2M05A

Structure of module 2 from the e1 domain of c. elegans apl-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
EACQFSHVNSRDQCNDYQHWKDEAGKQCKTKKSKGNKDMIVRSFAVLEPCALDMFTGVEFVCCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Quantification of copper binding to amyloid precursor protein domain 2 and its Caenorhabditis elegans ortholog. Implications for biological function.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Unknown function
molecule keywords Beta-amyloid-like protein
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2012-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2m05A00
2FK1A 2FMAA 2FK2A 2M05A 3KTMA 2FJZA 1OWTA 4PWQA 2FKLA 2FK3A
chains in the Genus database with same CATH superfamily
4B3RH 2C22A 5GONF 4BBRG 1HNXH 2WTFA 4CC6A 5DLFA 2PMZA 3VMMA 2PVPA 4F4XA 4QIWA 4M7EA 5KFIA 1CQJB 5KFVA 4TQRA 2C28A 4MAMA 4LFCH 2UVUA 2RDIA 2HGSA 3K5HA 1JLLB 5CA0F 3EPGA 1AUXA 3H0GG 3C0FB 4ZQIA 2R8GA 5CB4F 4DL4A 5FD5A 2VA3A 1Y14B 3G6VA 4X66H 4DV7H 5BPHA 5LXTF 1C3OA 1WCMG 4LSAA 3GIKA 4ECWA 2YRXA 3GTJA 3JSNA 3Q8QB 4A2BA 3VPBA 4X64H 4G3IA 3RGZA 1M7JA 3OHAA 4QW9A 3IG0A 2W6ZA 1V9PA 3U9TA 3G6YA 4ECXA 2Q2UA 2ZDQA 5C3EG 3MFIA 3T5LA 5KFOA 2VQEH 2FLNA 4IWXA 4DV4H 5KT6A 5KG7A 2JA5G 2YU9A 1TAEA 4HR7A 4QIWE 3PO2G 3WNZA 4O3OA 2FP4B 2VOBA 2WAQE 4Y8VB 2J6SA 2WYOA 2VA2A 3QZ7A 3HB9A 2C2DA 2R82A 2VPSA 2RGRA 1N33H 1I7NA 2Y0SA 3MJFA 4IRDA 3KAKA 4R7RA 4A3JG 2JEFA 4ED7A 1J5EH 1B33N 4ECZA 2M05A 4JI8H 5IYCG 4Q0YA 3I12A 2W9BA 4FU0A 3FKIA 3MWDA 4LF9H 4Q43A 1TWHA 2FPPB 3H4DA 3QFFA 2UXDH 2XGQA 1T36A 4FBUA 4LF5H 4EGQA 3V4SA 1DV2A 3VPCA 3KHLA 1TA8A 2OWOA 2F4VH 3TQ1A 3WO0A 1Y1WA 3R5FA 5KFFA 1EUCB 4MV9A 5KX5F 2UUAH 5IYBG 5DGBA 4A93G 4RAZA 2YYAA 3JSLA 5KFKA 3CQZA 5D1PA 1I3QA 5DG7A 4RNMA 3K3PA 3V6JA 3GQCA 2JEJA 4IZOA 3BA8A 4LF8H 3U9SA 3R5HA 5A2QW 4O3SA 1DGSA 3RB6A 5DG9A 3RUPA 2JA7A 5D8DA 4TUYF 2ASLA 5L1IA 4GKKH 4F50A 3Q8RB 3PO3G 2PBZA 1Z2PX 4DR4H 5JVDF 1DIKA 4HQ6A 3H4BA 5T14A 3RV3A 1M0WA 3GV8B 4DV2H 3JRWA 3KXYT 2Y0SE 3T1YH 2W57A 2IP4A 3ETJA 3LMLA 4IWYA 5KG0A 