2M05A

Structure of module 2 from the e1 domain of c. elegans apl-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
b'EACQFSHVNSRDQCNDYQHWKDEAGKQCKTKKSKGNKDMIVRSFAVLEPCALDMFTGVEFVCCPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-amyloid-like protein
publication title Quantification of copper binding to amyloid precursor protein domain 2 and its Caenorhabditis elegans ortholog. Implications for biological function.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Unknown function
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2012-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2m05A00
3KTMA 2M05A 2FK1A 2FKLA 2FMAA 2FK3A 1OWTA 2FK2A 2FJZA 4PWQA
chains in the Genus database with same CATH superfamily
4YBZB 4JI0H 5C8YF 5EWEA 4ZI7F 3PW2A 5BMVF 4Q0YA 2WTFA 4J9NA 2BQRA 3T5JA 2JA6A 5KFYA 5LL6b 2CW8A 4UCSA 4F4WA 2O03A 2UUCH 5K2MA 1Z2OX 3TQ1A 3JSNA 2YCHA 2WE6A 4APMA 5KFTA 4NLGA 1E4FT 5DGAA 2MCTA 5FD6A 2R82A 5JVDF 3GV7B 3MR5A 4J9PA 2DPIA 4YP3A 3BQ1A 4RNOA 3ETHA 4ECUA 3KHRA 4EBDA 5KFQA 1A0IA 1TWHA 2QYZA 4MV3A 4O4IF 4O4HF 3RIZA 4A2BA 2R8HA 3PW7A 1J5EH 4A3GG 3GIIA 3V4ZA 5LOVF 2NVXA 5IYDG 1T3NA 3H4BA 2CKZB 1I7NA 1BGWA 2R7NA 3GIPA 2W70A 4ED1A 2C35B 5KFJA 3FDSA 2W8KA 4BXXG 2ZM6H 5H80A 1HR0H 3PW5A 3PW4A 1ZHSA 4DV1H 3HOYG 5KT5A 3H3VH 4QWDA 3BQ2A 3GTMA 5FJ8G 4JI8H 1L2ZA 3IN5A 4HNVA 3R5XA 4RB3C 3EPIA 4JYAH 1E4EA 4EG0A 3KTMA 2NUAB 5IP7G 2W7PA 4DL6A 1RYSA 2X0SA 3E5NA 1DGSA 4C2MA 3RBEA 5C5JA 2QK4A 2R7KA 4GLXA 4F4XA 1DIKA 5KG0A 3GQCA 5LMUH 3T5KA 4J9KA 1S03G 2XC9A 2DPJA 5LA6F 3U9TA 4MV1A 2R8GA 4Y8VB 5IYZF 1RJPA 4A3BG 2SCUB 5KFXA 3KALA 5KG7A 4DR4H 1DV2A 3KHLA 4TUYF 4UCTA 3GIQA 2F4VH 3L4JA 4ECTA 3J7AK 1FJGH 4RZRA 3RB0A 1SCUB 5D8DA 3SE7A 1M7JA 2FPGB 5KT3A 4EBEA 5F9LA 2C22A 2PN1A 2WB1A 4Q45A 4ECXA 3BG5A 3U9SA 2XGPA 3OUUA 1X9NA 1N48A 4IR9A 4LF8H 2W9BA 5FPOA 4TQRA 1JDEA 3RJ0A 3BQ0A 5LXTF 5KFFA 4BY7G 3RV3A 3RUPA 1JIHA 2C28A 1RK6A 4PDBA 4A2AA 5IYCG 3RB6A 4UFZA 5EDWA 2J6SA 4GC6A 5DLFA 3Q8PB 3RBDA 2P0AA 4R8UB 4BBSG 4MV8A 2JA7G 2R93A 2FK3A 5C3EG 4YAKB 4JV1A 5GONF 