2LZ6B

Distinct ubiquitin binding modes exhibited by sh3 domains: molecular determinants and functional implications
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
b'AKEYCRTLFPYTGTNEDELTFREGEIIHLISKETGEAGWWKGELNGKEGVFPDNFAVQIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
molecule tags Signaling protein
source organism Homo sapiens
publication title Distinct Ubiquitin Binding Modes Exhibited by SH3 Domains: Molecular Determinants and Functional Implications.
pubmed doi rcsb
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2012-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lz6B00
2K3BA 2AZSA 4F17A 1GRIA 2K7AA 3PVQA 1X69A 1WXTA 5IXFA 3I9QA 2CUBA 1UECA 2C0OA 1WDXA 3I5SA 1VYUA 1NLPC 1UDLA 4AFUC 3EG0A 1JU5C 2LCSA 2M51A 1WA7A 2KRNA 2BZ8A 4D8KA 2VKNA 3GBQA 2RNAA 3LH5A 4IIOA 4OMNA 3M0PA 4LE9A 1BU1A 1UHCA 2GTOA 2ENMA 2KYMA 2ED1A 1WFWA 1W70A 3TVTA 3NGPA 1X43A 5IHNA 2L2PA 3M0QA 2RF0A 3VRYA 1JXMA 4X1VA 1UG1A 2JM9A 2PZ1A 5IH2A 3VS4A 1GCQA 1ABOA 1T0JA 1GCPA 2PTKA 4J9BA 1MV0B 3PVLA 2DMOA 2CREA 4JJDA 1BK2A 4K11A 4RTXA 2EW3A 3EHRA 2CUDA 4A63B 4RTZA 4JJBA 5IHKA 1AOJA 1SRMA 1M8MA 1BB9A 2KRMA 4GLMA 2L0AA 1IO6A 2J05A 4QT7A 2GQIA 3EHQA 2YUPA 1M3AA 5FWCA 1XOVA 2O2OA 2VVKA 3M0SA 4J9FA 1H3HA 1FYNA 4CC3A 1B07A 2F2VA 2O9SA 2YUQA 2HSPA 1SSHA 2BZXA 2GNCA 2DL4A 3EG1A 3M0UA 1SHFA 1U06A 1BBZA 4OMPA 3UA6A 2RPNA 2EGAA 4IIMA 2SEMA 3REBB 2I0NA 3TSWA 1M27C 1UE9A 2LX7A 3UATA 2F2WA 2DBMA 2OJ2A 2DNUA 2EKHA 2LQWA 2SRCA 4ESRA 1U5SA 1Z9QA 1SRLA 1WXBA 5I22A 2RQUA 4Y92A 1E7OA 2DL7A 2RQTA 1K0XA 2FPFA 3M0TA 1OPLA 2L3PA 1H92A 1H8KA 2O88A 4JPBW 1M3CA 1PKSA 1UJYA 2CSQA 2M0YA 1PWTA 3CQTA 4E6RA 1GBRA 4WCIA 1RI9A 3KFVA 1AZGB 2LJ0A 1X6BA 5L23A 4J9HA 1AVZC 4ZNXA 1ZX6A 2DVJA 1VYVA 2EGCA 4JZ4A 4R0KA 1AWJA 2X3XD 2GTJA 2L3SA 4RTYA 2ECZA 2JMAA 2JXBA 4HXJA 2HDAA 4LN2A 4LUEA 2VWFA 2DL5A 1GFCA 2W10A 3M0RA 4AFSC 2LNHB 3VS1A 1A0NB 4FSSA 1HSQA 1JXOA 4Z89A 1TG0A 2D8HA 5EC7A 1UUEA 4DEYA 2H8HA 3JV3A 1YN8A 3UA7A 3EGUA 2XMFA 4OMQA 2JS2A 2KRSA 2KROA 2KYBA 2YUNA 3H41A 1RUWA 5ECAA 1ZUKA 2YSQA 2W0ZA 4J9DA 2NUZA 2DBKA 1EFNA 1QCFA 1W1FA 1ZLMA 1NYFA 1S1NA 1PRMC 4CC4B 2DL8A 1WIEA 2EYXA 5HCKA 1NM7A 2JM8A 5FW9A 1SPKA 1TUCA 2FO0A 2LP5A 4OMMA 1PRLC 1YWPA 2JTEA 1AD5A 3QWYA 2IIMA 1T0HA 2AKLA 4J9IA 5GJWB 1YCSB 1I07A 2A37A 2FRWA 2FPDA 1OEBA 3SEMA 2E5KA 1QKXA 1NYGA 2LQNA 2AK5A 4LUDA 3VS6A 2AKKA 2DF6A 2EYYA 1PNJA 1QWFA 2K2MA 4J9CA 3REAB 1V1CA 1M3BA 4Z88A 2KT8A 1WXUA 3VRZA 1K1ZA 1AZEA 2K79A 4Z8AA 4HVWA 2DYBA 2F2XA 2X3WD 2EBPA 2O9VA 2YDLA 4AFZC 1K9AA 2CH4W 4J9EA 1LCKA 4HCKA 2MCNA 2J06A 1B3QA 2J6OA 2P4RA 1KFZA 4J9GA 1T3SA 2EYZA 2ROLA 2DA9A 2RQWA 2PNIA 1JEGA 2D8JA 2V1RA 2DX1A 1GCQC 2ROTA 2LMJA 1YNZA 1SEMA 4EIKA 1WLPB 2DL3A 2RQRA 4AFQC 1OPKA 1FMKA 1MUZA 2AZVA 2KEAA 3QWXX 1TUDA 3ZL7C 1GBQA 2HBWA 3C0CA 1OV3A 2GGRA 3EG3A 2K9GA 1E6GA 1HJDA 1JO8A 2FRYA 1OOTA 3H0HA 1N5ZA 1YP5A 2BZYA 4M4ZA 2FPEA 2KT1A 1Y0MA 2LJ3A 2EGEA 4AG2C 2HCKA 2BTTA 2GBQA 4RTUA 3NHNA 2O31A 2L3QA 1WYXA 1X2QA 1ZUUA 3THKA 4ORZA 1U3OA 4OMOA 1X6GA 1AWWA 1CKAA 1HD3A 1AEYA 1I0CA 4RUGA 4JZ3A 2MOXA 5FWBA 1GL5A 2A08A 5I11A 2ABLA 4KRTA 2DJQA 2CH4A 4AG1C 1MV3A 2JW4A 5IXBA 2EVRA 1UFFA 1RLQC 3ULRB 3FJ5A 1AWXA 2D0NA 3RNJA 2KXDA 1Y57A 1J3TA 1X27A 2A36A 4RTTA 2KBTA 2JMCA 2A28A 1VYTA 2C0IA 3NPFA 2DM1A 1M30A 4DEXA 1JQQA 1UHFA 1UJ0A 4OMLA 1AWOA 1T3LA 1K76A 2EYWA 1NG2A 2CT3A 1YWOA 3TSZA 2EQIA 2JS0A 2JT4A 2V1QA 1UGVA 4CC7A 1GFDA 3NMZC 4JJCA 2CDTA 1CKBA 3U23A 1QKWA 2OI3A 2ESWA 4HVVA 2FEIA 4LNPA 2RMOA 1ZSGA 3VS7A 2OAWA 1SHGA 1NLOC 2LJ1A 2DRKA 1W6XA 3PE0A 3A98A 2DLPA 1NEGA 3RBBB 3VS0A 4RTVA 1KJWA 3VS2A 1G83A 2EPDA 1G2BA 1Z9ZA 2QDLA 1X2KA 3I5RA 5IHIA 1QLYA 2DRMA 2KE9A 2RQVA 1WI7A 2KXCA 2J6FA 4F16A 3UF4A 2CSIA 1PKTA 2MIOA 3H0IA 1ZUYA 1WX6A 3IQLA 2ED0A 1QWEA 4GBQA 1NEBA 4D8DA 1K4US 2K6DA 1E6HA 3O5ZA 1ZBJA 3R6NA 1CSKA 4HVUA 1KSWA 2HEQA 1RLPC 2NWMA 2RN8A 4RTWA 2J7IA 3EG2A 1PHTA 3VS3A 2B86A 5GJVB 2FG0A 2YT6A 2DE0X 1K0SA 3SHWA 1I1JA 2KGTA 1KIKA 2D1XA 2C0TA 2YUOA 2KNBB 3VS5A 1ARKA 2J6KA 4F14A 3H0FA 2LZ6B 2DILA 1ABQA 2G6FX 4CC2A 2KR3A 2CT4A 1UTIA 3I35A 1VA7A
chains in the Genus database with same CATH superfamily
2AZSA 4F17A 1UGQB 1GRIA 3PVQA 1X69A 3GP8A 2G3RA 3X26B 3CMEA 1UECA 3N5BB 2QQ9A 1YJ9A 1WDXA 4KGZB 3I5SA 1VYUA 1UDLA 4AFUC 1WA7A 2KRNA 3OYFA 2VKNA 3GBQA 3CBOA 1Q7YU 1EIFA 1N9SA 5AYFA 1DJ7B 2GTOA 1VQ8T 2ENMA 5LJ5g 4HA8A 3OYNA 3SWNC 1W70A 2IPOB 4XU1A 2EJ9A 3NGPA 5LJ3d 8ATCB 4BACA 2P0KA 4A53A 5D6XA 2RF0A 3CC2Q 3CCST 3HL8A 1UGPB 4X1VA 1UG1A 1OZ2A 4J6YA 4PJJA 1G3TA 4JS4A 2K5FA 3RKWA 1GCQA 5GAMe 3OSVA 2L3RA 4MZPA 3J81E 4QQDA 4FSXA 5LJ5d 2JN0A 4JJDA 1VQKQ 4K11A 2EJGA 4E7ZA 3CCRQ 4YTLA 1FMWA 1BB9A 2J05A 3TCJA 4QQGA 2JUFA 3G6EA 4BI3A 3ZFJA 3CCEQ 2EKOA 5FWCA 2LCCA 1Q86R 1XOVA 1BIAA 4J9FA 1H3HA 5CKEA 2EQKA 2E6NA 2ATCB 2F2VA 2FZGB 2O9SA 4ZGEB 3I55T 2BZXA 2GNCA 3QBYA 2DL4A 5GAMf 2MWOA 4C5HA 1SHFA 1U06A 3LW5E 1KHIA 2RI5A 3E9FA 5FRNA 4BD3A 1Y7XA 2SEMA 5FU6B 2LX7A 2ZPHB 4M75E 3UATA 2F2WA 2OJ2A 2LQWA 2SRCA 4ESRA 1Z9QA 4PLIA 1SRLA 4Y92A 1OPLA 1RAIB 4A4FA 1Y07A 2O88A 2DVEA 4E7LA 1PKSA 5GAOp 2CSQA 1PWTA 3CQTA 2CP5A 3META 4MMLA 4WCIA 3KFVA 3CCLT 3S3OA 4LD6A 4DBFA 4KGXB 1BCOA 2VASA 5GAMj 4ATOA 4JZ4A 1AT1B 2RHYA 2RH2A 4JDSA 2HDAA 5GANf 2FB7A 2VWFA 1M1KR 2DZCA 4AFSC 1QVFS 4PFZA 3JCMc 3QYHB 1Q86U 1ZA1B 3H8ZA 1OQKA 4J7FA 3DB4A 4J83A 2H8HA 1YN8A 3EGUA 4BUGA 3LWIA 1VQPA 4C8QF 3OYHA 1ZUKA 2W0ZA 2DBKA 2E41A 2WSCE 1W1FA 2E3IA 3FB9A 3GF5A 2EYXA 3VJPA 2KK4A 4M7DG 2JM8A 2FO0A 2HKQB 4OMMA 1PRLC 1U1SA 1YWPA 2JTEA 3LYIA 3EFSA 1YBYA 1I81A 4LXCA 5CR2A 4KUDK 2I2LA 2AKLA 4RCBA 5CQXA 2OTLQ 2O01E 2IG0A 1I07A 4M77B 2A37A 2PVOB 1G3YA 1D1BA 1RACB 4N0AC 4O6JA 1UB4A 2XIDA 3HPWA 2K57A 1KK7A 4ZTFA 4LUDA 3VS6A 4ZGJB 3CBPA 2V8JA 2K2MA 5FU7B 3OS0A 1V1CA 4IUPA 1WXUA 3CMET 3C95A 1VOMA 1VQOA 2V26A 1AZEA 3CC7A 4Z8AA 3OYYA 4E7KA 1KHCA 4B6MA 4C92F 1VQ8Q 1M2VA 4J9EA 1QVGS 4MZMA 2BIVA 3RESA 1B3QA 2NYSA 2DA9A 2RQWA 4LDUA 2D8JA 2V1RA 3P8DA 1JJ2S 5D7UA 5I2MA 4Q5WA 1YJWA 4FYXB 1IGQA 4BE2A 1KG1A 4KH1B 1QVPA 2DL3A 3PGGA 1W2BA 3QG1A 1OPKA 3HFOA 4EMKB 3HFNA 2V8IA 3ZL7C 5CO7A 2A3LA 3EG3A 2K9GA 1E6GA 1S72Q 1KQSA 3A8HB 