3GIQA 3OUZA 2W6OA 3DF7A 3GLKA 4RB0A 3SI8A 5EOYA 3J81W 5IWAH 2NU6B 5KFUA 3I4MG 4IHJF 5KT2A 3HOUG 1PK8A 4LH6A 4ECSA 5C4XG 2AQ4A 4DV1H 3G6XA 2CKZB 5L1JA 2CZGA 2UVVA 4ED1A 1MZBA 4BXXG 2R85A 3M9OB 1S03G 5KG4A 2GPWA 2C2EA 1A9XA 3HOVG 5L9XA 1EZ1A 2W8LA 3RAXA 1GSHA 4JI5H 2VUMA 2YW2A 5J2UF 1E4FT 2V5AA 2W9AA 4QJFA 2C2RA 2W6PA 2I8CA 1S0NA 2IMWP 2J6TA 4Q8FA 4ECUA 4QWDA 2OH2A 1Y1VG 4EG0A 5KFMA 3T5KA 3MFHA 4YP3A 2FK1A 4X65H 3RBDA 4QWBA 1TWCA 5KFZA 5DQIA 5HV6A 3N42B 5LL6b 4FS2A 2P0AA 4YBZB 1IBKH 4LFBH 2NVYA 1ZHSA 4R8UA 4APMA 3KAJA 5LOVF 3I4NG 2R6FA 4PDBA 4HNVA 2V58A 5C1OA 1UNNC 4EFEA 5IP9G 3N41B 4RB1A 1HNZH 4KHPH 5FLMG 4YR2A 1M6VA 2Q2TA 1RJRA 1KJQA 1KJIA 2I87A 1KJ8A 4L1KA 1GGOA 3RJ0A 2HVSA 2UUBH 1ZHQA 1WCMA 4RNOA 4I55F 5LYJF 1HNWH 4IRCA 2R93A 1IOVA 3BG5A 1E4EB 4FS1A 1SYXB 2PN1A 2R7NA 2FK2A 2R8IA 2HVRA 1SCUB 3OHBA 4ECTA 2VPQA 2ZDHA 2FKLA 4QWAA 3GTGA 1BXRA 5L1KA 3EYYA 4LSXA 1XNQH 2AGQA 4MV3A 5BPFA 4M9UA 3RBEA 4ECQA 4UCSA 4JI1H 4O2BF 4A3DG 3GTKA 3PW4A 1S97A 1VS0A 4YQWA 2BR0A 1I50A 2XC9A 2MCTA 3HBLA 5L1LA 2AGOA 2W9CB 4EFBA 4J0MA 4XYLB 4Q44A 4B3SH 5KFWA 3PW0A 4F4ZA 2R92G 2W7OA 4A3GG 1JIHA 3RB0A 4HNUA 4R8UB 2ZDGA 4DL6A 4K0KH 4HNTA 4YR0A 3GIIA 2JEIA 4Q8EA 4J9NA 2VQDA 4A3FG 5DGAA 5JQWA 1A0IA 1WR2A 4XYMB 4MA5A 2DWCA 2XCAA 3Q1KA 2W6QA 4J9RA 4DV0H 4ME6A 2NU8B 4O4LF 4OX9H 1GLVA 3LWBA 2FPIB 4HYKA 1AN7A 3GTPA 5KFPA 2JA8G 3GIDA 1K1QA 2GPSA 2HVQA 4UFZA 5KG1A 2UVWA 2JEGA 3GIPA 4JV5H 2WE6A 1CS0A 2E2IA 2J6UA 2UXCH 4JV2A 4J9OA 1JKJB 1R9TA 1V4YA 2E5LH 3BABA 2X0SA 2YZGA 5BR8H 3PW5A 3UQ8A 4IR1A 1ZETA 4ECYA 3Q8PB 4IAJA 3FKIG 4O4HF 5F9LA 2DIKA 2CW8A 3RFCA 3GIJA 5C8YF 4DV6H 3J7AK 1RJQA 4RZQA 4DL7A 4DR6H 3KHRA 1VKZA 3VPDA 4C2MA 5JUMA 3QZ8A 3CVZA 3K5IA 3M9MB 3JRXA 2V4QA 1RK5A 3EPIA 5FPOA 2UVRA 4LFAH 2IBKA 5C44G 4TV8F 3BQ0A 3PR5B 1I94H 4QW8A 1BNCA 3WO1A 4AYBE 1B6RA 2R86A 3N43B 3N8DA 4JV0A 4RU9A 2IA6A 4A3LG 5I47A 4A3KG 1E4GT 3Q2OA 2JA5A 3MR6A 1BGWA 4DV5H 2B63A 5KFRA 1V51A 3LP8A 1N34H 2BQ3A 3G8CA 3NGDA 1OWTA 3MR3A 4MA0A 5KT7A 2W70A 1Y1WG 5K2MA 4FM9A 4FBTA 2HJWA 5IP7G 3M9NB 4BY1G 3GTOA 