4DL2A 3FKIG 4J0MA 4F4ZA 5HBRB 4ZQIA 3WO1A 3PZPA 3H0GG 2HVSA 3QZ7A 2GPWA 3BABA 5KFPA 4R7RA 4GC7A 1VS0A 1VAJA 3EPGA 1K1QA 4O3NA 4BY1G 2UVUA 2ALZA 5IT9W 3KAJA 2UVRA 3HOVG 4YJ3F 4Q44A 1XNRH 2WB1E 2V5AA 1GYFA 2BQUA 3VPCA 4LH7A 4ECVA 4C5BA 4XYMB 4EYHB 5DQHA 2WAQA 3M9OB 4ED7A 2FPIB 3Q8SB 2YS6A 2GPSA 5KG2A 5DG7A 4JV2A 2KSWA 2W6NA 2AGOA 3PVXA 3JRXA 1T36A 2CZGA 4ZHQF 5KFNA 2V59A 4ZOLF 3Q2OA 4DV3H 2HHHH 4RB0A 5T14A 2C2RA 3N44B 2ASLA 1GO3E 1S68A 4QWBA 2VA2A 2FK2A 4FM9A 4C5AA 1WR2A 3HOWG 4DUZH 4ECSA 3G6VA 5FLXW 4Q8EA 2NVYA 3RGZA 3DF7A 2XCPA 1OWTA 3EYYA 5FD5A 1Z2NX 1GSHA 3UFXB 2JA6G 5CA1F 4TV8F 2R6FA 1SFOA 3C0FB 1ZQ7A 2HVRA 5FLMG 3HXLA 4XX0B 3GTKA 1W93A 2W71A 3MWEA 4I55F 2WAQE 4F50A 4IZOA 3OHBA 5KFSA 2PBZA 1KEEA 1N32H 2C00A 4WD3A 4JI6H 4DL7A 4AQYH 4A3MG 1UC9A 4DR2H 2R92A 4Q43A 1DV1A 3GIMA 3M4IA 3CQZA 3VPBA 3RTXA 5KG5A 2FB9A 1HNZH 3QZ8A 4QIWA 3GTGA 1GLVA 4JUZA 1KJ8A 4MV4A 5C4XG 2R8KA 5FPRA 4JI5H 1BJTA 3TIIA 2AGPA 1IBKH 3N42B 1N34H 2C2DA 4UCOA 2HGSA 1I7LA 1TWGA 2HJWA 4RAYA 4RZQA 2W9CB 4IRDA 1XNQH 4ECQA 1CE8A 3MWDA 3LWBA 2NU7B 2UUBH 5JVLA 2UUAH 4IWYA 5KG3A 1TWCA 2JA5G 3KXYT 5A2QW 4CC6A 2FLNA 4ECYA 4X62H 4DL5A 2V4RA 4OX9H 3F8NA 3T1HH 3OSPA 1BXRA 5I47A 1AN7A 5KFRA 4A3EG 2E2IA 4YR2A 2JA8G 3V4SA 1JKJB 3GIKA 4WBNF 1JDBB 4BWSC 4J9RA 2VPSA 4LF5H 1AUXA 2ZDQA 2W57A 4QIWE 5KFDA 4LMYA 4QJFA 5KFMA 1KJIA 4JI3H 4O3RA 1N36H 3BJYA 3FMAA 3IG0A 3R5FA 3GV8B 4GKKH 5KFZA 2WYOA 2NU8B 4UCRA 1Y14B 3G6XA 3PW0A 4DLKA 3JSLA 2YU9A 4A3KG 3GTJA 5KX5F 3RB3A 5KT7A 1IOVA 2R8JA 2JEGA 4MV6A 4QWEA 1JX4A 5KG4A 4A93G 5IWAH 1XMQH 4KHPH 2UVVA 4JI7H 1RJRA 1B6RA 5EOYA 1JLLB 3ETJA 2DLNA 2VPQA 5DLGA 3T5HA 4EFBA 2OWOA 4RB1A 4K0KH 4U6PA 4EGJA 4FBTA 3N8DA 4B3MH 1XDNA 1KBLA 1V4YA 5KFAA 4HNUA 3J81W 1BNCA 2R7ZA 2FMAA 1E4GT 2E5LH 3I4MG 1EHIA 4BBRG 4A3CG 1IBLH 4YR0A 3BA8A 1RK5A 1Y1VG 3CVZA 3RF2A 3PO3G 5LYJF 4QWCA 2FK1A 3NGDA 1C3OA 4B3RH 4DL3A 4IR1A 4HYKA 3BAAA 5KFUA 1K1SA 2PMZA 3Q8QB 2B63A 4LSAA 5KFIA 3MR2A 5L9XA 2AU0A 2BQ3A 1CQIB 2YRXA 1K83A 3HKZA 2RGRA 1S0OA 5KT6A 5L1KA 2ZDHA 1S0MA 1EUCB 2W6QA 5KFGA 2UXBH 1S0NA 1WCMA 2M05A 