1HJDA 1O75A 2RJDA 3H0HA 1N5ZA 2DFUA 2KT1A 2EGEA 3BFMA 3NHNA 2O31A 5AT1B 3E19A 1WYXA 3G6EQ 1PC0A 4ORZA 1YI2A 4M75B 1X6GA 4XU3A 2L8DA 1SSFA 1CKAA 4OB0B 4C92G 1AEYA 1I0CA 4HCZA 2PQWA 3BDUA 5FWBA 5LJ5f 1KC8R 4LDXA 2O4XA 3JCMg 2COWA 4JRPA 1VQMA 2QXFA 4HCCA 3I55A 5KYYA 1UFFA 4JJNK 2DTHA 4M78C 2HZYA 4M7AG 5GMKl 2EQJA 2KXDA 2O4XB 1NJIU 1IREB 4RTTA 3A1PA 3CCUA 2KBTA 4O5VA 2JMCA 3NPFA 1VYTA 1YJNA 2DM1A 2QI2A 1UHFA 1K76A 4OB3B 2QQBA 2ZPBB 1KC8U 2ZPGB 4CC7A 2JVVA 1GFDA 3CCJT 3U23A 3GIBA 2ESWA 5J26A 4HKEA 3ZEHA 3MEAA 1VQ9T 2ZZDA 2RMOA 3JCMJ 1NJIR 3VS7A 1VQ6Q 2DRKA 4AMCA 3PE0A 4M7DB 3A98A 1VQMT 1Q82C 4NOYA 5CQYA 2L5QA 3CCMT 3VS2A 1G2BA 3CXCP 1KD1U 1LOJA 4PJOF 2MF2A 3I5RA 4IKFA 2KE9A 2LVMA 1WI7A 4M7DC 5CIUA 4F16A 3MEUA 1WX6A 2RK2A 1YJ9Q 5A0GA 1Q82U 5FROA 2M1HA 1CSKA 1D0YA 4HVUA 1PD1A 4GLKA 3M56A 1W2BP 4DBQA 1LPLA 3SWNB 2NWMA 3L2ZA 4PFOA 2HQHA 2YXYA 4XTZA 1M90C 1I1JA 4GY5A 1D0XA 3QJ6A 4C0GA 2KNBB 2J6KA 1WQWA 3CPWP 1QVFA 2G6FX 3OW2S 2KR3A 2ZGWA 2ZPFB 4M75A 1VA7A 2DXCA 3CPFA 4JRIA 1ZQ1A 3G71A 3QZ5B 5IXFA 1VQ4Q 3OS1A 2BUDA 2C0OA 2VB6A 3AT1B 1NLPC 3JCMP 4PJMA 2KY9A 4QVCA 3OS5A 2KMTA 4C0ZA 4KH0B 1D3BA 3EGDA 1R0BG 2QEXT 4IIOA 1JBMA 1X01A 3M0PA 4OMFB 2EYQA 2ED1A 4IUQA 3BW1A 5GMKe 1WFWA 1NZ9A 3QDRB 4E7IA 2YLBA 1OU9A 5KE2A 3L2VA 1M8VA 2K3XA 3RKYA 4C92B 2M16A 4AT1B 3VS4A 2QA4A 2YRCA 3OYLA 3OA6A 1GCPA 3MEVA 2PTKA 2FYKA 4HT8A 1MV0B 2XI9A 3KBGA 3CMAQ 5FRMA 3JB9F 4KT0E 2CUDA 4C92C 2XDDA 1AHJB 3L2QA 4M77A 1SRMA 2RHZA 3EGXA 2YHTA 2KRMA 3CCVQ 4QT7A 5J3BA 5GAMh 4JLGA 1M3AA 1M5Q1 4A4EA 5L8RE 5I2SA 2VVKA 3P8BB 5GAOl 4MDWA 1XNIA 1FYNA 3OMCA 2RM4A 4A4KA 3GLXA 2YUQA 1SSHA 2E5QA 3EFOB 2DPPB 1MMGA 2QK0A 5GANh 3M0UA 1KQSS 1B34B 2HAXA 2XDPA 1VQMQ 4D6WA 3G7ZA 2EGAA 3KXTA 3REBB 3TU4K 2I0NA 3TSWA 3DB3A 1M27C 1UE9A 2VC8A 1RI0A 1VQKA 2QGFB 1VQNA 3X25B 1JJ2A 3CCJQ 1E7OA 3F70A 5GAN2 1VQLA 3PT9A 3CCQA 2KI7A 2L3PA 1H92A 3Q1JA 1H8KA 1RAHB 2YRDA 3BDLA 4JPBW 1K9MU 2R5MA 1M2OA 1UJYA 4F7UB 1KQ1A 2M0YA 4M7DF 5LJ5h 1WHHA 1TS9A 2F5KA 3GNFB 4BY6C 3QSUA 1RI9A 5CKHA 3FC3A 3LGFA 2NUTA 3FDRA 5L23A 4J9HA 1VUBA 3CPWA 1AVZC 4ZNXA 1ZX6A 5GAN8 1VYVA 2EGCA 1ACMB 2QQRA 1IXDA 1OU8A 4EMKC 1HXDA 4KUIA 4RTYA 2ECZA 3OYBA 2JXBA 4C5IA 2ZPEB 4LN2A 2D6FA 2BE7D 2LTOA 3HKSA 1WNLA 2E10A 1N8RC 4ELZC 1A0NB 2RK1A 2RJFA 5EG2A 4FSSA 1JXOA 4Z89A 3NTKA 4NL2A 5IAYA 5EC7A 4C92A 1VQKT 4RCCA 4M7AF 2JS2A 3EG9A 2YUNA 3CCET 1RUWA 1PCXA 5ECAA 3V8LA 4J7IA 2NUZA 2DEQA 3WVDB 2HD0A 3RERA 5HCKA 4C5EA 2DTOA 5DY9A 2LP5A 4A54A 1AD5A 4M77G 2H3EB 4N4GA 3QWYA 4J9IA 4CRIA 1SF9A 3S6WA 3VUZA 3CCMQ 3QO3A 1RAGB 4C0FA 1YJWQ 2B8AA 2P0QA 3X28B 3UDCA 2FPDA 1VQ6T 1B34A 4Y28E 1OEBA 4XTXA 3MP1A 2LCLA 2BKDN 2LQNA 2DF6A 1TXQA 1PNJA 4M7AE 1S72A 2E4HA 2PU9B 3G71Q 2HKNA 3REAB 5D6WA 3JB9D 1QMCA 4FL6A 4XTUA 1BI0A 1IHVA 1IZ6A 1IHWA 2K79A 1VQ4T 2F2XA 2EBPA 1ZHIA 3JCMh 1K9AA 2RB6A 4HCKA 4TVRA 2DD5A 1YHQT 2VGNA 3CC7T 3V7CA 2QA4T 2EYZA 3MPUB 2ROLA 2OTLA 1JEGA 1M1FA 2ROTA 3HRUA 1RABB 2EJFA 2LMJA 3RUXA 4EMHA 3V7SA 2CKKA 2RJEA 1FMKA 3TREA 1YITA 4ZN3A 1PSFA 5GAN5 3JB9G 2GF7A 3C0CA 5LL6S 2Y4YA 1OYXA 1ZSZA 2L89A 3G4SQ 2FRYA 2DAQA 5CVIA 3CCUQ 4XAXB 4M78G 2E1HA 5CKDA 1Y0MA 5GANg 4MMKA 2EAYA 2HQXA 3THKA 1U3OA 3J80E 2YRVA 1R0CB 2M9UA 1YHQA 1W4SA 1VIEA 2K5IA 4JZ3A 2MOXA 1GL5A 4BDZA 1WHJA 2QYZA 3CCSA 2ZCFB 5IXBA 2ZAEA 1ZSZC 4E7SA 1RLQC 3ULRB 4C8QA 4QVDA 1M2VB 3MEWA 4IUVA 1J3TA 1TUGB 2R57A 5DLOA 2DXTA 2JTFA 4B9WA 2DTIA 1JJ2P 1T3LA 2EFIA 2LT1A 3UPUA 2CT3A 3TSZA 2JT4A 2EWNA 3HTRA 3G71T 1CKBA 1BCMA 2VV5A 2OI3A 2DERA 4HVVA 4JS5A 2GFUA 5HK0A 4FIBA 1SHGA 5LJ5j 4M7AA 7AT1B 5GAOr 2RI3A 1TWBA 5FU7C 4RTVA 4F7UE 5LJ5e 1N6AA 1KJWA 5HKCA 4PJLA 2CZ7B 1X2KA 1N9RA 5IHIA 1QLYA 2DRMA 4OB2B 4PJOG 2KXCA 5LJ3j 4PK4A 3QUIA 3UF4A 2CSIA 1O9SA 3JSCA 2LNVA 1Q95G 4FT4A 4M77E 1K4US 4D8DA 2DO3A 2K6DA 1E6HA 2EQUA 1ZBJA 1F1BB 2P84A 1P92A 1Q81R 3JCMX 4DBRA 2RN8A 4J8OA 3EG2A 1PHTA 2B86A 5GJVB 2YT6A 3M9QA 3CEYA 2FL7A 3SHWA 5KYUB 3QDFA 3KUFA 5KYUA 2D1XA 2C0TA 1VQ7A 4F14A 1MMDA 4CC2A 1K8AR 3A8GB 3MP6A 2HL3A 2K3BA 3TQ7P 2K7AA 5LJ3h 1WXTA 2QQAA 3AHUA 2FVUA 3FRNA 3QPHA 1M1KU 3CCVA 3JB9J 1VIFA 5GAOm 2BZ8A 1VQ8A 4D8KA 2RNAA 3LH5A 2ZPIB 1BU1A 2E12A 4R56A 2KYMA 2D9TA 3M4GA 3TVTA 4NL3A 2Z0WA 4JRQA 4M77C 1U8RA 4XTVA 3VRYA 1VQ7T 2PZ1A 3PNWC 4LDYA 4E47A 4DBHA 2QAZA 2X9HA 1TH7A 1C6VX 3HP9A 1T0JA 1BI1A 2E3HA 3M53A 1MMNA 3OSSC 3PVLA 2CREA 3EHRA 4RTZA 2OX7A 5IHKA 3PTAA 1R77A 2HQEA 1M8MA 4GLMA 3CCVT 1IO6A 1I8FA 4FT2A 3EHQA 2YUPA 3I56T 2E6ZA 3CXCA 3CCRT 4VUBA 2O2OA 5KYXB 1X75C 3FLGA 3M0SA 1YCYA 3SB2A 1B07A 3M58A 2HSPA 4N4HA 5GAN4 1K9MR 4UC4A 3MP8A 4DOVA 1M1KC 5KYYB 3CCSQ 2LQ8A 1M9SA 1D09B 1BBZA 3DLMA 3UA6A 2YLCA 1OZ3A 2QA4Q 4IIMA 3ZBDA 3CD6A 3G4ST 5FLXE 4ZTJA 3OYIA 4OVAA 2DBMA 2MK5A 2DNUA 2EKHA 3RDVA 1U5SA 2HNIA 2RQUA 2RQTA 3WVEB 3VUBA 2VGMA 1K0XA 2R58A 3A8LB 2E64A 3M0TA 1V76A 1N8RU 4ME7A 4E6RA 3M59A 4M75D 2X4JA 2DVJA 3CC4T 1I5LA 2HSEB 3M5AA 1K8AC 4OP0A 1VQ6A 1D3BB 3EGDB 2GTJA 2L3SA 4B9XA 1WJRA 1YJWT 2Y90A 4LUEA 2OTLT 4BB7A 2NUPB 1QVGA 3M0RA 4WTOB 1D0ZA 1WPYA 5LJ3f 2CZ6B 1Y71A 2OTJA 2D8HA 1UUEA 1VQLT 4DEYA 3GOXA 3JV3A 5HK3A 2JTMA 5GANd 3UA7A 4OMQA 1WHMA 2JZ2A 1VQLQ 2KRSA 2KROA 3SDZA 2DETA 3EGXB 3H41A 4WF2A 2KDSA 1RAEB 1YITT 4J9DA 1YJ9T 3LWHA 1ZLMA 1NYFA 1S1NA 1PRMC 3A8MB 2QTXA 4LD9K 5A0DA 1I4K1 4FCYA 4HT9A 5FW9A 3MO8A 1SPKA 1TUCA 1QVGP 3JCMf 4PKCC 4R55A 3OW2P 1XTDA 2IIMA 1T0HA 5GJWB 2LC4A 2JNGA 4C8QD 2A0FB 2XD0A 4OGEA 1ZA2B 3M55A 2P4TA 4X9DA 2MAMA 2GFAA 4KULA 1NYGA 5C0MA 4M78B 4M78A 2EYYA 4J9CA 4FM4B 3VV0A 3QKJA 1VQOT 3EH1A 3CMEQ 1K9MC 1LJOA 2KT8A 2NUTB 3VRZA 3WXMB 1K1ZA 1FWZA 3OYMA 2AIRB 3VYGA 2PUKB 2A7YA 2CZ1B 4ZGDB 4AFZC 1H3ZA 4C0DC 3R6OA 4HCBA 5IN1A 1LCKA 2Y4XA 2J06A 2C06A 2E70A 5KCHA 2BE9B 2VXEA 2QQSA 2JJ9A 3JCMb 1QCNA 1KD1C 2PNIA 3CCMA 3L42A 4PJOA 1GCQC 1ZSZB 4BE0A 3ER0A 1IRXA 3CC2A 1YNZA 1SEMA 1JB0E 1WLPB 4E7JA 2RQRA 1NPPA 3QYGB 4AFQC 3HSBA 3OMGA 5GMKm 2HBWA 1YIJA 5FU6C 1OV3A 1BYMA 3CMAA 2KAFA 2WSEE 5GAN3 1YP5A 3JRZA 2BZYA 4M4ZA 2LJ3A 4M78F 4RMOA 3C4SA 2NUPA 2HCKA 2BTTA 2GBQA 2CP7A 3X24B 1VQ5T 1X2QA 5GMKh 2CP0A 3JB9H 1NJIC 4PFPA 4L6V5 4OMOA 1NPRA 1AWWA 1K73U 3RIRA 4M7DE 3CD6T 1V29B 2A08A 2E65A 2ABLA 4IURA 