3FDSA 3H20A 3AYHB 3KALA 4I7HA 4J9SA 4DR7H 2YZMA 2VUMG 2UXBH 1O75A 4UCVA 2VUGA 5JH7F 3L2PA 5C5JA 2PMZE 3RAQA 5FJ8G 2XGPA 4RZRA 3BA9A 4MV7A 4YY3H 1JX4A 2UUCH 4J9MA 4ECVA 1WH2A 1KBLA 5KFCA 3BQ2A 3HOWG 4A3BG 2I80A 1UC9A 4MTDA 5LMNH 4A3CG 4EBEA 2FLLA 5LP6F 3BQ1A 2WB1A 4WD3A 1S0MA 3Q8SB 4YJ2F 3FMAA 3TINA 2V4RA 2W9CA 4AYBA 4DR2H 4MV4A 5KFLA 5KFQA 4A3IG 4IR9A 4A2AA 4A3MG 4JI6H 4NXNH 5KFJA 1FKAH 4YB8B 2VQFH 1CE8A 1L2ZA 1TWAA 2ALZA 5J2TF 2GLTA 4DUZH 1T94A 5C1PA 3RIZA 3GILA 2R8KA 3PW7A 1EYZA 3HXLA 4UCRA 1CQIB 5LMUH 4DR1H 2FE3A 4F4WA 4JI2H 2YL2A 1DV1A 2XD4A 3HKZE 1HR0H 4O3RA 3TIGA 3GIMA 4GLXA 4JUZA 2FK3A 4Q45A 5HBRB 1JDBB 1GSAA 1N56A 3GV7B 4RUAA 4ETSA 4MV8A 1XMQH 1EHIA 5DQHA 4C5BA 3RGXA 1AUVA 3HOZG 2ZM6H 2ZJTA 4LMYA 2FLPA 4DUYH 2DPIA 3RV4A 1KJ9A 4O3PA 4GC7A 1TWFA 4MV1A 4JI4H 3HOYG 4LF7H 1Y1VA 2QK4A 1ZQ7A 4PWQA 1JDEA 4X62H 3RB4A 1X9NA 1K83A 4UCUA 2SCUB 5KFEA 2FB9A 2J9GA 3OUUA 2O03A 4WBNF 5IYDG 4DL3A 1C30A 4XX0B 1XNRH 4O3NA 2ASJA 4QWEA 4GC6A 4QWCA 5CAEB 3N6XA 2OLSA 3PW2A 2FMAA 4ED3A 4O4IF 2R84A 5KG3A 3PN1A 5KFAA 2VR1A 2C00A 3MWEA 4ED0A 1S68A 2JA7G 5IYZF 3F8NA 2XIGA 5KFYA 4RNNA 1GSOA 5DG8A 4DLKA 2ASDA 1VBGA 3ORRA 4B3MH 1TWGA 1EUDB 4U7CA 2V9WA 2NVXA 4J9QA 2CW7A 4MTEA 1PX2A 2JA6A 4EYIB 4ZOLF 5H80A 2W7PA 1S9FA 4MV6A 5D1OA 2QYZA 4I4TF 5DLGA 1XDNA 3JZIA 5KFNA 2R8HA 4A3EG 2R7KA 4UCOA 2RDJA 1IBMH 1FJGH 2FPGB 5EZYF 4DV3H 4JYAH 4JI3H 4EGJA 1N36H 1B04A 5KFHA 5DQGA 2UU9H 2RGVA 3RTXA 5KT5A 1K1SA 3R23A 2C35B 2R93G 4EBCA 4BBSG 2NU7B 5IT9W 3J80W 4RAYA 4GKJH 5KFXA 4NXMH 2XCLA 5KFBA 2WDTA 4ZHQF 1ULZA 4B3TH 1N32H 3K3VA 4TQSA 4J9LA 1RYSA 1W93A 3L4KA 1Z2OX 2DPJA 4ED6A 5FD6A 3H0GA 3V6HA 1M0TA 1SFOA 4ED2A 2NUAB 2BQRA 2WB1E 2CQYA 4YR3A 1S0OA 4NLGA 5KG2A 3RB3A 2YS6A 3TQTA 1B6SA 2YS7A 5EDWA 4JV1A 4LF6H 3V6KA 2R7ZG 4J9PA 1GYFA 3HKZA 3V4ZA 4TV9F 2W9BB 4YAKB 1KEEA 3OSPA 3PZPA 5EWFA 4BY7G 4RUCA 2WAQA 5FPRA 3PR4A 5KFDA 3HOXG 2JA6G 1GO3E 3KHHA 1Z2NX 2DLNA 3IN5A 5LA6F 4F4YA 4DL2A 5BMVF 3N44B 3OSNA 3MR5A 3H40A 4JI7H 3GTLA 2R7ZA 2YRWA 1RJPA 2W6NA 4IRKA 4EBDA 2YZNA 4LH7A 1BJTA 4O2AF 4E4TA 