2NU9B 4EEQA 5C1PA 4HNTA 5DG8A 5J2UF 1R9TA 1A9XA 2R7LA 1GSAA 3M9MB 1UNNC 1B6SA 2XCAA 1EUDB 5L1IA 2XCLA 4IRCA 4LF4H 1CQJB 5KFEA 4QW9A 1IBMH 4NXNH 5D1OB 4LFBH 4LFAH 4O2AF 1N33H 3I12A 3PR5B 4J9MA 4ED6A 4EGQA 2VR1A 5DG9A 4DL4A 4RAZA 4PWQA 4EFEA 3I4NG 2JA7A 2IBKA 4FS2A 4G3IA 3HOZG 4DR6H 1ZHQA 4CC5A 4J9SA 2Q2UA 1MZBA 1WH2A 4I50F 4MA0A 3GTPA 3RGXA 2PMZE 1V9PA 1Y1WA 2YZMA 3L2PA 3HB9A 3HKZE 4U7CA 4LF9H 4LH6A 5KFVA 4ED2A 2DZDA 4DV6H 4ECZA 3R23A 5L1LA 1FKAH 4JI4H 4UCUA 4A3DG 3N40P 1TWAA 4I4TF 1B33N 5JQWA 1I3QA 3V6JA 2XD4A 4RU9A 3GV5B 1UC8A 4B3TH 5KT4A 4X65H 2RDIA 1VBHA 4GKJH 4L1KA 1O75A 3BA9A 3MFIA 4FS1A 2IMWP 4XYLB 4ETSA 1HNWH 5JUMA 2CQYA 3N6XA 3RAQA 2FP4B 4C5CA 4F4YA 5HV6A 5KKNB 4O3QA 4TQSA 4RNMA 2W7OA 5KFBA 5C44G 4LSXA 3MFHA 4JV0A 3K3VA 5DGBA 4YQWA 4EBCA 3AYHB 4JV5H 2YW2A 1VBGA 5D1PA 4DUYH 5C1OA 1JXLA 5CA0F 3G6YA 2JEJA 4X66H 3KHGA 3JRWA 1TA8A 5DQGA 2FLPA 2FJZA 3HOXG 1SEIA 3V6HA 4DV0H 2FE3A 5LP6F 5KFKA 5IP9G 4JI2H 1W96A 5KFOA 4ECRA 2ASJA 2R85A 2HVQA 2AQ4A 1M0TA 3HBLA 3GTOA 2I87A 2UXDH 4IWXA 4O3SA 2VQDA 4MV9A 4AYBA 3T1YH 2Y0SE 2VUMA 3N43B 5J2TF 4EEYA 3GILA 3JZIA 2UU9H 1PX2A 2WDTA 2V4QA 2OLSA 2W9CA 2UXCH 2W6OA 4ECWA 3GTQA 4DR7H 4RNNA 4J9QA 3WO0A 3M9NB 5CB4F 4A3IG 5KT2A 5IYBG 1M0WA 1E4EB 5KFHA 1XMOH 4QWAA 4XZ3B 4ED0A 2R87A 1HNXH 1S9FA 1KJQA 1PK8A 1RJQA 2VUGA 5BPHA 4DR3H 2FKLA 3PR4A 1Z2PX 3RFCA 3H4DA 3UQ8A 2IP4A 1RYRA 4DR1H 1I94H 2DIKA 3OTOH 2ZJTA 2W8LA 4DV2H 3WNZA 2R7ZG 2ATLA 1ZETA 4UCVA 1B04A 3V6KA 3VMMA 2YZNA 2R93G 2UVWA 1I6UA 3SI8A 2RGVA 4O2BF 3K5HA 1KJ9A 3MR3A 4M9UA 4A3FG 2RF4A 4DV7H 3TIGA 5EWFA 4AYBE 2B63G 2JA5A 4O4LF 2W9BB 4A3LG 1TWFA 2R84A 3PN1A 4RUAA 5EWGA 2GLTA 2C2EA 1C30A 3T5LA 4Q8FA 4DR5H 3G8CA 4QW8A 5CAEB 1SYXB 4RB2C 3MWMA 1GGOA 1WCMG 3ORRA 2ASDA 1WSCA 3VPDA 1N56A 2W6MA 4YR3A 2PVPA 4MV7A 2R7MA 4MAMA 3H40A 4B3SH 4NXMH 2YZGA 3QFFA 2J6UA 3H20A 4DV4H 1EYZA 1I50A 5KG1A 2I8CA 2R8IA 5BPFA 4R8UA 4M7EA 2W6ZA 1VKZA 5EZYF 4YY3H 4LF7H 1S10A 4LF6H 3PO2G 4O3PA 5LMNH 3RV4A 2JEIA 4A3JG 3TINA 4JI1H 4YAJB 4ED3A 2BR0A 3R5HA 1Y1WG 4IRKA 4IAJA 4O3OA 2E2HA 3ORQA 5KG6A 2FLLA 3RB4A 