3JCMd 2DJQA 1MV3A 3CC2T 2LT4A 2K5LA 4QKUA 1SKUB 4RKUE 5KYXA 2CGHA 1MHNA 3FJ5A 4XU2A 3C94A 3RNJA 3GNGA 5DLQE 2DYIA 1IGUA 1YI2T 1VQNQ 1Y57A 3CC4A 3G4SA 1X27A 2JOYA 2OTJT 2A36A 3OYJA 3BY7A 1BI3A 4X34A 5CK9A 2A28A 2C0IA 4FW2A 2RO0A 3UWNA 1M30A 4DEXA 5I21A 1JQQA 4J6XA 4PJOD 2DKGA 4F7UA 2MPXC 2XICA 1NG2A 4OB1B 3NTIA 3NMZC 4JJCA 3OYEA 2MI6A 4LNPA 1XJWB 2RD1A 1EZZB 1VQ9A 4EMGA 1IB8A 1W6XA 4M7DD 2V8KA 3LGLA 1NEGA 1KC8C 1K8AU 3VS0A 1M90U 4A4HA 1FX7A 1PSEA 1G83A 2EPDA 2COZA 4PJOB 1Z9ZA 2QDLA 4PLLA 4BE1A 4XU0A 4XK8E 5J39A 2OTJQ 1OX8A 1VQNT 1D1AA 2EQMA 4F7UG 4L59A 1G3SA 1Q81C 2MIOA 3FEOA 3IQLA 2ED0A 1QWEA 2DIGA 5IT9E 4GBQA 4PJOE 1NEBA 3O5ZA 3JB9I 3R6NA 3MCAB 4LDVA 3P8HA 2X4YA 2HEQA 1YFNA 2LX9A 4V2SA 4RTWA 1G5VA 2X4WA 2F5TX 1KIKA 1Q82R 1ARKA 4C8QE 2LZ6B 1Q7YR 2DILA 1D1CA 3E2UA 2CT4A 3VYHB 4ELYC 2KQWA 5GAN6 1K73R 3CCRA 4JLIA 2WSFE 3RMSA 3I9QA 3CCLQ 2CUBA 1C0MA 4MDXA 1KQ2A 3L1AA 3EG0A 1JU5C 2LCSA 2M51A 3A8OB 3OW2A 1VQOQ 2RJCA 3CC7Q 4M78D 3CCEA 1K73C 4OMNA 4LE9A 2X35A 1UHCA 1YIJT 4J6WA 4EMKA 5LJ3e 2PVDB 3OY9A 1X43A 5IHNA 2L2PA 3M0QA 1JXMA 5CKFA 2JM9A 2KVQG 5GAMd 5IH2A 1YITQ 5KCOA 2QASA 1ABOA 3C12A 3OYAA 4J9BA 2RHUA 2DMOA 1BK2A 4RTXA 3HRTA 3G6ET 2EW3A 4EPCA 1OX9A 4CI0C 2K4YA 2AHJB 4A63B 3PFSA 4JJBA 3V8KA 1QP3A 1AOJA 2F1LA 3EG9B 2L0AA 4P5NA 5GAMg 2CP3A 2GQIA 1KD1R 4FYWB 5CKBA 1S72T 3DKMA 3QHSA 1YHQQ 1LNXA 3M54A 2FZKB 4CC3A 2PVGB 3JCMe 4C5GA 1N8RR 3EG1A 4OMPA 3NFCA 2RPNA 4C8QB 4RG8A 3PMIA 3OYCA 3JCMQ 3QXEB 1QCOA 3CC4Q 1WXBA 5I22A 5HY6A 2DL7A 1C1AA 1TU0B 2IVWA 5KYWB 2FPFA 5KYWA 3QJYA 3HRSA 3OBWA 3JAME 2VUBA 1M3CA 3CCQT 1N27A 3TEEA 3PIOA 3JCMW 2X4XA 2YWWA 1Y96B 1GBRA 2KSSA 1AZGB 1M4ZA 2LJ0A 1X6BA 1ZBXA 3MKDA 5GAOq 3OBYA 3PIPA 3BE3A 4R0KA 1AWJA 2X3XD 4M7DA 1BIBA 2JMAA 3I56Q 4HXJA 3DLLA 3E1SA 5KYNA 1I5OB 4M7AC 3L2UA 3RMQA 1WHGA 4ZN1A 2DL5A 1OULA 1GFCA 4N0AA 2W10A 5GMKj 2LNHB 3VS1A 1NBEB 1HSQA 4MZTA 3CD6Q 1B7TA 1TG0A 1JRIA 1QP2A 4PNOA 3RKXA 1RAAB 5M9OA 4KBMB 1FXXA 4M7AB 5CCAA 3NTHA 3VKIA 2XMFA 2K3YA 2KYBA 1VQ5A 1QW1A 4PJNA 2XK0A 2CS7A 2OAUA 4QVZA 2YSQA 5DM7R 1G3WA 1EFNA 1QCFA 2DJZA 3T9NA 4CC4B 2DL8A 3M57A 1WIEA 1BKBA 2DK3A 1NM7A 4PJOC 3LH0A 2LQKA 3X20B 2QEXQ 3V7RA 1G8XA 5KH6A 4RG2A 2DXUA 3INZA 5A0LA 1UGSB 2QTVA 2RA2A 3SFMA 1LVKA 3CBMA 3EH2A 4M77F 1YCSB 1VQ7Q 3OYKA 2FRWA 2DEUA 4PL6A 1MNEA 4L5GA 1RL2A 3SEMA 2E5KA 1QKXA 3OQ5A 4XTYA 4Z02A 3S3NA 3FJPA 2AK5A 2AKKA 4FW1A 4FYYB 4IUUA 1QWFA 2HMAA 2CZ0B 1MGQA 1TSFA 3M4YA 2RI2A 4BY6B 2F69A 1WZOA 2CP2A 2XU8A 1M3BA 2D0QB 2M0OA 4DOWA 4Z88A 1VQ4A 4FU6A 2R5AA 4BDYA 2DIQA 3A5ZB 4HVWA 2DYBA 2X3WD 3GPLA 2O9VA 4DQ2A 2YDLA 4QQ6A 4E2FB 4BI4A 5C6SA 4M78E 2CH4W 1X6OA 1MMAA 2LDMA 2MCNA 1U1TA 1YI2Q 1WGSA 2J6OA 2P4RA 2M02A 2RHXA 1KFZA 4J9GA 1T3SA 3E9GA 4F04B 5GANj 2QGGA 5GMKi 2DX1A 1HYOA 1QQJA 4EDUA 2XDBA 2AT1B 3I55Q 4EIKA 1Y96A 2LRQA 1MUZA 3EAEA 2AZVA 2KEAA 3QWXX 5GANe 1TUDA 2DZ9A 3ASKA 1GBQA 1WQ7A 3SD4A 2GGRA 1JO8A 2DXBA 1OOTA 4NS5A 3HHTB 5LJ3g 4Y91A 4BI8B 2FPEA 5GAN7 3OS2A 1UEBA 1RADB 4C92E 3EFRA 4AG2C 4RTUA 2HBPA 9ATCB 3CXCS 1W2BS 2L3QA 4FYVB 1UGRB 1ZUUA 1EX4A 2RHIA 1WJQA 1NE8A 4ANJA 1HD3A 2GCXA 2COYA 2FZCB 4RUGA 3EFOA 2EIFA 4M75G 3L2RA 5I11A 1GXIE 4KRTA 2CH4A 4AG1C 2JW4A 3ME9A 2EVRA 1BI2A 5GAOn 3RR6A 1AWXA 1WHLA 3CMAT 4N4IA 1PD0A 2D0NA 4II1A 2VYTA 1YIJQ 5CAIA 4J5YA 4DA4A 1TTHB 1FMVA 4QW2A 3SWNA 1Q81U 2CP6A 3CCJA 2XG8D 1XQHA 4IUTA 3CCQQ 1UJ0A 3D7SB 4OMLA 2VXFA 1M1GA 1AWOA 2H3JA 2EYWA 1YWOA 3L2WA 2EQIA 3VU3C 2JS0A 2V1QA 1UGVA 4LDWA 2QG9B 4C92D 3CPWS 3PMTA 8AT1B 2CDTA 5KE3A 5A2QE 2X51A 1QKWA 1QVFP 4C8QC 3OYDA 3O8VA 2FEIA 2FHDA 1ZSGA 2K2VA 3MHXA 4OGCA 1OI1A 2OAWA 1WHKA 1NLOC 2GQVA 2LJ1A 4XTWA 4M7AD 2DLPA 3I56A 1TOVA 3RBBB 3J7AF 4M75F 1HK9A 2CYZB 1SG5A 4E7HA 4M77D 2NLUA 3H9NA 1Q86C 3G1JA 3H6ZA 1R8OB 3URGA 4JRKA 2RQVA 4JUVA 2DD4A 4C8QG 4XQ3A 4C0DB 2J6FA 1VQPQ 1YJNQ 6AT1B 1PKTA 1VQ5Q 3QIIA 1PG5B 1RAFB 3FIFA 4F7UF 3H0IA 1ZUYA 1MNDA 3CCLA 2XKOC 3OB9A 2XHCA 3V8JA 1PM3A 2MYSA 2MMPA 1VQPT 2WACA 1KSWA 1H641 3LX7A 3LLRA 1VQ9Q 1RLPC 1Q7YC 4KGVB 2J7IA 3OYGA 3QZ9B 3VS3A 2QDYB 2QEXA 4A4GA 3JCMV 2FG0A 1WJSA 2DE0X 1K0SA 2MWPA 2KGTA 3UT1A 5D6YA 2YUOA 2P0PA 3VS5A 3CCUT 4M75C 3MJXA 4OF1A 3H0FA 1YJNT 1ABQA 4X9CA 1UTIA 1M90R 2PUOB 1KQSP 3I35A 2HL5C 3S3MA
chains in the Genus database with same CATH topology
2K3BA 2AZSA 4F17A 1GRIA 2K7AA 3PVQA 1X69A 1WXTA 5IXFA 3I9QA 2CUBA 1UECA 2C0OA 1WDXA 3I5SA 1VYUA 1NLPC 1UDLA 4AFUC 3EG0A 1JU5C 2LCSA 2M51A 1WA7A 2KRNA 2BZ8A 4D8KA 2VKNA 3GBQA 2RNAA 3LH5A 4IIOA 4OMNA 3M0PA 4LE9A 1BU1A 1UHCA 2GTOA 2ENMA 2KYMA 2ED1A 1WFWA 1W70A 3TVTA 3NGPA 1X43A 5IHNA 2L2PA 3M0QA 2RF0A 3VRYA 1JXMA 4X1VA 1UG1A 2JM9A 2PZ1A 5IH2A 3VS4A 1GCQA 1ABOA 1T0JA 1GCPA 2PTKA 4J9BA 1MV0B 3PVLA 2DMOA 2CREA 4JJDA 1BK2A 4K11A 4RTXA 2EW3A 3EHRA 2CUDA 4A63B 4RTZA 4JJBA 5IHKA 1AOJA 1SRMA 1M8MA 1BB9A 2KRMA 4GLMA 2L0AA 1IO6A 2J05A 4QT7A 2GQIA 3EHQA 2YUPA 1M3AA 5FWCA 1XOVA 2O2OA 2VVKA 3M0SA 4J9FA 1H3HA 1FYNA 4CC3A 1B07A 2F2VA 2O9SA 2YUQA 2HSPA 1SSHA 2BZXA 2GNCA 2DL4A 3EG1A 3M0UA 1SHFA 1U06A 1BBZA 4OMPA 3UA6A 2RPNA 2EGAA 4IIMA 2SEMA 3REBB 2I0NA 3TSWA 1M27C 1UE9A 2LX7A 3UATA 2F2WA 2DBMA 2OJ2A 2DNUA 2EKHA 2LQWA 2SRCA 4ESRA 1U5SA 1Z9QA 1SRLA 1WXBA 5I22A 2RQUA 4Y92A 1E7OA 2DL7A 2RQTA 1K0XA 2FPFA 3M0TA 1OPLA 2L3PA 1H92A 1H8KA 2O88A 4JPBW 1M3CA 1PKSA 1UJYA 2CSQA 2M0YA 1PWTA 3CQTA 4E6RA 1GBRA 4WCIA 1RI9A 3KFVA 1AZGB 2LJ0A 1X6BA 5L23A 4J9HA 1AVZC 4ZNXA 1ZX6A 2DVJA 1VYVA 2EGCA 4JZ4A 4R0KA 1AWJA 2X3XD 2GTJA 2L3SA 4RTYA 2ECZA 2JMAA 2JXBA 4HXJA 2HDAA 4LN2A 4LUEA 2VWFA 2DL5A 1GFCA 2W10A 3M0RA 4AFSC 2LNHB 3VS1A 1A0NB 4FSSA 1HSQA 1JXOA 4Z89A 1TG0A 2D8HA 5EC7A 1UUEA 4DEYA 2H8HA 3JV3A 1YN8A 3UA7A 3EGUA 2XMFA 4OMQA 2JS2A 2KRSA 2KROA 2KYBA 2YUNA 3H41A 1RUWA 5ECAA 1ZUKA 2YSQA 2W0ZA 4J9DA 2NUZA 2DBKA 1EFNA 1QCFA 1W1FA 1ZLMA 1NYFA 1S1NA 1PRMC 4CC4B 2DL8A 1WIEA 2EYXA 5HCKA 1NM7A 2JM8A 5FW9A 1SPKA 1TUCA 2FO0A 2LP5A 4OMMA 1PRLC 1YWPA 2JTEA 1AD5A 3QWYA 2IIMA 1T0HA 2AKLA 4J9IA 5GJWB 1YCSB 1I07A 2A37A 2FRWA 2FPDA 1OEBA 3SEMA 2E5KA 1QKXA 1NYGA 2LQNA 2AK5A 4LUDA 3VS6A 2AKKA 2DF6A 2EYYA 1PNJA 1QWFA 2K2MA 4J9CA 3REAB 1V1CA 1M3BA 4Z88A 2KT8A 1WXUA 3VRZA 1K1ZA 1AZEA 2K79A 4Z8AA 4HVWA 