1N48A 1RYRA 4ECRA 3KTMA 3N40P 4RB3C 1P8LA 3BJYA 2W6MA 2ATLA 1VAJA 2AU0A 2BQUA 4DL5A 4LF4H 4YAJB 2R87A 2RF4A 3GTMA 3BAAA 5KT4A 1T3NA 2V59A 5KG5A 5EWGA 2R7MA 4CC5A 3L4JA 2E2HA 3R5XA 2NU9B 3RF2A 5CA1F 4RB2C 2W8KA 3E5NA 1I7LA 1XMOH 1JXLA 3JAMW 1WSCA 3T1HH 4U6PA 4J9KA 3MR2A 4O3QA 1FVIA 5KT3A 4JI0H 1SEIA 2R92A 3GTQA 1IOWA 2DZDA 3ETHA 5KFTA 3SE7A 1E4EA 1KC7A 3ORQA 4EEQA 1UC8A 3GV5B 4AQYH 2B63G 3PVXA 3H3VH 3M4IA 4C5AA 4YHHH 2KSWA 5KFGA 5KG6A 3T5JA 3TIIA 3UFXB 4YJ3F 4C5CA 4EEYA 1S10A 1RK6A 1W96A 1IBLH 1VBHA 4UCTA 5JVLA 2XCPA 5F9NA 5KFSA 2HHHH 4DR5H 4EYHB 5FLXW 4ED8A 2R7LA 5D1OB 3T5HA 2FJZA 4BWSC 4ZI7F 3KHGA 3MWMA 2AGPA 1I6UA 2R8JA 4DR3H 5KKNB 3OTOH 2W71A 4XZ3B 4I50F 5EWEA 1KJJA 2YCHA
chains in the Genus database with same CATH topology
2FK1A 2FMAA 2FK2A 2M05A 3KTMA 2FJZA 1OWTA 4PWQA 2FKLA 2FK3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FK1 A;  2FMA A;  2FK2 A;  2M05 A;  3KTM A;  2FJZ A;  1OWT A;  4PWQ A;  2FKL A;  2FK3 A; 
#chains in the Genus database with same CATH topology
 4B3R H;  2C22 A;  5GON F;  4BBR G;  1HNX H;  2WTF A;  4CC6 A;  5DLF A;  2PMZ A;  3VMM A;  2PVP A;  4F4X A;  4QIW A;  4M7E A;  5KFI A;  1CQJ B;  5KFV A;  4TQR A;  2C28 A;  4MAM A;  4LFC H;  2UVU A;  2RDI A;  2HGS A;  3K5H A;  1JLL B;  5CA0 F;  3EPG A;  1AUX A;  3H0G G;  3C0F B;  4ZQI A;  2R8G A;  5CB4 F;  4DL4 A;  5FD5 A;  2VA3 A;  1Y14 B;  3G6V A;  4X66 H;  4DV7 H;  5BPH A;  5LXT F;  1C3O A;  1WCM G;  4LSA A;  3GIK A;  4ECW A;  2YRX A;  3GTJ A;  3JSN A;  3Q8Q B;  4A2B A;  3VPB A;  4X64 H;  4G3I A;  3RGZ A;  1M7J A;  3OHA A;  4QW9 A;  3IG0 A;  2W6Z A;  1V9P A;  3U9T A;  3G6Y A;  4ECX A;  2Q2U A;  2ZDQ A;  5C3E G;  3MFI A;  3T5L A;  5KFO A;  2VQE H;  2FLN A;  4IWX A;  4DV4 H;  5KT6 A;  5KG7 A;  2JA5 G;  2YU9 A;  1TAE A;  4HR7 A;  4QIW E;  3PO2 G;  3WNZ A;  4O3O A;  2FP4 B;  2VOB A;  2WAQ E;  4Y8V B;  2J6S A;  2WYO A;  2VA2 A;  3QZ7 A;  3HB9 A;  2C2D A;  2R82 A;  2VPS A;  2RGR A;  1N33 H;  1I7N A;  2Y0S A;  3MJF A;  4IRD A;  3KAK A;  4R7R A;  4A3J G;  2JEF A;  4ED7 A;  1J5E