2YRWA 3HOUG 2VQFH 2DWCA 3Q8RB 4MTEA 4FU0A 4ME6A 1IOWA 3GIJA 3JAMW 4HR7A 1FVIA 1CS0A 1Y1VA 1M6VA 1TAEA 2VA3A 3FKIA 2VQEH 2W9AA 1GSOA 3MJFA 4MTDA 4J9OA 4ED8A 2Q2TA 5KFLA 3H0GA 2CW7A 3OHAA 3K3PA 3MR6A 5D1OA 2V58A 2V9WA 4TV9F 2ZDGA 4E4TA 5F9NA 5KFWA 2JEFA 1ULZA 2R92G 2OH2A 3N41B 3RAXA 4HQ6A 2VOBA 3OSNA 2XGQA 5L1JA 4X64H 3KAKA 1V51A 2W6PA 4J9LA 4LFCH 2XIGA 1KC7A 5DQIA 3OUZA 1S97A 1T94A 2Y0SA 4RUCA 3GLKA 1P8LA 3J80W 5KFCA 3LP8A 3L4KA 2FPPB 4IHJF 3GIDA 4YB8B 2YYAA 1KJJA 3LMLA 4YHHH 4MA5A 4EYIB 2R86A 5JH7F 3K5IA 4DV5H 2J6TA 2AGQA 2I80A 3TQTA 1AUVA 2YS7A 2NU6B 2IA6A 4FBUA 3GTLA 4YJ2F 3KHHA 3Q1KA 2YL2A 4I7HA 2J9GA 1EZ1A 2RDJA 5BR8H 2VUMG
chains in the Genus database with same CATH topology
3KTMA 2M05A 2FK1A 2FKLA 2FMAA 2FK3A 1OWTA 2FK2A 2FJZA 4PWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTM A;  2M05 A;  2FK1 A;  2FKL A;  2FMA A;  2FK3 A;  1OWT A;  2FK2 A;  2FJZ A;  4PWQ A; 
#chains in the Genus database with same CATH topology
 4YBZ B;  4JI0 H;  5C8Y F;  5EWE A;  4ZI7 F;  3PW2 A;  5BMV F;  4Q0Y A;  2WTF A;  4J9N A;  2BQR A;  3T5J A;  2JA6 A;  5KFY A;  5LL6 b;  2CW8 A;  4UCS A;  4F4W A;  2O03 A;  2UUC H;  5K2M A;  1Z2O X;  3TQ1 A;  3JSN A;  2YCH A;  2WE6 A;  4APM A;  5KFT A;  4NLG A;  1E4F T;  5DGA A;  2MCT A;  5FD6 A;  2R82 A;  5JVD F;  3GV7 B;  3MR5 A;  4J9P A;  2DPI A;  4YP3 A;  3BQ1 A;  4RNO A;  3ETH A;  4ECU A;  3KHR A;  4EBD A;  5KFQ A;  1A0I A;  1TWH A;  2QYZ A;  4MV3 A;  4O4I F;  4O4H F;  3RIZ A;  4A2B A;  2R8H A;  3PW7 A;  1J5E H;  4A3G G;  3GII A;  3V4Z A;  5LOV F;  2NVX A;  5IYD G;  1T3N A;  3H4B A;  2CKZ B;  1I7N A;  1BGW A;  2R7N A;  3GIP A;  2W70 A;  4ED1 A;  2C35 B;  5KFJ A;  3FDS A;  2W8K A;  4BXX G;  2ZM6 H;  5H80 A;  1HR0 H;  3PW5 A;  3PW4 A;  1ZHS A;  4DV1 H;  3HOY G;  5KT5 A;  3H3V H;  4QWD A;  3BQ2 A;  3GTM A;  5FJ8 G;  4JI8 H;  1L2Z A;  3IN5 A;  4HNV A;  3R5X A;  4RB3 C;  3EPI A;  4JYA H;  1E4E A;  4EG0 A;  3KTM A;  2NUA B;  5IP7 G;  2W7P A;  4DL6 A;  1RYS A;  2X0S A;  3E5N A;  1DGS A;  4C2M A;  3RBE A;  5C5J A;  2QK4 A;  2R7K A;  