2DYBA 2F2XA 2X3WD 2EBPA 2O9VA 2YDLA 4AFZC 1K9AA 2CH4W 4J9EA 1LCKA 4HCKA 2MCNA 2J06A 1B3QA 2J6OA 2P4RA 1KFZA 4J9GA 1T3SA 2EYZA 2ROLA 2DA9A 2RQWA 2PNIA 1JEGA 2D8JA 2V1RA 2DX1A 1GCQC 2ROTA 2LMJA 1YNZA 1SEMA 4EIKA 1WLPB 2DL3A 2RQRA 4AFQC 1OPKA 1FMKA 1MUZA 2AZVA 2KEAA 3QWXX 1TUDA 3ZL7C 1GBQA 2HBWA 3C0CA 1OV3A 2GGRA 3EG3A 2K9GA 1E6GA 1HJDA 1JO8A 2FRYA 1OOTA 3H0HA 1N5ZA 1YP5A 2BZYA 4M4ZA 2FPEA 2KT1A 1Y0MA 2LJ3A 2EGEA 4AG2C 2HCKA 2BTTA 2GBQA 4RTUA 3NHNA 2O31A 2L3QA 1WYXA 1X2QA 1ZUUA 3THKA 4ORZA 1U3OA 4OMOA 1X6GA 1AWWA 1CKAA 1HD3A 1AEYA 1I0CA 4RUGA 4JZ3A 2MOXA 5FWBA 1GL5A 2A08A 5I11A 2ABLA 4KRTA 2DJQA 2CH4A 4AG1C 1MV3A 2JW4A 5IXBA 2EVRA 1UFFA 1RLQC 3ULRB 3FJ5A 1AWXA 2D0NA 3RNJA 2KXDA 1Y57A 1J3TA 1X27A 2A36A 4RTTA 2KBTA 2JMCA 2A28A 1VYTA 2C0IA 3NPFA 2DM1A 1M30A 4DEXA 1JQQA 1UHFA 1UJ0A 4OMLA 1AWOA 1T3LA 1K76A 2EYWA 1NG2A 2CT3A 1YWOA 3TSZA 2EQIA 2JS0A 2JT4A 2V1QA 1UGVA 4CC7A 1GFDA 3NMZC 4JJCA 2CDTA 1CKBA 3U23A 1QKWA 2OI3A 2ESWA 4HVVA 2FEIA 4LNPA 2RMOA 1ZSGA 3VS7A 2OAWA 1SHGA 1NLOC 2LJ1A 2DRKA 1W6XA 3PE0A 3A98A 2DLPA 1NEGA 3RBBB 3VS0A 4RTVA 1KJWA 3VS2A 1G83A 2EPDA 1G2BA 1Z9ZA 2QDLA 1X2KA 3I5RA 5IHIA 1QLYA 2DRMA 2KE9A 2RQVA 1WI7A 2KXCA 2J6FA 4F16A 3UF4A 2CSIA 1PKTA 2MIOA 3H0IA 1ZUYA 1WX6A 3IQLA 2ED0A 1QWEA 4GBQA 1NEBA 4D8DA 1K4US 2K6DA 1E6HA 3O5ZA 1ZBJA 3R6NA 1CSKA 4HVUA 1KSWA 2HEQA 1RLPC 2NWMA 2RN8A 4RTWA 2J7IA 3EG2A 1PHTA 3VS3A 2B86A 5GJVB 2FG0A 2YT6A 2DE0X 1K0SA 3SHWA 1I1JA 2KGTA 1KIKA 2D1XA 2C0TA 2YUOA 2KNBB 3VS5A 1ARKA 2J6KA 4F14A 3H0FA 2LZ6B 2DILA 1ABQA 2G6FX 4CC2A 2KR3A 2CT4A 1UTIA 3I35A 1VA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3B A;  2AZS A;  4F17 A;  1GRI A;  2K7A A;  3PVQ A;  1X69 A;  1WXT A;  5IXF A;  3I9Q A;  2CUB A;  1UEC A;  2C0O A;  1WDX A;  3I5S A;  1VYU A;  1NLP C;  1UDL A;  4AFU C;  3EG0 A;  1JU5 C;  2LCS A;  2M51 A;  1WA7 A;  2KRN A;  2BZ8 A;  4D8K A;  2VKN A;  3GBQ A;  2RNA A;  3LH5 A;  4IIO A;  4OMN A;  3M0P A;  4LE9 A;  1BU1 A;  1UHC A;  2GTO A;  2ENM A;  2KYM A;  2ED1 A;  1WFW A;  1W70 A;  3TVT A;  3NGP A;  1X43 A;  5IHN A;  2L2P A;  3M0Q A;  2RF0 A;  3VRY A;  1JXM A;  4X1V A;  1UG1 A;  2JM9 A;  2PZ1 A;  5IH2 A;  3VS4 A;  1GCQ A;  1ABO A;  1T0J A;  1GCP A;  2PTK A;  4J9B A;  1MV0 B;  3PVL A;  2DMO A;  2CRE A;  4JJD A;  1BK2 A;  4K11 A;  4RTX A;  2EW3 A;  3EHR A;  2CUD A;  4A63 B;  4RTZ A;  4JJB A;  5IHK A;  1AOJ A;  1SRM A;  1M8M A;  1BB9 A;  2KRM A;  4GLM A;  2L0A A;  1IO6 A;  2J05 A;  4QT7 A;  2GQI A;  3EHQ A;  2YUP A;  1M3A A;  5FWC A;  1XOV A;  2O2O A;  2VVK A;  3M0S A;  4J9F A;  1H3H A;  1FYN A;  4CC3 A;  1B07 A;  2F2V A;  2O9S A;  2YUQ A;  2HSP A;  1SSH A;  2BZX A;  2GNC A;  2DL4 A;  3EG1 A;  3M0U A;  1SHF A;  1U06 A;  1BBZ A;  4OMP A;  3UA6 A;  2RPN A;  2EGA A;  4IIM A;  2SEM A;  3REB B;  2I0N A;  3TSW A;  1M27 C;  1UE9 A;  2LX7 A;  3UAT A;  2F2W A;  2DBM A;  2OJ2 A;  2DNU A;  2EKH A;  2LQW A;  2SRC A;  4ESR A;  1U5S A;  1Z9Q A;  1SRL A;  1WXB A;  5I22 A;  2RQU A;  4Y92 A;  1E7O A;  2DL7 A;  2RQT A;  1K0X A;  2FPF A;  3M0T A;  1OPL A;  2L3P A;  1H92 A;  1H8K A;  2O88 A;  4JPB W;  1M3C A;  1PKS A;  1UJY A;  2CSQ A;  2M0Y A;  1PWT A;  3CQT A;  4E6R A;  1GBR A;  4WCI A;  1RI9 A;  3KFV A;  1AZG B;  2LJ0 A;  1X6B A;  5L23 A;  4J9H A;  1AVZ C;  4ZNX A;  1ZX6 A;  2DVJ A;  1VYV A;  2EGC A;  4JZ4 A;  4R0K A;  1AWJ A;  2X3X D;  2GTJ A;  2L3S A;  4RTY A;  2ECZ A;  2JMA A;  2JXB A;  4HXJ A;  2HDA A;  4LN2 A;  4LUE A;  2VWF A;  2DL5 A;  1GFC A;  2W10 A;  3M0R A;  4AFS C;  2LNH B;  3VS1 A;  1A0N B;  4FSS A;  1HSQ A;  1JXO A;  4Z89 A;  1TG0 A;  2D8H A;  5EC7 A;  1UUE A;  4DEY A;  2H8H A;  3JV3 A;  1YN8 A;  3UA7 A;  3EGU A;  2XMF A;  4OMQ A;  2JS2 A;  2KRS A;  2KRO A;  2KYB A;  2YUN A;  3H41 A;  1RUW A;  5ECA A;  1ZUK A;  2YSQ A;  2W0Z A;  4J9D A;  2NUZ A;  2DBK A;  1EFN A;  1QCF A;  1W1F A;  1ZLM A;  1NYF A;  1S1N A;  1PRM C;  4CC4 B;  2DL8 A;  1WIE A;  2EYX A;  5HCK A;  1NM7 A;  2JM8 A;  5FW9 A;  1SPK A;  1TUC A;  2FO0 A;  2LP5 A;  4OMM A;  1PRL C;  1YWP A;  2JTE A;  1AD5 A;  3QWY A;  2IIM A;  1T0H A;  2AKL A;  4J9I A;  5GJW B;  1YCS B;  1I07 A;  2A37 A;  2FRW A;  2FPD A;  1OEB A;  3SEM A;  2E5K A;  1QKX A;  1NYG A;  2LQN A;  2AK5 A;  4LUD A;  3VS6 A;  2AKK A;  2DF6 A;  2EYY A;  1PNJ A;  1QWF A;  2K2M A;  4J9C A;  3REA B;  1V1C A;  1M3B A;  4Z88 A;  2KT8 A;  1WXU A;  3VRZ A;  1K1Z A;  1AZE A;  2K79 A;  4Z8A A;  4HVW A;  2DYB A;  2F2X A;  2X3W D;  2EBP A;  2O9V A;  2YDL A;  4AFZ C;  1K9A A;  2CH4 W;  4J9E A;  1LCK A;  4HCK A;  2MCN A;  2J06 A;  1B3Q A;  2J6O A;  2P4R A;  1KFZ A;  4J9G A;  1T3S A;  2EYZ A;  2ROL A;  2DA9 A;  2RQW A;  2PNI A;  1JEG A;  2D8J A;  2V1R A;  2DX1 A;  1GCQ C;  2ROT A;  2LMJ A;  1YNZ A;  1SEM A;  4EIK A;  1WLP B;  2DL3 A;  2RQR A;  4AFQ C;  1OPK A;  1FMK A;  1MUZ A;  2AZV A;  2KEA A;  3QWX X;  1TUD A;  3ZL7 C;  1GBQ A;  2HBW A;  3C0C A;  1OV3 A;  2GGR A;  3EG3 A;  2K9G A;  1E6G A;  1HJD A;  1JO8 A;  2FRY A;  1OOT A;  3H0H A;  1N5Z A;  1YP5 A;  2BZY A;  4M4Z A;  2FPE A;  2KT1 A;  1Y0M A;  2LJ3 A;  2EGE A;  4AG2 C;  2HCK A;  2BTT A;  2GBQ A;  4RTU A;  3NHN A;  2O31 A;  2L3Q A;  1WYX A;  1X2Q A;  1ZUU A;  3THK A;  4ORZ A;  1U3O A;  4OMO A;  1X6G A;  1AWW A;  1CKA A;  1HD3 A;  1AEY A;  1I0C A;  4RUG A;  4JZ3 A;  2MOX A;  5FWB A;  1GL5 A;  2A08 A;  5I11 A;  2ABL A;  4KRT A;  2DJQ A;  2CH4 A;  4AG1 C;  1MV3 A;  2JW4 A;  5IXB A;  2EVR A;  1UFF A;  1RLQ C;  3ULR B;  3FJ5 A;  1AWX A;  2D0N A;  3RNJ A;  2KXD A;  1Y57 A;  1J3T A;  1X27 A;  2A36 A;  4RTT A;  2KBT A;  2JMC A;  2A28 A;  1VYT A;  2C0I A;  3NPF A;  2DM1 A;  1M30 A;  4DEX A;  1JQQ A;  1UHF A;  1UJ0 A;  4OML A;  1AWO A;  1T3L A;  1K76 A;  2EYW A;  1NG2 A;  2CT3 A;  1YWO A;  3TSZ A;  2EQI A;  2JS0 A;  2JT4 A;  2V1Q A;  1UGV A;  4CC7 A;  1GFD A;  3NMZ C;  4JJC A;  2CDT A;  1CKB A;  3U23 A;  1QKW A;  2OI3 A;  2ESW A;  4HVV A;  2FEI A;  4LNP A;  2RMO A;  1ZSG A;  3VS7 A;  2OAW A;  1SHG A;  1NLO C;  2LJ1 A;  2DRK A;  1W6X A;  3PE0 A;  3A98 A;  2DLP A;  1NEG A;  3RBB B;  3VS0 A;  4RTV A;  1KJW A;  3VS2 A;  1G83 A;  2EPD A;  1G2B A;  1Z9Z A;  2QDL A;  1X2K A;  3I5R A;  5IHI A;  1QLY A;  2DRM A;  2KE9 A;  2RQV A;  1WI7 A;  2KXC A;  2J6F A;  4F16 A;  3UF4 A;  2CSI A;  1PKT A;  2MIO A;  3H0I A;  1ZUY A;  1WX6 A;  3IQL A;  2ED0 A;  1QWE A;  4GBQ A;  1NEB A;  4D8D A;  1K4U S;  2K6D A;  1E6H A;  3O5Z A;  1ZBJ A;  3R6N A;  1CSK A;  4HVU A;  1KSW A;  2HEQ A;  1RLP C;  2NWM A;  2RN8 A;  4RTW A;  2J7I A;  3EG2 A;  1PHT A;  3VS3 A;  2B86 A;  5GJV B;  2FG0 A;  2YT6 A;  2DE0 X;  1K0S A;  3SHW A;  1I1J A;  2KGT A;  1KIK A;  2D1X A;  2C0T A;  2YUO A;  2KNB B;  3VS5 A;  1ARK A;  2J6K A;  4F14 A;  3H0F A;  2LZ6 B;  2DIL A;  1ABQ A;  2G6F X;  4CC2 A;  2KR3 A;  2CT4 A;  1UTI A;  3I35 A;  1VA7 A; 