H;  1B33 N;  4ECZ A;  2M05 A;  4JI8 H;  5IYC G;  4Q0Y A;  3I12 A;  2W9B A;  4FU0 A;  3FKI A;  3MWD A;  4LF9 H;  4Q43 A;  1TWH A;  2FPP B;  3H4D A;  3QFF A;  2UXD H;  2XGQ A;  1T36 A;  4FBU A;  4LF5 H;  4EGQ A;  3V4S A;  1DV2 A;  3VPC A;  3KHL A;  1TA8 A;  2OWO A;  2F4V H;  3TQ1 A;  3WO0 A;  1Y1W A;  3R5F A;  5KFF A;  1EUC B;  4MV9 A;  5KX5 F;  2UUA H;  5IYB G;  5DGB A;  4A93 G;  4RAZ A;  2YYA A;  3JSL A;  5KFK A;  3CQZ A;  5D1P A;  1I3Q A;  5DG7 A;  4RNM A;  3K3P A;  3V6J A;  3GQC A;  2JEJ A;  4IZO A;  3BA8 A;  4LF8 H;  3U9S A;  3R5H A;  5A2Q W;  4O3S A;  1DGS A;  3RB6 A;  5DG9 A;  3RUP A;  2JA7 A;  5D8D A;  4TUY F;  2ASL A;  5L1I A;  4GKK H;  4F50 A;  3Q8R B;  3PO3 G;  2PBZ A;  1Z2P X;  4DR4 H;  5JVD F;  1DIK A;  4HQ6 A;  3H4B A;  5T14 A;  3RV3 A;  1M0W A;  3GV8 B;  4DV2 H;  3JRW A;  3KXY T;  2Y0S E;  3T1Y H;  2W57 A;  2IP4 A;  3ETJ A;  3LML A;  4IWY A;  5KG0 A;  3GIQ A;  3OUZ A;  2W6O A;  3DF7 A;  3GLK A;  4RB0 A;  3SI8 A;  5EOY A;  3J81 W;  5IWA H;  2NU6 B;  5KFU A;  3I4M G;  4IHJ F;  5KT2 A;  3HOU G;  1PK8 A;  4LH6 A;  4ECS A;  5C4X G;  2AQ4 A;  4DV1 H;  3G6X A;  2CKZ B;  5L1J A;  2CZG A;  2UVV A;  4ED1 A;  1MZB A;  4BXX G;  2R85 A;  3M9O B;  1S03 G;  5KG4 A;  2GPW A;  2C2E A;  1A9X A;  3HOV G;  5L9X A;  1EZ1 A;  2W8L A;  3RAX A;  1GSH A;  4JI5 H;  2VUM A;  2YW2 A;  5J2U F;  1E4F T;  2V5A A;  2W9A A;  4QJF A;  2C2R A;  2W6P A;  2I8C A;  1S0N A;  2IMW P;  2J6T A;  4Q8F A;  4ECU A;  4QWD A;  2OH2 A;  1Y1V G;  4EG0 A;  5KFM A;  3T5K A;  3MFH A;  4YP3 A;  2FK1 A;  4X65 H;  3RBD A;  4QWB A;  1TWC A;  5KFZ A;  5DQI A;  5HV6 A;  3N42 B;  5LL6 b;  4FS2 A;  2P0A A;  4YBZ B;  1IBK H;  4LFB H;  2NVY A;  1ZHS A;  4R8U A;  4APM A;  3KAJ A;  5LOV F;  3I4N G;  2R6F A;  4PDB A;  4HNV A;  2V58 A;  5C1O A;  1UNN C;  4EFE A;  5IP9 G;  3N41 B;  4RB1 A;  1HNZ H;  4KHP H;  5FLM G;  4YR2 A;  1M6V A;  2Q2T A;  1RJR A;  1KJQ A;  1KJI A;  2I87 A;  1KJ8 A;  4L1K A;  1GGO A;  3RJ0 A;  2HVS A;  2UUB H;  1ZHQ A;  1WCM A;  4RNO A;  4I55 F;  5LYJ F;  1HNW H;  4IRC A;  