4GLX A;  4F4X A;  1DIK A;  5KG0 A;  3GQC A;  5LMU H;  3T5K A;  4J9K A;  1S03 G;  2XC9 A;  2DPJ A;  5LA6 F;  3U9T A;  4MV1 A;  2R8G A;  4Y8V B;  5IYZ F;  1RJP A;  4A3B G;  2SCU B;  5KFX A;  3KAL A;  5KG7 A;  4DR4 H;  1DV2 A;  3KHL A;  4TUY F;  4UCT A;  3GIQ A;  2F4V H;  3L4J A;  4ECT A;  3J7A K;  1FJG H;  4RZR A;  3RB0 A;  1SCU B;  5D8D A;  3SE7 A;  1M7J A;  2FPG B;  5KT3 A;  4EBE A;  5F9L A;  2C22 A;  2PN1 A;  2WB1 A;  4Q45 A;  4ECX A;  3BG5 A;  3U9S A;  2XGP A;  3OUU A;  1X9N A;  1N48 A;  4IR9 A;  4LF8 H;  2W9B A;  5FPO A;  4TQR A;  1JDE A;  3RJ0 A;  3BQ0 A;  5LXT F;  5KFF A;  4BY7 G;  3RV3 A;  3RUP A;  1JIH A;  2C28 A;  1RK6 A;  4PDB A;  4A2A A;  5IYC G;  3RB6 A;  4UFZ A;  5EDW A;  2J6S A;  4GC6 A;  5DLF A;  3Q8P B;  3RBD A;  2P0A A;  4R8U B;  4BBS G;  4MV8 A;  2JA7 G;  2R93 A;  2FK3 A;  5C3E G;  4YAK B;  4JV1 A;  5GON F;  4DL2 A;  3FKI G;  4J0M A;  4F4Z A;  5HBR B;  4ZQI A;  3WO1 A;  3PZP A;  3H0G G;  2HVS A;  3QZ7 A;  2GPW A;  3BAB A;  5KFP A;  4R7R A;  4GC7 A;  1VS0 A;  1VAJ A;  3EPG A;  1K1Q A;  4O3N A;  4BY1 G;  2UVU A;  2ALZ A;  5IT9 W;  3KAJ A;  2UVR A;  3HOV G;  4YJ3 F;  4Q44 A;  1XNR H;  2WB1 E;  2V5A A;  1GYF A;  2BQU A;  3VPC A;  4LH7 A;  4ECV A;  4C5B A;  4XYM B;  4EYH B;  5DQH A;  2WAQ A;  3M9O B;  4ED7 A;  2FPI B;  3Q8S B;  2YS6 A;  2GPS A;  5KG2 A;  5DG7 A;  4JV2 A;  2KSW A;  2W6N A;  2AGO A;  3PVX A;  3JRX A;  1T36 A;  2CZG A;  4ZHQ F;  5KFN A;  2V59 A;  4ZOL F;  3Q2O A;  4DV3 H;  2HHH H;  4RB0 A;  5T14 A;  2C2R A;  3N44 B;  2ASL A;  1GO3 E;  1S68 A;  4QWB A;  2VA2 A;  2FK2 A;  4FM9 A;  4C5A A;  1WR2 A;  3HOW G;  4DUZ H;  4ECS A;  3G6V A;  5FLX W;  4Q8E A;  2NVY A;  3RGZ A;  3DF7 A;  2XCP A;  1OWT A;  3EYY A;  5FD5 A;  1Z2N X;  1GSH A;  3UFX B;  2JA6 G;  5CA1 F;  4TV8 F;  2R6F A;  1SFO A;  3C0F B;  1ZQ7 A;  2HVR A;  5FLM G;  3HXL A;  4XX0 B;  3GTK A;  1W93 A;  2W71 A;  3MWE A;  4I55 F;  2WAQ E;  4F50 A;  4IZO A;  3OHB A;  5KFS A;  2PBZ A;  1KEE A;  1N32 H;  2C00 A;  4WD3 A;  4JI6 H;  4DL7 A;  4AQY H;  4A3M G;  1UC9 A;  4DR2 H;  2R92 A;  4Q43 