#chains in the Genus database with same CATH topology
 2AZS A;  4F17 A;  1UGQ B;  1GRI A;  3PVQ A;  1X69 A;  3GP8 A;  2G3R A;  3X26 B;  3CME A;  1UEC A;  3N5B B;  2QQ9 A;  1YJ9 A;  1WDX A;  4KGZ B;  3I5S A;  1VYU A;  1UDL A;  4AFU C;  1WA7 A;  2KRN A;  3OYF A;  2VKN A;  3GBQ A;  3CBO A;  1Q7Y U;  1EIF A;  1N9S A;  5AYF A;  1DJ7 B;  2GTO A;  1VQ8 T;  2ENM A;  5LJ5 g;  4HA8 A;  3OYN A;  3SWN C;  1W70 A;  2IPO B;  4XU1 A;  2EJ9 A;  3NGP A;  5LJ3 d;  8ATC B;  4BAC A;  2P0K A;  4A53 A;  5D6X A;  2RF0 A;  3CC2 Q;  3CCS T;  3HL8 A;  1UGP B;  4X1V A;  1UG1 A;  1OZ2 A;  4J6Y A;  4PJJ A;  1G3T A;  4JS4 A;  2K5F A;  3RKW A;  1GCQ A;  5GAM e;  3OSV A;  2L3R A;  4MZP A;  3J81 E;  4QQD A;  4FSX A;  5LJ5 d;  2JN0 A;  4JJD A;  1VQK Q;  4K11 A;  2EJG A;  4E7Z A;  3CCR Q;  4YTL A;  1FMW A;  1BB9 A;  2J05 A;  3TCJ A;  4QQG A;  2JUF A;  3G6E A;  4BI3 A;  3ZFJ A;  3CCE Q;  2EKO A;  5FWC A;  2LCC A;  1Q86 R;  1XOV A;  1BIA A;  4J9F A;  1H3H A;  5CKE A;  2EQK A;  2E6N A;  2ATC B;  2F2V A;  2FZG B;  2O9S A;  4ZGE B;  3I55 T;  2BZX A;  2GNC A;  3QBY A;  2DL4 A;  5GAM f;  2MWO A;  4C5H A;  1SHF A;  1U06 A;  3LW5 E;  1KHI A;  2RI5 A;  3E9F A;  5FRN A;  4BD3 A;  1Y7X A;  2SEM A;  5FU6 B;  2LX7 A;  2ZPH B;  4M75 E;  3UAT A;  2F2W A;  2OJ2 A;  2LQW A;  2SRC A;  4ESR A;  1Z9Q A;  4PLI A;  1SRL A;  4Y92 A;  1OPL A;  1RAI B;  4A4F A;  1Y07 A;  2O88 A;  2DVE A;  4E7L A;  1PKS A;  5GAO p;  2CSQ A;  1PWT A;  3CQT A;  2CP5 A;  3MET A;  4MML A;  4WCI A;  3KFV A;  3CCL T;  3S3O A;  4LD6 A;  4DBF A;  4KGX B;  1BCO A;  2VAS A;  5GAM j;  4ATO A;  4JZ4 A;  1AT1 B;  2RHY A;  2RH2 A;  4JDS A;  2HDA A;  5GAN f;  2FB7 A;  2VWF A;  1M1K R;  2DZC A;  4AFS C;  1QVF S;  4PFZ A;  3JCM c;  3QYH B;  1Q86 U;  1ZA1 B;  3H8Z A;  1OQK A;  4J7F A;  3DB4 A;  4J83 A;  2H8H A;  1YN8 A;  3EGU A;  4BUG A;  3LWI A;  1VQP A;  4C8Q F;  3OYH A;  1ZUK A;  2W0Z A;  2DBK A;  2E41 A;  2WSC E;  1W1F A;  2E3I A;  3FB9 A;  3GF5 A;  2EYX A;  3VJP A;  2KK4 A;  4M7D G;  2JM8 A;  2FO0 A;  2HKQ B;  4OMM A;  1PRL C;  1U1S A;  1YWP A;  2JTE A;  3LYI A;  3EFS A;  1YBY A;  1I81 A;  4LXC A;  5CR2 A;  4KUD K;  2I2L A;  2AKL A;  4RCB A;  5CQX A;  2OTL Q;  2O01 E;  2IG0 A;  1I07 A;  4M77 B;  2A37 A;  2PVO B;  1G3Y A;  1D1B A;  1RAC B;  4N0A C;  4O6J A;  1UB4 A;  2XID A;  3HPW A;  2K57 A;  1KK7 A;  4ZTF A;  4LUD A;  3VS6 A;  4ZGJ B;  3CBP A;  2V8J A;  2K2M A;  5FU7 B;  3OS0 A;  1V1C A;  4IUP A;  1WXU A;  3CME T;  3C95 A;  1VOM A;  1VQO A;  2V26 A;  1AZE A;  3CC7 A;  4Z8A A;  3OYY A;  4E7K A;  1KHC A;  4B6M A;  4C92 F;  1VQ8 Q;  1M2V A;  4J9E A;  1QVG S;  4MZM A;  2BIV A;  3RES A;  1B3Q A;  2NYS A;  2DA9 A;  2RQW A;  4LDU A;  2D8J A;  2V1R A;  3P8D A;  1JJ2 S;  5D7U A;  5I2M A;  4Q5W A;  1YJW A;  4FYX B;  1IGQ A;  4BE2 A;  1KG1 A;  4KH1 B;  1QVP A;  2DL3 A;  3PGG A;  1W2B A;  3QG1 A;  1OPK A;  3HFO A;  4EMK B;  3HFN A;  2V8I A;  3ZL7 C;  5CO7 A;  2A3L A;  3EG3 A;  2K9G A;  1E6G A;  1S72 Q;  1KQS A;  3A8H B;  1HJD A;  1O75 A;  2RJD A;  3H0H A;  1N5Z A;  2DFU A;  2KT1 A;  2EGE A;  3BFM A;  3NHN A;  2O31 A;  5AT1 B;  3E19 A;  1WYX A;  3G6E Q;  1PC0 A;  4ORZ A;  1YI2 A;  4M75 B;  1X6G A;  4XU3 A;  2L8D A;  1SSF A;  1CKA A;  4OB0 B;  4C92 G;  1AEY A;  1I0C A;  4HCZ A;  2PQW A;  3BDU A;  5FWB A;  5LJ5 f;  1KC8 R;  4LDX A;  2O4X A;  3JCM g;  2COW A;  4JRP A;  1VQM A;  2QXF A;  4HCC A;  3I55 A;  5KYY A;  1UFF A;  4JJN K;  2DTH A;  4M78 C;  2HZY A;  4M7A G;  5GMK l;  2EQJ A;  2KXD A;  2O4X B;  1NJI U;  1IRE B;  4RTT A;  3A1P A;  3CCU A;  2KBT A;  4O5V A;  2JMC A;  3NPF A;  1VYT A;  1YJN A;  2DM1 A;  2QI2 A;  1UHF A;  1K76 A;  4OB3 B;  2QQB A;  2ZPB B;  1KC8 U;  2ZPG B;  4CC7 A;  2JVV A;  1GFD A;  3CCJ T;  3U23 A;  3GIB A;  2ESW A;  5J26 A;  4HKE A;  3ZEH A;  3MEA A;  1VQ9 T;  2ZZD A;  2RMO A;  3JCM J;  1NJI R;  3VS7 A;  1VQ6 Q;  2DRK A;  4AMC A;  3PE0 A;  4M7D B;  3A98 A;  1VQM T;  1Q82 C;  4NOY A;  5CQY A;  2L5Q A;  3CCM T;  3VS2 A;  1G2B A;  3CXC P;  1KD1 U;  1LOJ A;  4PJO F;  2MF2 A;  3I5R A;  4IKF A;  2KE9 A;  2LVM A;  1WI7 A;  4M7D C;  5CIU A;  4F16 A;  3MEU A;  1WX6 A;  2RK2 A;  1YJ9 Q;  5A0G A;  1Q82 U;  5FRO A;  2M1H A;  1CSK A;  1D0Y A;  4HVU A;  1PD1 A;  4GLK A;  3M56 A;  1W2B P;  4DBQ A;  1LPL A;  3SWN B;  2NWM A;  3L2Z A;  4PFO A;  2HQH A;  2YXY A;  4XTZ A;  1M90 C;  1I1J A;  4GY5 A;  1D0X A;  3QJ6 A;  4C0G A;  2KNB B;  2J6K A;  1WQW A;  3CPW P;  1QVF A;  2G6F X;  3OW2 S;  2KR3 A;  2ZGW A;  2ZPF B;  4M75 A;  1VA7 A;  2DXC A;  3CPF A;  4JRI A;  1ZQ1 A;  3G71 A;  3QZ5 B;  5IXF A;  1VQ4 Q;  3OS1 A;  2BUD A;  2C0O A;  2VB6 A;  3AT1 B;  1NLP C;  3JCM P;  4PJM A;  2KY9 A;  4QVC A;  3OS5 A;  2KMT A;  4C0Z A;  4KH0 B;  1D3B A;  3EGD A;  1R0B G;  2QEX T;  4IIO A;  1JBM A;  1X01 A;  3M0P A;  4OMF B;  2EYQ A;  2ED1 A;  4IUQ A;  3BW1 A;  5GMK e;  1WFW A;  1NZ9 A;  3QDR B;  4E7I A;  2YLB A;  1OU9 A;  5KE2 A;  3L2V A;  1M8V A;  2K3X A;  3RKY A;  4C92 B;  2M16 A;  4AT1 B;  3VS4 A;  2QA4 A;  2YRC A;  3OYL A;  3OA6 A;  1GCP A;  3MEV A;  2PTK A;  2FYK A;  4HT8 A;  1MV0 B;  2XI9 A;  3KBG A;  3CMA Q;  5FRM A;  3JB9 F;  4KT0 E;  2CUD A;  4C92 C;  2XDD A;  1AHJ B;  3L2Q A;  4M77 A;  1SRM A;  2RHZ A;  3EGX A;  2YHT A;  2KRM A;  3CCV Q;  4QT7 A;  5J3B A;  5GAM h;  4JLG A;  1M3A A;  1M5Q 1;  4A4E A;  5L8R E;  5I2S A;  2VVK A;  3P8B B;  5GAO l;  4MDW A;  1XNI A;  1FYN A;  3OMC A;  2RM4 