2EBY A;  2IUO A;  1WIZ A;  3GZD A;  3G0T A;  2KZ8 A;  5DTQ A;  3BDN A;  2GRM A;  3GN5 B;  2LCV A;  3BS3 A;  1CJG A;  1JFT A;  2ICT A;  3JXC L;  3QOX A;  4ER5 A;  4Z59 A;  1NW3 A;  2IVB A;  2BNN A;  3QF3 A;  2LYQ A;  3JXD L;  2WIU B;  4X4E A;  1B0N A;  3NXH A;  2ICP A;  2XI8 A;  1EFA A;  2PXV A;  2XXA A;  1DW9 A;  3M9L A;  4MCT A;  5K98 B;  4IA8 A;  3TRB A;  1ZUG A;  1ADR A;  1ZS4 A;  3GBF A;  4JCX A;  3TFL A;  4HRA A;  4Q2J A;  3FYM A;  4J1W A;  2EF8 A;  4I6U A;  2AW6 A;  3SCG A;  2WUS R;  3NDB B;  3FYA A;  3JXB C;  4J1X A;  2LNM A;  1WET A;  2O49 A;  1DWK A;  1S7E A;  5JUW A;  4ER7 A;  3ZHM A;  2BJC A;  3QFI A;  1UTX A;  3GUU A;  1ZZB A;  1PER L;  3IVP A;  3ZPX A;  4PU8 A;  2BNO A;  4PU3 C;  1NEQ A;  2XCJ A;  2IVQ A;  3EUS A;  3OQM A;  2PXD A;  2LLW A;  3QOW A;  2R63 A;  2B5A A;  3LFP A;  3CLC A;  3B7H A;  2L1P A;  1QP4 A;  1PRV A;  4Z5H A;  5DTR A;  2EWT A;  3PXP A;  5DRT A;  1PRU A;  2IVG A;  1HF0 A;  1JWL A;  2J7U A;  1ZAY A;  3CRO L;  1LCC A;  3NRO A;  2OFY A;  1QQB A;  1E3O C;  4X4D A;  2KEI A;  1RZR A;  2LYK A;  2H8R A;  3G7D A;  2PUF A;  3R1F A;  4I6R A;  3DM5 A;  4F8D A;  2AUW A;  5DSX A;  4EKI A;  2PXK A;  2HCN A;  1ZZ6 A;  2LLV A;  3SCH A;  5DTM A;  1ZPQ A;  1SQ8 A;  4YG1 A;  2AXU A;  3KXA A;  2JQE A;  3A9X A;  3QQ6 A;  2PXF A;  4JQD A;  4ER3 A;  1X57 A;  3SX0 A;  1X2L A;  4YG4 A;  2V3C C;  2PXP A;  4OBM A;  1BDI A;  4YAR A;  2KPJ A;  1MFQ C;  2FJR A;  4MCX A; 
#chains in the Genus database with same CATH homology
 1ZZC A;  4Z58 A;  1PRA A;  2LYL A;  4X4G A;  2AXZ A;  2A6C A;  2L8N A;  1YSE A;  1ZZB A;  3KZ3 A;  4X4H A;  1ZZ9 A;  1LLI A;  2MEZ A;  1L1M A;  4IWR A;  2XJ3 A;  2R1J L;  1PER L;  2PUB A;  2PUG A;  4Y42 A;  3IVP A;  1AU7 A;  2HSG A;  4Z5D A;  2AWI A;  2O38 A;  4PU8 A;  2BNO A;  4PU3 C;  2IV1 A;  2EBY A;  3HZI B;  1NEQ A;  2IUO A;  2XCJ A;  1QP0 A;  3S8Q A;  4OB4 A;  1WIZ A;  3OQO A;  1IC8 A;  2IVQ A;  3GN5 A;  3EUS A;  1BDH A;  2BNM A;  2CSF A;  4O8B A;  4JCY A;  1R63 A;  1O4X A;  2KZ8 A;  3ZKC A;  2OR1 L;  3KJX A;  3OQM A;  1RZR D;  2JVL A;  3BDN A;  2GRM A;  5A7L A;  3GN5 B;  3UFD A;  2PUA A;  1JFS A;  2L49 A;  2LCV A;  3BS3 A;  4I6T A;  1CJG A;  1WH8 A;  2JCG A;  2R63 A;  2B5A A;  3LFP A;  3RZZ A;  2GZU A;  3B7H A;  3CLC A;  1QP4 A;  1PRV A;  1JFT A;  4Z5H A;  1QQA A;  2ICT A;  3JXC L;  2EWT A;  1UXD A;  1R69 A;  3PXP A;  2IU7 A;  2PE5 A;  1WH6 A;  2O4A A;  1PRU A;  2IVG A;  4Z59 A;  1UXC A;  3ZHI A;  2IVB A;  2PIJ A;  2XSD C;  4X4I A;  2BNN A;  1RIO A;  3QF3 A;  1HF0 A;  3U3W A;  1JWL A;  2LYQ A;  3JXD L;  1ZAY A;  3CRO L;  2WIU B;  4X4E A;  1LCC A;  1OCT C;  1B0N A;  2OFY A;  2ICP A;  2XI8 A;  1JH9 A;  1VPW A;  1QQB A;  1E3O C;  1EFA A;  4X4D A;  2KEI A;  1Y7Y A;  1ZZ8 A;  1GT0 C;  2PUC A;  1DW9 A;  1RZR A;  2LYK A;  2H8R A;  4Z5C A;  2PUD A;  1RZS A;  4X4B A;  4X4C A;  2MQK A;  4X4F A;  3G7D A;  4YBA A;  4MCT A;  1OSL A;  3SCF A;  2PUF A;  3R1F A;  4NDW A;  5K98 B;  1LCD A;  4I6R A;  4IA8 A;  4F8D A;  3TRB A;  1RPE L;  1ZUG A;  2AUW A;  3QYX A;  1POU A;  1ADR A;  1ZS4 A;  1ZVV A;  3GBF A;  4JCX A;  4YG7 B;  1LMB 3;  3G5G A;  3BD1 A;  4IVZ A;  2GRL A;  2LYJ A;  3FYM A;  3OMT A;  1ZZ6 A;  4J1W A;  1QP7 A;  2XIU A;  3SCH A;  2LYS A;  1LQC A;  2EF8 A;  2KEJ A;  3LIS A;  1NER A;  3O9X A;  3L1P A;  2HIN A;  4GHJ A;  1ZPQ A;  4PU7 A;  4I6U A;  2PUE A;  1Y9Q A;  2D5V A;  1SQ8 A;  4YG1 A;  3VK0 A;  2AW6 A;  2AXU A;  3KXA A;  3SCG A;  3DNV B;  2WUS R;  3FYA A;  1QPZ A;  3QQ6 A;  3F6W A;  3QWG A;  4I8T A;  2KEK A;  4PU4 C;  4JQD A;  3D1N I;  2LYR A;  3JXB C;  4J1X A;  2AXV A;  3OQN A;  1X57 A;  3CEC A;  3MLF A;  2CRO A;  1ZZ7 A;  1WET A;  1X2L A;  1XWR A;  2O49 A;  4FN3 A;  1DWK A;  4YG4 A;  3H5T A;  3OP9 A;  1BDI A;  1PNR A;  3F52 A;  2PPX A;  1S7E A;  4YAR A;  2KPJ A;  3F51 A;  3FMY A;  3ZHM A;  2BJC A;  4GQM A;  2FJR A;  1UTX A;  1CQT A;  4FBI A;  4MCX A;  2LYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...