A;  1DV1 A;  3GIM A;  3M4I A;  3CQZ A;  3VPB A;  3RTX A;  5KG5 A;  2FB9 A;  1HNZ H;  3QZ8 A;  4QIW A;  3GTG A;  1GLV A;  4JUZ A;  1KJ8 A;  4MV4 A;  5C4X G;  2R8K A;  5FPR A;  4JI5 H;  1BJT A;  3TII A;  2AGP A;  1IBK H;  3N42 B;  1N34 H;  2C2D A;  4UCO A;  2HGS A;  1I7L A;  1TWG A;  2HJW A;  4RAY A;  4RZQ A;  2W9C B;  4IRD A;  1XNQ H;  4ECQ A;  1CE8 A;  3MWD A;  3LWB A;  2NU7 B;  2UUB H;  5JVL A;  2UUA H;  4IWY A;  5KG3 A;  1TWC A;  2JA5 G;  3KXY T;  5A2Q W;  4CC6 A;  2FLN A;  4ECY A;  4X62 H;  4DL5 A;  2V4R A;  4OX9 H;  3F8N A;  3T1H H;  3OSP A;  1BXR A;  5I47 A;  1AN7 A;  5KFR A;  4A3E G;  2E2I A;  4YR2 A;  2JA8 G;  3V4S A;  1JKJ B;  3GIK A;  4WBN F;  1JDB B;  4BWS C;  4J9R A;  2VPS A;  4LF5 H;  1AUX A;  2ZDQ A;  2W57 A;  4QIW E;  5KFD A;  4LMY A;  4QJF A;  5KFM A;  1KJI A;  4JI3 H;  4O3R A;  1N36 H;  3BJY A;  3FMA A;  3IG0 A;  3R5F A;  3GV8 B;  4GKK H;  5KFZ A;  2WYO A;  2NU8 B;  4UCR A;  1Y14 B;  3G6X A;  3PW0 A;  4DLK A;  3JSL A;  2YU9 A;  4A3K G;  3GTJ A;  5KX5 F;  3RB3 A;  5KT7 A;  1IOV A;  2R8J A;  2JEG A;  4MV6 A;  4QWE A;  1JX4 A;  5KG4 A;  4A93 G;  5IWA H;  1XMQ H;  4KHP H;  2UVV A;  4JI7 H;  1RJR A;  1B6R A;  5EOY A;  1JLL B;  3ETJ A;  2DLN A;  2VPQ A;  5DLG A;  3T5H A;  4EFB A;  2OWO A;  4RB1 A;  4K0K H;  4U6P A;  4EGJ A;  4FBT A;  3N8D A;  4B3M H;  1XDN A;  1KBL A;  1V4Y A;  5KFA A;  4HNU A;  3J81 W;  1BNC A;  2R7Z A;  2FMA A;  1E4G T;  2E5L H;  3I4M G;  1EHI A;  4BBR G;  4A3C G;  1IBL H;  4YR0 A;  3BA8 A;  1RK5 A;  1Y1V G;  3CVZ A;  3RF2 A;  3PO3 G;  5LYJ F;  4QWC A;  2FK1 A;  3NGD A;  1C3O A;  4B3R H;  4DL3 A;  4IR1 A;  4HYK A;  3BAA A;  5KFU A;  1K1S A;  2PMZ A;  3Q8Q B;  2B63 A;  4LSA A;  5KFI A;  3MR2 A;  5L9X A;  2AU0 A;  2BQ3 A;  1CQI B;  2YRX A;  1K83 A;  3HKZ A;  2RGR A;  1S0O A;  5KT6 A;  5L1K A;  2ZDH A;  1S0M A;  1EUC B;  2W6Q A;  5KFG A;  2UXB H;  1S0N A;  1WCM A;  2M05 A;  2NU9 B;  4EEQ A;  5C1P A;  4HNT A;  5DG8 A;  5J2U F;  1R9T A;  1A9X A;  2R7L A;  1GSA A;  3M9M B;  1UNN C;  1B6S A;  2XCA A;  1EUD B;  5L1I A;  2XCL A;  4IRC