A;  4A4K A;  3GLX A;  2YUQ A;  1SSH A;  2E5Q A;  3EFO B;  2DPP B;  1MMG A;  2QK0 A;  5GAN h;  3M0U A;  1KQS S;  1B34 B;  2HAX A;  2XDP A;  1VQM Q;  4D6W A;  3G7Z A;  2EGA A;  3KXT A;  3REB B;  3TU4 K;  2I0N A;  3TSW A;  3DB3 A;  1M27 C;  1UE9 A;  2VC8 A;  1RI0 A;  1VQK A;  2QGF B;  1VQN A;  3X25 B;  1JJ2 A;  3CCJ Q;  1E7O A;  3F70 A;  5GAN 2;  1VQL A;  3PT9 A;  3CCQ A;  2KI7 A;  2L3P A;  1H92 A;  3Q1J A;  1H8K A;  1RAH B;  2YRD A;  3BDL A;  4JPB W;  1K9M U;  2R5M A;  1M2O A;  1UJY A;  4F7U B;  1KQ1 A;  2M0Y A;  4M7D F;  5LJ5 h;  1WHH A;  1TS9 A;  2F5K A;  3GNF B;  4BY6 C;  3QSU A;  1RI9 A;  5CKH A;  3FC3 A;  3LGF A;  2NUT A;  3FDR A;  5L23 A;  4J9H A;  1VUB A;  3CPW A;  1AVZ C;  4ZNX A;  1ZX6 A;  5GAN 8;  1VYV A;  2EGC A;  1ACM B;  2QQR A;  1IXD A;  1OU8 A;  4EMK C;  1HXD A;  4KUI A;  4RTY A;  2ECZ A;  3OYB A;  2JXB A;  4C5I A;  2ZPE B;  4LN2 A;  2D6F A;  2BE7 D;  2LTO A;  3HKS A;  1WNL A;  2E10 A;  1N8R C;  4ELZ C;  1A0N B;  2RK1 A;  2RJF A;  5EG2 A;  4FSS A;  1JXO A;  4Z89 A;  3NTK A;  4NL2 A;  5IAY A;  5EC7 A;  4C92 A;  1VQK T;  4RCC A;  4M7A F;  2JS2 A;  3EG9 A;  2YUN A;  3CCE T;  1RUW A;  1PCX A;  5ECA A;  3V8L A;  4J7I A;  2NUZ A;  2DEQ A;  3WVD B;  2HD0 A;  3RER A;  5HCK A;  4C5E A;  2DTO A;  5DY9 A;  2LP5 A;  4A54 A;  1AD5 A;  4M77 G;  2H3E B;  4N4G A;  3QWY A;  4J9I A;  4CRI A;  1SF9 A;  3S6W A;  3VUZ A;  3CCM Q;  3QO3 A;  1RAG B;  4C0F A;  1YJW Q;  2B8A A;  2P0Q A;  3X28 B;  3UDC A;  2FPD A;  1VQ6 T;  1B34 A;  4Y28 E;  1OEB A;  4XTX A;  3MP1 A;  2LCL A;  2BKD N;  2LQN A;  2DF6 A;  1TXQ A;  1PNJ A;  4M7A E;  1S72 A;  2E4H A;  2PU9 B;  3G71 Q;  2HKN A;  3REA B;  5D6W A;  3JB9 D;  1QMC A;  4FL6 A;  4XTU A;  1BI0 A;  1IHV A;  1IZ6 A;  1IHW A;  2K79 A;  1VQ4 T;  2F2X A;  2EBP A;  1ZHI A;  3JCM h;  1K9A A;  2RB6 A;  4HCK A;  4TVR A;  2DD5 A;  1YHQ T;  2VGN A;  3CC7 T;  3V7C A;  2QA4 T;  2EYZ A;  3MPU B;  2ROL A;  2OTL A;  1JEG A;  1M1F A;  2ROT A;  3HRU A;  1RAB B;  2EJF A;  2LMJ A;  3RUX A;  4EMH A;  3V7S A;  2CKK A;  2RJE A;  1FMK A;  3TRE A;  1YIT A;  4ZN3 A;  1PSF A;  5GAN 5;  3JB9 G;  2GF7 A;  3C0C A;  5LL6 S;  2Y4Y A;  1OYX A;  1ZSZ A;  2L89 A;  3G4S Q;  2FRY A;  2DAQ A;  5CVI A;  3CCU Q;  4XAX B;  4M78 G;  2E1H A;  5CKD A;  1Y0M A;  5GAN g;  4MMK A;  2EAY A;  2HQX A;  3THK A;  1U3O A;  3J80 E;  2YRV A;  1R0C B;  2M9U A;  1YHQ A;  1W4S A;  1VIE A;  2K5I A;  4JZ3 A;  2MOX A;  1GL5 A;  4BDZ A;  1WHJ A;  2QYZ A;  3CCS A;  2ZCF B;  5IXB A;  2ZAE A;  1ZSZ C;  4E7S A;  1RLQ C;  3ULR B;  4C8Q A;  4QVD A;  1M2V B;  3MEW A;  4IUV A;  1J3T A;  1TUG B;  2R57 A;  5DLO A;  2DXT A;  2JTF A;  4B9W A;  2DTI A;  1JJ2 P;  1T3L A;  2EFI A;  2LT1 A;  3UPU A;  2CT3 A;  3TSZ A;  2JT4 A;  2EWN A;  3HTR A;  3G71 T;  1CKB A;  1BCM A;  2VV5 A;  2OI3 A;  2DER A;  4HVV A;  4JS5 A;  2GFU A;  5HK0 A;  4FIB A;  1SHG A;  5LJ5 j;  4M7A A;  7AT1 B;  5GAO r;  2RI3 A;  1TWB A;  5FU7 C;  4RTV A;  4F7U E;  5LJ5 e;  1N6A A;  1KJW A;  5HKC A;  4PJL A;  2CZ7 B;  1X2K A;  1N9R A;  5IHI A;  1QLY A;  2DRM A;  4OB2 B;  4PJO G;  2KXC A;  5LJ3 j;  4PK4 A;  3QUI A;  3UF4 A;  2CSI A;  1O9S A;  3JSC A;  2LNV A;  1Q95 G;  4FT4 A;  4M77 E;  1K4U S;  4D8D A;  2DO3 A;  2K6D A;  1E6H A;  2EQU A;  1ZBJ A;  1F1B B;  2P84 A;  1P92 A;  1Q81 R;  3JCM X;  4DBR A;  2RN8 A;  4J8O A;  3EG2 A;  1PHT A;  2B86 A;  5GJV B;  2YT6 A;  3M9Q A;  3CEY A;  2FL7 A;  3SHW A;  5KYU B;  3QDF A;  3KUF A;  5KYU A;  2D1X A;  2C0T A;  1VQ7 A;  4F14 A;  1MMD A;  4CC2 A;  1K8A R;  3A8G B;  3MP6 A;  2HL3 A;  2K3B A;  3TQ7 P;  2K7A A;  5LJ3 h;  1WXT A;  2QQA A;  3AHU A;  2FVU A;  3FRN A;  3QPH A;  1M1K U;  3CCV A;  3JB9 J;  1VIF A;  5GAO m;  2BZ8 A;  1VQ8 A;  4D8K A;  2RNA A;  3LH5 A;  2ZPI B;  1BU1 A;  2E12 A;  4R56 A;  2KYM A;  2D9T A;  3M4G A;  3TVT A;  4NL3 A;  2Z0W A;  4JRQ A;  4M77 C;  1U8R A;  4XTV A;  3VRY A;  1VQ7 T;  2PZ1 A;  3PNW C;  4LDY A;  4E47 A;  4DBH A;  2QAZ A;  2X9H A;  1TH7 A;  1C6V X;  3HP9 A;  1T0J A;  1BI1 A;  2E3H A;  3M53 A;  1MMN A;  3OSS C;  3PVL A;  2CRE A;  3EHR A;  4RTZ A;  2OX7 A;  5IHK A;  3PTA A;  1R77 A;  2HQE A;  1M8M A;  4GLM A;  3CCV T;  1IO6 A;  1I8F A;  4FT2 A;  3EHQ A;  2YUP A;  3I56 T;  2E6Z A;  3CXC A;  3CCR T;  4VUB A;  2O2O A;  5KYX B;  1X75 C;  3FLG A;  3M0S A;  1YCY A;  3SB2 A;  1B07 A;  3M58 A;  2HSP A;  4N4H A;  5GAN 4;  1K9M R;  4UC4 A;  3MP8 A;  4DOV A;  1M1K C;  5KYY B;  3CCS Q;  2LQ8 A;  1M9S A;  1D09 B;  1BBZ A;  3DLM A;  3UA6 A;  2YLC A;  1OZ3 A;  2QA4 Q;  4IIM A;  3ZBD A;  3CD6 A;  3G4S T;  5FLX E;  4ZTJ A;  3OYI A;  4OVA A;  2DBM A;  2MK5 A;  2DNU A;  2EKH A;  3RDV A;  1U5S A;  2HNI A;  2RQU A;  2RQT A;  3WVE B;  3VUB A;  2VGM A;  1K0X A;  2R58 A;  3A8L B;  2E64 A;  3M0T A;  1V76 A;  1N8R U;  4ME7 A;  4E6R A;  3M59 A;  4M75 D;  2X4J A;  2DVJ A;  3CC4 T;  1I5L A;  2HSE B;  3M5A A;  1K8A C;  4OP0 A;  1VQ6 A;  1D3B B;  3EGD B;  2GTJ A;  2L3S A;  4B9X A;  1WJR A;  1YJW T;  2Y90 A;  4LUE A;  2OTL T;  4BB7 A;  2NUP B;  1QVG A;  3M0R A;  4WTO B;  1D0Z A;  1WPY A;  5LJ3 f;  2CZ6 B;  1Y71 A;  2OTJ A;  2D8H A;  1UUE A;  1VQL T;  4DEY A;  3GOX A;  3JV3 A;  5HK3 A;  2JTM A;  5GAN d;  3UA7 A;  4OMQ A;  1WHM A;  2JZ2 A;  1VQL Q;  2KRS A;  2KRO A;  3SDZ A;  2DET A;  3EGX B;  3H41 A;  4WF2 A;  2KDS A;  1RAE B;  1YIT T;  4J9D A;  1YJ9 T;  3LWH A;  1ZLM A;  1NYF A;  1S1N A;  1PRM C;  3A8M B;  2QTX A;  4LD9 K;  5A0D A;  1I4K 1;  4FCY A;  4HT9 A;  5FW9 A;  3MO8 A;  1SPK A;  1TUC A;  1QVG P;  3JCM f;  4PKC C;  4R55 A;  3OW2 P;  1XTD A;  2IIM A;  1T0H A;  5GJW B;  2LC4 A;  2JNG A;  4C8Q D;  2A0F B;  2XD0 A;  4OGE A;  1ZA2 B;  3M55 A;  2P4T A;  4X9D A;  2MAM A;  2GFA A;  4KUL A;  1NYG A;  5C0M A;  4M78 B;  4M78 A;  2EYY A;  4J9C A;  4FM4 B;  3VV0 A;  3QKJ A;  1VQO T;  3EH1 A;  3CME Q;  1K9M C;  1LJO A;  2KT8 A;  2NUT B;  3VRZ A;  3WXM B;  1K1Z A;  1FWZ A;  3OYM A;  2AIR B;  3VYG A;  2PUK B;  2A7Y A;  2CZ1 B;  4ZGD B;  4AFZ C;  1H3Z A;  4C0D C;  3R6O A;  4HCB A;  5IN1 A;  1LCK A;  2Y4X A;  2J06 A;  2C06 A;  2E70 A;  5KCH A;  2BE9 B;  2VXE A;  2QQS A;  2JJ9 