2R93 A;  1IOV A;  3BG5 A;  1E4E B;  4FS1 A;  1SYX B;  2PN1 A;  2R7N A;  2FK2 A;  2R8I A;  2HVR A;  1SCU B;  3OHB A;  4ECT A;  2VPQ A;  2ZDH A;  2FKL A;  4QWA A;  3GTG A;  1BXR A;  5L1K A;  3EYY A;  4LSX A;  1XNQ H;  2AGQ A;  4MV3 A;  5BPF A;  4M9U A;  3RBE A;  4ECQ A;  4UCS A;  4JI1 H;  4O2B F;  4A3D G;  3GTK A;  3PW4 A;  1S97 A;  1VS0 A;  4YQW A;  2BR0 A;  1I50 A;  2XC9 A;  2MCT A;  3HBL A;  5L1L A;  2AGO A;  2W9C B;  4EFB A;  4J0M A;  4XYL B;  4Q44 A;  4B3S H;  5KFW A;  3PW0 A;  4F4Z A;  2R92 G;  2W7O A;  4A3G G;  1JIH A;  3RB0 A;  4HNU A;  4R8U B;  2ZDG A;  4DL6 A;  4K0K H;  4HNT A;  4YR0 A;  3GII A;  2JEI A;  4Q8E A;  4J9N A;  2VQD A;  4A3F G;  5DGA A;  5JQW A;  1A0I A;  1WR2 A;  4XYM B;  4MA5 A;  2DWC A;  2XCA A;  3Q1K A;  2W6Q A;  4J9R A;  4DV0 H;  4ME6 A;  2NU8 B;  4O4L F;  4OX9 H;  1GLV A;  3LWB A;  2FPI B;  4HYK A;  1AN7 A;  3GTP A;  5KFP A;  2JA8 G;  3GID A;  1K1Q A;  2GPS A;  2HVQ A;  4UFZ A;  5KG1 A;  2UVW A;  2JEG A;  3GIP A;  4JV5 H;  2WE6 A;  1CS0 A;  2E2I A;  2J6U A;  2UXC H;  4JV2 A;  4J9O A;  1JKJ B;  1R9T A;  1V4Y A;  2E5L H;  3BAB A;  2X0S A;  2YZG A;  5BR8 H;  3PW5 A;  3UQ8 A;  4IR1 A;  1ZET A;  4ECY A;  3Q8P B;  4IAJ A;  3FKI G;  4O4H F;  5F9L A;  2DIK A;  2CW8 A;  3RFC A;  3GIJ A;  5C8Y F;  4DV6 H;  3J7A K;  1RJQ A;  4RZQ A;  4DL7 A;  4DR6 H;  3KHR A;  1VKZ A;  3VPD A;  4C2M A;  5JUM A;  3QZ8 A;  3CVZ A;  3K5I A;  3M9M B;  3JRX A;  2V4Q A;  1RK5 A;  3EPI A;  5FPO A;  2UVR A;  4LFA H;  2IBK A;  5C44 G;  4TV8 F;  3BQ0 A;  3PR5 B;  1I94 H;  4QW8 A;  1BNC A;  3WO1 A;  4AYB E;  1B6R A;  2R86 A;  3N43 B;  3N8D A;  4JV0 A;  4RU9 A;  2IA6 A;  4A3L G;  5I47 A;  4A3K G;  1E4G T;  3Q2O A;  2JA5 A;  3MR6 A;  1BGW A;  4DV5 H;  2B63 A;  5KFR A;  1V51 A;  3LP8 A;  1N34 H;  2BQ3 A;  3G8C A;  3NGD A;  1OWT A;  3MR3 A;  4MA0 A;  5KT7 A;  2W70 A;  1Y1W G;  5K2M A;  4FM9 A;  4FBT A;  2HJW A;  5IP7 G;  3M9N B;  4BY1 G;  3GTO A;  3FDS A;  3H20 A;  3AYH B;  3KAL A;  4I7H A;  4J9S A;  4DR7 H;  2YZM A;  2VUM G;  2UXB H;  1O75 A;  4UCV A;  2VUG