A;  4LF4 H;  1CQJ B;  5KFE A;  4QW9 A;  1IBM H;  4NXN H;  5D1O B;  4LFB H;  4LFA H;  4O2A F;  1N33 H;  3I12 A;  3PR5 B;  4J9M A;  4ED6 A;  4EGQ A;  2VR1 A;  5DG9 A;  4DL4 A;  4RAZ A;  4PWQ A;  4EFE A;  3I4N G;  2JA7 A;  2IBK A;  4FS2 A;  4G3I A;  3HOZ G;  4DR6 H;  1ZHQ A;  4CC5 A;  4J9S A;  2Q2U A;  1MZB A;  1WH2 A;  4I50 F;  4MA0 A;  3GTP A;  3RGX A;  2PMZ E;  1V9P A;  1Y1W A;  2YZM A;  3L2P A;  3HB9 A;  3HKZ E;  4U7C A;  4LF9 H;  4LH6 A;  5KFV A;  4ED2 A;  2DZD A;  4DV6 H;  4ECZ A;  3R23 A;  5L1L A;  1FKA H;  4JI4 H;  4UCU A;  4A3D G;  3N40 P;  1TWA A;  4I4T F;  1B33 N;  5JQW A;  1I3Q A;  3V6J A;  2XD4 A;  4RU9 A;  3GV5 B;  1UC8 A;  4B3T H;  5KT4 A;  4X65 H;  2RDI A;  1VBH A;  4GKJ H;  4L1K A;  1O75 A;  3BA9 A;  3MFI A;  4FS1 A;  2IMW P;  4XYL B;  4ETS A;  1HNW H;  5JUM A;  2CQY A;  3N6X A;  3RAQ A;  2FP4 B;  4C5C A;  4F4Y A;  5HV6 A;  5KKN B;  4O3Q A;  4TQS A;  4RNM A;  2W7O A;  5KFB A;  5C44 G;  4LSX A;  3MFH A;  4JV0 A;  3K3V A;  5DGB A;  4YQW A;  4EBC A;  3AYH B;  4JV5 H;  2YW2 A;  1VBG A;  5D1P A;  4DUY H;  5C1O A;  1JXL A;  5CA0 F;  3G6Y A;  2JEJ A;  4X66 H;  3KHG A;  3JRW A;  1TA8 A;  5DQG A;  2FLP A;  2FJZ A;  3HOX G;  1SEI A;  3V6H A;  4DV0 H;  2FE3 A;  5LP6 F;  5KFK A;  5IP9 G;  4JI2 H;  1W96 A;  5KFO A;  4ECR A;  2ASJ A;  2R85 A;  2HVQ A;  2AQ4 A;  1M0T A;  3HBL A;  3GTO A;  2I87 A;  2UXD H;  4IWX A;  4O3S A;  2VQD A;  4MV9 A;  4AYB A;  3T1Y H;  2Y0S E;  2VUM A;  3N43 B;  5J2T F;  4EEY A;  3GIL A;  3JZI A;  2UU9 H;  1PX2 A;  2WDT A;  2V4Q A;  2OLS A;  2W9C A;  2UXC H;  2W6O A;  4ECW A;  3GTQ A;  4DR7 H;  4RNN A;  4J9Q A;  3WO0 A;  3M9N B;  5CB4 F;  4A3I G;  5KT2 A;  5IYB G;  1M0W A;  1E4E B;  5KFH A;  1XMO H;  4QWA A;  4XZ3 B;  4ED0 A;  2R87 A;  1HNX H;  1S9F A;  1KJQ A;  1PK8 A;  1RJQ A;  2VUG A;  5BPH A;  4DR3 H;  2FKL A;  3PR4 A;  1Z2P X;  3RFC A;  3H4D A;  3UQ8 A;  2IP4 A;  1RYR A;  4DR1 H;  1I94 H;  2DIK A;  3OTO H;  2ZJT A;  2W8L A;  4DV2 H;  3WNZ A;  2R7Z G;  2ATL A;  1ZET A;  4UCV A;  1B04 A;  3V6K A;  3VMM A;  2YZN A;  2R93 G;  2UVW