A;  3JCM b;  1QCN A;  1KD1 C;  2PNI A;  3CCM A;  3L42 A;  4PJO A;  1GCQ C;  1ZSZ B;  4BE0 A;  3ER0 A;  1IRX A;  3CC2 A;  1YNZ A;  1SEM A;  1JB0 E;  1WLP B;  4E7J A;  2RQR A;  1NPP A;  3QYG B;  4AFQ C;  3HSB A;  3OMG A;  5GMK m;  2HBW A;  1YIJ A;  5FU6 C;  1OV3 A;  1BYM A;  3CMA A;  2KAF A;  2WSE E;  5GAN 3;  1YP5 A;  3JRZ A;  2BZY A;  4M4Z A;  2LJ3 A;  4M78 F;  4RMO A;  3C4S A;  2NUP A;  2HCK A;  2BTT A;  2GBQ A;  2CP7 A;  3X24 B;  1VQ5 T;  1X2Q A;  5GMK h;  2CP0 A;  3JB9 H;  1NJI C;  4PFP A;  4L6V 5;  4OMO A;  1NPR A;  1AWW A;  1K73 U;  3RIR A;  4M7D E;  3CD6 T;  1V29 B;  2A08 A;  2E65 A;  2ABL A;  4IUR A;  3JCM d;  2DJQ A;  1MV3 A;  3CC2 T;  2LT4 A;  2K5L A;  4QKU A;  1SKU B;  4RKU E;  5KYX A;  2CGH A;  1MHN A;  3FJ5 A;  4XU2 A;  3C94 A;  3RNJ A;  3GNG A;  5DLQ E;  2DYI A;  1IGU A;  1YI2 T;  1VQN Q;  1Y57 A;  3CC4 A;  3G4S A;  1X27 A;  2JOY A;  2OTJ T;  2A36 A;  3OYJ A;  3BY7 A;  1BI3 A;  4X34 A;  5CK9 A;  2A28 A;  2C0I A;  4FW2 A;  2RO0 A;  3UWN A;  1M30 A;  4DEX A;  5I21 A;  1JQQ A;  4J6X A;  4PJO D;  2DKG A;  4F7U A;  2MPX C;  2XIC A;  1NG2 A;  4OB1 B;  3NTI A;  3NMZ C;  4JJC A;  3OYE A;  2MI6 A;  4LNP A;  1XJW B;  2RD1 A;  1EZZ B;  1VQ9 A;  4EMG A;  1IB8 A;  1W6X A;  4M7D D;  2V8K A;  3LGL A;  1NEG A;  1KC8 C;  1K8A U;  3VS0 A;  1M90 U;  4A4H A;  1FX7 A;  1PSE A;  1G83 A;  2EPD A;  2COZ A;  4PJO B;  1Z9Z A;  2QDL A;  4PLL A;  4BE1 A;  4XU0 A;  4XK8 E;  5J39 A;  2OTJ Q;  1OX8 A;  1VQN T;  1D1A A;  2EQM A;  4F7U G;  4L59 A;  1G3S A;  1Q81 C;  2MIO A;  3FEO A;  3IQL A;  2ED0 A;  1QWE A;  2DIG A;  5IT9 E;  4GBQ A;  4PJO E;  1NEB A;  3O5Z A;  3JB9 I;  3R6N A;  3MCA B;  4LDV A;  3P8H A;  2X4Y A;  2HEQ A;  1YFN A;  2LX9 A;  4V2S A;  4RTW A;  1G5V A;  2X4W A;  2F5T X;  1KIK A;  1Q82 R;  1ARK A;  4C8Q E;  2LZ6 B;  1Q7Y R;  2DIL A;  1D1C A;  3E2U A;  2CT4 A;  3VYH B;  4ELY C;  2KQW A;  5GAN 6;  1K73 R;  3CCR A;  4JLI A;  2WSF E;  3RMS A;  3I9Q A;  3CCL Q;  2CUB A;  1C0M A;  4MDX A;  1KQ2 A;  3L1A A;  3EG0 A;  1JU5 C;  2LCS A;  2M51 A;  3A8O B;  3OW2 A;  1VQO Q;  2RJC A;  3CC7 Q;  4M78 D;  3CCE A;  1K73 C;  4OMN A;  4LE9 A;  2X35 A;  1UHC A;  1YIJ T;  4J6W A;  4EMK A;  5LJ3 e;  2PVD B;  3OY9 A;  1X43 A;  5IHN A;  2L2P A;  3M0Q A;  1JXM A;  5CKF A;  2JM9 A;  2KVQ G;  5GAM d;  5IH2 A;  1YIT Q;  5KCO A;  2QAS A;  1ABO A;  3C12 A;  3OYA A;  4J9B A;  2RHU A;  2DMO A;  1BK2 A;  4RTX A;  3HRT A;  3G6E T;  2EW3 A;  4EPC A;  1OX9 A;  4CI0 C;  2K4Y A;  2AHJ B;  4A63 B;  3PFS A;  4JJB A;  3V8K A;  1QP3 A;  1AOJ A;  2F1L A;  3EG9 B;  2L0A A;  4P5N A;  5GAM g;  2CP3 A;  2GQI A;  1KD1 R;  4FYW B;  5CKB A;  1S72 T;  3DKM A;  3QHS A;  1YHQ Q;  1LNX A;  3M54 A;  2FZK B;  4CC3 A;  2PVG B;  3JCM e;  4C5G A;  1N8R R;  3EG1 A;  4OMP A;  3NFC A;  2RPN A;  4C8Q B;  4RG8 A;  3PMI A;  3OYC A;  3JCM Q;  3QXE B;  1QCO A;  3CC4 Q;  1WXB A;  5I22 A;  5HY6 A;  2DL7 A;  1C1A A;  1TU0 B;  2IVW A;  5KYW B;  2FPF A;  5KYW A;  3QJY A;  3HRS A;  3OBW A;  3JAM E;  2VUB A;  1M3C A;  3CCQ T;  1N27 A;  3TEE A;  3PIO A;  3JCM W;  2X4X A;  2YWW A;  1Y96 B;  1GBR A;  2KSS A;  1AZG B;  1M4Z A;  2LJ0 A;  1X6B A;  1ZBX A;  3MKD A;  5GAO q;  3OBY A;  3PIP A;  3BE3 A;  4R0K A;  1AWJ A;  2X3X D;  4M7D A;  1BIB A;  2JMA A;  3I56 Q;  4HXJ A;  3DLL A;  3E1S A;  5KYN A;  1I5O B;  4M7A C;  3L2U A;  3RMQ A;  1WHG A;  4ZN1 A;  2DL5 A;  1OUL A;  1GFC A;  4N0A A;  2W10 A;  5GMK j;  2LNH B;  3VS1 A;  1NBE B;  1HSQ A;  4MZT A;  3CD6 Q;  1B7T A;  1TG0 A;  1JRI A;  1QP2 A;  4PNO A;  3RKX A;  1RAA B;  5M9O A;  4KBM B;  1FXX A;  4M7A B;  5CCA A;  3NTH A;  3VKI A;  2XMF A;  2K3Y A;  2KYB A;  1VQ5 A;  1QW1 A;  4PJN A;  2XK0 A;  2CS7 A;  2OAU A;  4QVZ A;  2YSQ A;  5DM7 R;  1G3W A;  1EFN A;  1QCF A;  2DJZ A;  3T9N A;  4CC4 B;  2DL8 A;  3M57 A;  1WIE A;  1BKB A;  2DK3 A;  1NM7 A;  4PJO C;  3LH0 A;  2LQK A;  3X20 B;  2QEX Q;  3V7R A;  1G8X A;  5KH6 A;  4RG2 A;  2DXU A;  3INZ A;  5A0L A;  1UGS B;  2QTV A;  2RA2 A;  3SFM A;  1LVK A;  3CBM A;  3EH2 A;  4M77 F;  1YCS B;  1VQ7 Q;  3OYK A;  2FRW A;  2DEU A;  4PL6 A;  1MNE A;  4L5G A;  1RL2 A;  3SEM A;  2E5K A;  1QKX A;  3OQ5 A;  4XTY A;  4Z02 A;  3S3N A;  3FJP A;  2AK5 A;  2AKK A;  4FW1 A;  4FYY B;  4IUU A;  1QWF A;  2HMA A;  2CZ0 B;  1MGQ A;  1TSF A;  3M4Y A;  2RI2 A;  4BY6 B;  2F69 A;  1WZO A;  2CP2 A;  2XU8 A;  1M3B A;  2D0Q B;  2M0O A;  4DOW A;  4Z88 A;  1VQ4 A;  4FU6 A;  2R5A A;  4BDY A;  2DIQ A;  3A5Z B;  4HVW A;  2DYB A;  2X3W D;  3GPL A;  2O9V A;  4DQ2 A;  2YDL A;  4QQ6 A;  4E2F B;  4BI4 A;  5C6S A;  4M78 E;  2CH4 W;  1X6O A;  1MMA A;  2LDM A;  2MCN A;  1U1T A;  1YI2 Q;  1WGS A;  2J6O A;  2P4R A;  2M02 A;  2RHX A;  1KFZ A;  4J9G A;  1T3S A;  3E9G A;  4F04 B;  5GAN j;  2QGG A;  5GMK i;  2DX1 A;  1HYO A;  1QQJ A;  4EDU A;  2XDB A;  2AT1 B;  3I55 Q;  4EIK A;  1Y96 A;  2LRQ A;  1MUZ A;  3EAE A;  2AZV A;  2KEA A;  3QWX X;  5GAN e;  1TUD A;  2DZ9 A;  3ASK A;  1GBQ A;  1WQ7 A;  3SD4 A;  2GGR A;  1JO8 A;  2DXB A;  1OOT A;  4NS5 A;  3HHT B;  5LJ3 g;  4Y91 A;  4BI8 B;  2FPE A;  5GAN 7;  3OS2 A;  1UEB A;  1RAD B;  4C92 E;  3EFR A;  4AG2 C;  4RTU A;  2HBP A;  9ATC B;  3CXC S;  1W2B S;  2L3Q A;  4FYV B;  1UGR B;  1ZUU A;  1EX4 A;  2RHI A;  1WJQ A;  1NE8 A;  4ANJ A;  1HD3 A;  2GCX A;  2COY A;  2FZC B;  4RUG A;  3EFO A;  2EIF A;  4M75 G;  3L2R A;  5I11 A;  1GXI E;  4KRT A;  2CH4 A;  4AG1 C;  2JW4 A;  3ME9 A;  2EVR A;  1BI2 A;  5GAO n;  3RR6 A;  1AWX A;  1WHL A;  3CMA T;  4N4I A;  1PD0 A;  2D0N A;  4II1 A;  2VYT A;  1YIJ Q;  5CAI A;  4J5Y A;  4DA4 A;  1TTH B;  1FMV A;  4QW2 A;  3SWN A;  1Q81 U;  2CP6 A;  3CCJ A;  2XG8 D;  1XQH A;  4IUT A;  3CCQ Q;  1UJ0 A;  3D7S B;  4OML A;  2VXF A;  1M1G A;  1AWO A;  2H3J A;  2EYW A;  1YWO A;  3L2W A;  2EQI A;  3VU3 C;  2JS0 A;  2V1Q A;  1UGV A;  4LDW A;  2QG9 B;  4C92 D;  3CPW S;  3PMT A;  8AT1 B;  2CDT A;  5KE3 A;  5A2Q E;  2X51 A;  1QKW A;  1QVF P;  4C8Q C;  3OYD A;  3O8V A;  2FEI A;  2FHD A;  1ZSG A;  2K2V A;  3MHX A;  4OGC A;  1OI1 A;  2OAW A;  1WHK A;  1NLO C;  2GQV A;  2LJ1 A;  4XTW A;  4M7A D;  2DLP A;  3I56 A;  1TOV A;  3RBB B;  3J7A F;  4M75 F;  1HK9 A;  2CYZ B;  1SG5 A;  4E7H A;  4M77 D;  2NLU A;  3H9N A;  1Q86 C;  3G1J A;  3H6Z A;  1R8O B;  3URG A;  4JRK A;  2RQV A;  4JUV A;  2DD4 A;  4C8Q G;  4XQ3 A;  4C0D B;  2J6F A;  1VQP Q;  1YJN Q;  6AT1 B;  1PKT A;  1VQ5 Q;  3QII A;  1PG5 B;  1RAF B;  3FIF A;  4F7U F;  3H0I A;  1ZUY A;  1MND A;  3CCL A;  2XKO C;  3OB9 A;  2XHC A;  3V8J A;  1PM3 A;  2MYS A;  2MMP A;  1VQP T;  2WAC A;  1KSW A;  1H64 1;  3LX7 A;  3LLR A;  1VQ9 Q;  1RLP C;  1Q7Y C;  4KGV B;  2J7I A;  3OYG A;  3QZ9 B;  3VS3 A;  2QDY B;  2QEX A;  4A4G A;  3JCM V;  2FG0 A;  1WJS A;  2DE0 X;  1K0S A;  2MWP A;  2KGT A;  3UT1 A;  5D6Y A;  2YUO A;  2P0P A;  3VS5 A;  3CCU T;  4M75 C;  3MJX A;  4OF1 A;  3H0F A;  1YJN T;  1ABQ A;  4X9C A;  1UTI A;  1M90 R;  2PUO B;  1KQS P;  3I35 A;  2HL5 C;  3S3M A; 