A;  5JH7 F;  3L2P A;  5C5J A;  2PMZ E;  3RAQ A;  5FJ8 G;  2XGP A;  4RZR A;  3BA9 A;  4MV7 A;  4YY3 H;  1JX4 A;  2UUC H;  4J9M A;  4ECV A;  1WH2 A;  1KBL A;  5KFC A;  3BQ2 A;  3HOW G;  4A3B G;  2I80 A;  1UC9 A;  4MTD A;  5LMN H;  4A3C G;  4EBE A;  2FLL A;  5LP6 F;  3BQ1 A;  2WB1 A;  4WD3 A;  1S0M A;  3Q8S B;  4YJ2 F;  3FMA A;  3TIN A;  2V4R A;  2W9C A;  4AYB A;  4DR2 H;  4MV4 A;  5KFL A;  5KFQ A;  4A3I G;  4IR9 A;  4A2A A;  4A3M G;  4JI6 H;  4NXN H;  5KFJ A;  1FKA H;  4YB8 B;  2VQF H;  1CE8 A;  1L2Z A;  1TWA A;  2ALZ A;  5J2T F;  2GLT A;  4DUZ H;  1T94 A;  5C1P A;  3RIZ A;  3GIL A;  2R8K A;  3PW7 A;  1EYZ A;  3HXL A;  4UCR A;  1CQI B;  5LMU H;  4DR1 H;  2FE3 A;  4F4W A;  4JI2 H;  2YL2 A;  1DV1 A;  2XD4 A;  3HKZ E;  1HR0 H;  4O3R A;  3TIG A;  3GIM A;  4GLX A;  4JUZ A;  2FK3 A;  4Q45 A;  5HBR B;  1JDB B;  1GSA A;  1N56 A;  3GV7 B;  4RUA A;  4ETS A;  4MV8 A;  1XMQ H;  1EHI A;  5DQH A;  4C5B A;  3RGX A;  1AUV A;  3HOZ G;  2ZM6 H;  2ZJT A;  4LMY A;  2FLP A;  4DUY H;  2DPI A;  3RV4 A;  1KJ9 A;  4O3P A;  4GC7 A;  1TWF A;  4MV1 A;  4JI4 H;  3HOY G;  4LF7 H;  1Y1V A;  2QK4 A;  1ZQ7 A;  4PWQ A;  1JDE A;  4X62 H;  3RB4 A;  1X9N A;  1K83 A;  4UCU A;  2SCU B;  5KFE A;  2FB9 A;  2J9G A;  3OUU A;  2O03 A;  4WBN F;  5IYD G;  4DL3 A;  1C30 A;  4XX0 B;  1XNR H;  4O3N A;  2ASJ A;  4QWE A;  4GC6 A;  4QWC A;  5CAE B;  3N6X A;  2OLS A;  3PW2 A;  2FMA A;  4ED3 A;  4O4I F;  2R84 A;  5KG3 A;  3PN1 A;  5KFA A;  2VR1 A;  2C00 A;  3MWE A;  4ED0 A;  1S68 A;  2JA7 G;  5IYZ F;  3F8N A;  2XIG A;  5KFY A;  4RNN A;  1GSO A;  5DG8 A;  4DLK A;  2ASD A;  1VBG A;  3ORR A;  4B3M H;  1TWG A;  1EUD B;  4U7C A;  2V9W A;  2NVX A;  4J9Q A;  2CW7 A;  4MTE A;  1PX2 A;  2JA6 A;  4EYI B;  4ZOL F;  5H80 A;  2W7P A;  1S9F A;  4MV6 A;  5D1O A;  2QYZ A;  4I4T F;  5DLG A;  1XDN A;  3JZI A;  5KFN A;  2R8H A;  4A3E G;  2R7K A;  4UCO A;  2RDJ A;  1IBM H;  1FJG H;  2FPG B;  5EZY F;  4DV3 H;  4JYA H;  4JI3 H;  4EGJ A;  1N36 H;  1B04 A;  5KFH A;  5DQG A;  2UU9 H;  2RGV A;  3RTX A;  5KT5 A;  1K1S A;  