A;  1I6U A;  3SI8 A;  2RGV A;  4O2B F;  3K5H A;  1KJ9 A;  3MR3 A;  4M9U A;  4A3F G;  2RF4 A;  4DV7 H;  3TIG A;  5EWF A;  4AYB E;  2B63 G;  2JA5 A;  4O4L F;  2W9B B;  4A3L G;  1TWF A;  2R84 A;  3PN1 A;  4RUA A;  5EWG A;  2GLT A;  2C2E A;  1C30 A;  3T5L A;  4Q8F A;  4DR5 H;  3G8C A;  4QW8 A;  5CAE B;  1SYX B;  4RB2 C;  3MWM A;  1GGO A;  1WCM G;  3ORR A;  2ASD A;  1WSC A;  3VPD A;  1N56 A;  2W6M A;  4YR3 A;  2PVP A;  4MV7 A;  2R7M A;  4MAM A;  3H40 A;  4B3S H;  4NXM H;  2YZG A;  3QFF A;  2J6U A;  3H20 A;  4DV4 H;  1EYZ A;  1I50 A;  5KG1 A;  2I8C A;  2R8I A;  5BPF A;  4R8U A;  4M7E A;  2W6Z A;  1VKZ A;  5EZY F;  4YY3 H;  4LF7 H;  1S10 A;  4LF6 H;  3PO2 G;  4O3P A;  5LMN H;  3RV4 A;  2JEI A;  4A3J G;  3TIN A;  4JI1 H;  4YAJ B;  4ED3 A;  2BR0 A;  3R5H A;  1Y1W G;  4IRK A;  4IAJ A;  4O3O A;  2E2H A;  3ORQ A;  5KG6 A;  2FLL A;  3RB4 A;  2YRW A;  3HOU G;  2VQF H;  2DWC A;  3Q8R B;  4MTE A;  4FU0 A;  4ME6 A;  1IOW A;  3GIJ A;  3JAM W;  4HR7 A;  1FVI A;  1CS0 A;  1Y1V A;  1M6V A;  1TAE A;  2VA3 A;  3FKI A;  2VQE H;  2W9A A;  1GSO A;  3MJF A;  4MTD A;  4J9O A;  4ED8 A;  2Q2T A;  5KFL A;  3H0G A;  2CW7 A;  3OHA A;  3K3P A;  3MR6 A;  5D1O A;  2V58 A;  2V9W A;  4TV9 F;  2ZDG A;  4E4T A;  5F9N A;  5KFW A;  2JEF A;  1ULZ A;  2R92 G;  2OH2 A;  3N41 B;  3RAX A;  4HQ6 A;  2VOB A;  3OSN A;  2XGQ A;  5L1J A;  4X64 H;  3KAK A;  1V51 A;  2W6P A;  4J9L A;  4LFC H;  2XIG A;  1KC7 A;  5DQI A;  3OUZ A;  1S97 A;  1T94 A;  2Y0S A;  4RUC A;  3GLK A;  1P8L A;  3J80 W;  5KFC A;  3LP8 A;  3L4K A;  2FPP B;  4IHJ F;  3GID A;  4YB8 B;  2YYA A;  1KJJ A;  3LML A;  4YHH H;  4MA5 A;  4EYI B;  2R86 A;  5JH7 F;  3K5I A;  4DV5 H;  2J6T A;  2AGQ A;  2I80 A;  3TQT A;  1AUV A;  2YS7 A;  2NU6 B;  2IA6 A;  4FBU A;  3GTL A;  4YJ2 F;  3KHH A;  3Q1K A;  2YL2 A;  4I7H A;  2J9G A;  1EZ1 A;  2RDJ A;  5BR8 H;  2VUM G; 
#chains in the Genus database with same CATH homology
 3KTM A;  2M05 A;  2FK1 A;  2FKL A;  2FMA A;  2FK3 A;  1OWT A;  2FK2 A;  2FJZ A;  4PWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...