#chains in the Genus database with same CATH homology
 2K3B A;  2AZS A;  4F17 A;  1GRI A;  2K7A A;  3PVQ A;  1X69 A;  1WXT A;  5IXF A;  3I9Q A;  2CUB A;  1UEC A;  2C0O A;  1WDX A;  3I5S A;  1VYU A;  1NLP C;  1UDL A;  4AFU C;  3EG0 A;  1JU5 C;  2LCS A;  2M51 A;  1WA7 A;  2KRN A;  2BZ8 A;  4D8K A;  2VKN A;  3GBQ A;  2RNA A;  3LH5 A;  4IIO A;  4OMN A;  3M0P A;  4LE9 A;  1BU1 A;  1UHC A;  2GTO A;  2ENM A;  2KYM A;  2ED1 A;  1WFW A;  1W70 A;  3TVT A;  3NGP A;  1X43 A;  5IHN A;  2L2P A;  3M0Q A;  2RF0 A;  3VRY A;  1JXM A;  4X1V A;  1UG1 A;  2JM9 A;  2PZ1 A;  5IH2 A;  3VS4 A;  1GCQ A;  1ABO A;  1T0J A;  1GCP A;  2PTK A;  4J9B A;  1MV0 B;  3PVL A;  2DMO A;  2CRE A;  4JJD A;  1BK2 A;  4K11 A;  4RTX A;  2EW3 A;  3EHR A;  2CUD A;  4A63 B;  4RTZ A;  4JJB A;  5IHK A;  1AOJ A;  1SRM A;  1M8M A;  1BB9 A;  2KRM A;  4GLM A;  2L0A A;  1IO6 A;  2J05 A;  4QT7 A;  2GQI A;  3EHQ A;  2YUP A;  1M3A A;  5FWC A;  1XOV A;  2O2O A;  2VVK A;  3M0S A;  4J9F A;  1H3H A;  1FYN A;  4CC3 A;  1B07 A;  2F2V A;  2O9S A;  2YUQ A;  2HSP A;  1SSH A;  2BZX A;  2GNC A;  2DL4 A;  3EG1 A;  3M0U A;  1SHF A;  1U06 A;  1BBZ A;  4OMP A;  3UA6 A;  2RPN A;  2EGA A;  4IIM A;  2SEM A;  3REB B;  2I0N A;  3TSW A;  1M27 C;  1UE9 A;  2LX7 A;  3UAT A;  2F2W A;  2DBM A;  2OJ2 A;  2DNU A;  2EKH A;  2LQW A;  2SRC A;  4ESR A;  1U5S A;  1Z9Q A;  1SRL A;  1WXB A;  5I22 A;  2RQU A;  4Y92 A;  1E7O A;  2DL7 A;  2RQT A;  1K0X A;  2FPF A;  3M0T A;  1OPL A;  2L3P A;  1H92 A;  1H8K A;  2O88 A;  4JPB W;  1M3C A;  1PKS A;  1UJY A;  2CSQ A;  2M0Y A;  1PWT A;  3CQT A;  4E6R A;  1GBR A;  4WCI A;  1RI9 A;  3KFV A;  1AZG B;  2LJ0 A;  1X6B A;  5L23 A;  4J9H A;  1AVZ C;  4ZNX A;  1ZX6 A;  2DVJ A;  1VYV A;  2EGC A;  4JZ4 A;  4R0K A;  1AWJ A;  2X3X D;  2GTJ A;  2L3S A;  4RTY A;  2ECZ A;  2JMA A;  2JXB A;  4HXJ A;  2HDA A;  4LN2 A;  4LUE A;  2VWF A;  2DL5 A;  1GFC A;  2W10 A;  3M0R A;  4AFS C;  2LNH B;  3VS1 A;  1A0N B;  4FSS A;  1HSQ A;  1JXO A;  4Z89 A;  1TG0 A;  2D8H A;  5EC7 A;  1UUE A;  4DEY A;  2H8H A;  3JV3 A;  1YN8 A;  3UA7 A;  3EGU A;  2XMF A;  4OMQ A;  2JS2 A;  2KRS A;  2KRO A;  2KYB A;  2YUN A;  3H41 A;  1RUW A;  5ECA A;  1ZUK A;  2YSQ A;  2W0Z A;  4J9D A;  2NUZ A;  2DBK A;  1EFN A;  1QCF A;  1W1F A;  1ZLM A;  1NYF A;  1S1N A;  1PRM C;  4CC4 B;  2DL8 A;  1WIE A;  2EYX A;  5HCK A;  1NM7 A;  2JM8 A;  5FW9 A;  1SPK A;  1TUC A;  2FO0 A;  2LP5 A;  4OMM A;  1PRL C;  1YWP A;  2JTE A;  1AD5 A;  3QWY A;  2IIM A;  1T0H A;  2AKL A;  4J9I A;  5GJW B;  1YCS B;  1I07 A;  2A37 A;  2FRW A;  2FPD A;  1OEB A;  3SEM A;  2E5K A;  1QKX A;  1NYG A;  2LQN A;  2AK5 A;  4LUD A;  3VS6 A;  2AKK A;  2DF6 A;  2EYY A;  1PNJ A;  1QWF A;  2K2M A;  4J9C A;  3REA B;  1V1C A;  1M3B A;  4Z88 A;  2KT8 A;  1WXU A;  3VRZ A;  1K1Z A;  1AZE A;  2K79 A;  4Z8A A;  4HVW A;  2DYB A;  2F2X A;  2X3W D;  2EBP A;  2O9V A;  2YDL A;  4AFZ C;  1K9A A;  2CH4 W;  4J9E A;  1LCK A;  4HCK A;  2MCN A;  2J06 A;  1B3Q A;  2J6O A;  2P4R A;  1KFZ A;  4J9G A;  1T3S A;  2EYZ A;  2ROL A;  2DA9 A;  2RQW A;  2PNI A;  1JEG A;  2D8J A;  2V1R A;  2DX1 A;  1GCQ C;  2ROT A;  2LMJ A;  1YNZ A;  1SEM A;  4EIK A;  1WLP B;  2DL3 A;  2RQR A;  4AFQ C;  1OPK A;  1FMK A;  1MUZ A;  2AZV A;  2KEA A;  3QWX X;  1TUD A;  3ZL7 C;  1GBQ A;  2HBW A;  3C0C A;  1OV3 A;  2GGR A;  3EG3 A;  2K9G A;  1E6G A;  1HJD A;  1JO8 A;  2FRY A;  1OOT A;  3H0H A;  1N5Z A;  1YP5 A;  2BZY A;  4M4Z A;  2FPE A;  2KT1 A;  1Y0M A;  2LJ3 A;  2EGE A;  4AG2 C;  2HCK A;  2BTT A;  2GBQ A;  4RTU A;  3NHN A;  2O31 A;  2L3Q A;  1WYX A;  1X2Q A;  1ZUU A;  3THK A;  4ORZ A;  1U3O A;  4OMO A;  1X6G A;  1AWW A;  1CKA A;  1HD3 A;  1AEY A;  1I0C A;  4RUG A;  4JZ3 A;  2MOX A;  5FWB A;  1GL5 A;  2A08 A;  5I11 A;  2ABL A;  4KRT A;  2DJQ A;  2CH4 A;  4AG1 C;  1MV3 A;  2JW4 A;  5IXB A;  2EVR A;  1UFF A;  1RLQ C;  3ULR B;  3FJ5 A;  1AWX A;  2D0N A;  3RNJ A;  2KXD A;  1Y57 A;  1J3T A;  1X27 A;  2A36 A;  4RTT A;  2KBT A;  2JMC A;  2A28 A;  1VYT A;  2C0I A;  3NPF A;  2DM1 A;  1M30 A;  4DEX A;  1JQQ A;  1UHF A;  1UJ0 A;  4OML A;  1AWO A;  1T3L A;  1K76 A;  2EYW A;  1NG2 A;  2CT3 A;  1YWO A;  3TSZ A;  2EQI A;  2JS0 A;  2JT4 A;  2V1Q A;  1UGV A;  4CC7 A;  1GFD A;  3NMZ C;  4JJC A;  2CDT A;  1CKB A;  3U23 A;  1QKW A;  2OI3 A;  2ESW A;  4HVV A;  2FEI A;  4LNP A;  2RMO A;  1ZSG A;  3VS7 A;  2OAW A;  1SHG A;  1NLO C;  2LJ1 A;  2DRK A;  1W6X A;  3PE0 A;  3A98 A;  2DLP A;  1NEG A;  3RBB B;  3VS0 A;  4RTV A;  1KJW A;  3VS2 A;  1G83 A;  2EPD A;  1G2B A;  1Z9Z A;  2QDL A;  1X2K A;  3I5R A;  5IHI A;  1QLY A;  2DRM A;  2KE9 A;  2RQV A;  1WI7 A;  2KXC A;  2J6F A;  4F16 A;  3UF4 A;  2CSI A;  1PKT A;  2MIO A;  3H0I A;  1ZUY A;  1WX6 A;  3IQL A;  2ED0 A;  1QWE A;  4GBQ A;  1NEB A;  4D8D A;  1K4U S;  2K6D A;  1E6H A;  3O5Z A;  1ZBJ A;  3R6N A;  1CSK A;  4HVU A;  1KSW A;  2HEQ A;  1RLP C;  2NWM A;  2RN8 A;  4RTW A;  2J7I A;  3EG2 A;  1PHT A;  3VS3 A;  2B86 A;  5GJV B;  2FG0 A;  2YT6 A;  2DE0 X;  1K0S A;  3SHW A;  1I1J A;  2KGT A;  1KIK A;  2D1X A;  2C0T A;  2YUO A;  2KNB B;  3VS5 A;  1ARK A;  2J6K A;  4F14 A;  3H0F A;  2LZ6 B;  2DIL A;  1ABQ A;  2G6F X;  4CC2 A;  2KR3 A;  2CT4 A;  1UTI A;  3I35 A;  1VA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...