3R23 A;  2C35 B;  2R93 G;  4EBC A;  4BBS G;  2NU7 B;  5IT9 W;  3J80 W;  4RAY A;  4GKJ H;  5KFX A;  4NXM H;  2XCL A;  5KFB A;  2WDT A;  4ZHQ F;  1ULZ A;  4B3T H;  1N32 H;  3K3V A;  4TQS A;  4J9L A;  1RYS A;  1W93 A;  3L4K A;  1Z2O X;  2DPJ A;  4ED6 A;  5FD6 A;  3H0G A;  3V6H A;  1M0T A;  1SFO A;  4ED2 A;  2NUA B;  2BQR A;  2WB1 E;  2CQY A;  4YR3 A;  1S0O A;  4NLG A;  5KG2 A;  3RB3 A;  2YS6 A;  3TQT A;  1B6S A;  2YS7 A;  5EDW A;  4JV1 A;  4LF6 H;  3V6K A;  2R7Z G;  4J9P A;  1GYF A;  3HKZ A;  3V4Z A;  4TV9 F;  2W9B B;  4YAK B;  1KEE A;  3OSP A;  3PZP A;  5EWF A;  4BY7 G;  4RUC A;  2WAQ A;  5FPR A;  3PR4 A;  5KFD A;  3HOX G;  2JA6 G;  1GO3 E;  3KHH A;  1Z2N X;  2DLN A;  3IN5 A;  5LA6 F;  4F4Y A;  4DL2 A;  5BMV F;  3N44 B;  3OSN A;  3MR5 A;  3H40 A;  4JI7 H;  3GTL A;  2R7Z A;  2YRW A;  1RJP A;  2W6N A;  4IRK A;  4EBD A;  2YZN A;  4LH7 A;  1BJT A;  4O2A F;  4E4T A;  1N48 A;  1RYR A;  4ECR A;  3KTM A;  3N40 P;  4RB3 C;  1P8L A;  3BJY A;  2W6M A;  2ATL A;  1VAJ A;  2AU0 A;  2BQU A;  4DL5 A;  4LF4 H;  4YAJ B;  2R87 A;  2RF4 A;  3GTM A;  3BAA A;  5KT4 A;  1T3N A;  2V59 A;  5KG5 A;  5EWG A;  2R7M A;  4CC5 A;  3L4J A;  2E2H A;  3R5X A;  2NU9 B;  3RF2 A;  5CA1 F;  4RB2 C;  2W8K A;  3E5N A;  1I7L A;  1XMO H;  1JXL A;  3JAM W;  1WSC A;  3T1H H;  4U6P A;  4J9K A;  3MR2 A;  4O3Q A;  1FVI A;  5KT3 A;  4JI0 H;  1SEI A;  2R92 A;  3GTQ A;  1IOW A;  2DZD A;  3ETH A;  5KFT A;  3SE7 A;  1E4E A;  1KC7 A;  3ORQ A;  4EEQ A;  1UC8 A;  3GV5 B;  4AQY H;  2B63 G;  3PVX A;  3H3V H;  3M4I A;  4C5A A;  4YHH H;  2KSW A;  5KFG A;  5KG6 A;  3T5J A;  3TII A;  3UFX B;  4YJ3 F;  4C5C A;  4EEY A;  1S10 A;  1RK6 A;  1W96 A;  1IBL H;  1VBH A;  4UCT A;  5JVL A;  2XCP A;  5F9N A;  5KFS A;  2HHH H;  4DR5 H;  4EYH B;  5FLX W;  4ED8 A;  2R7L A;  5D1O B;  3T5H A;  2FJZ A;  4BWS C;  4ZI7 F;  3KHG A;  3MWM A;  2AGP A;  1I6U A;  2R8J A;  4DR3 H;  5KKN B;  3OTO H;  2W71 A;  4XZ3 B;  4I50 F;  5EWE A;  1KJJ A;  2YCH A; 
#chains in the Genus database with same CATH homology
 2FK1 A;  2FMA A;  2FK2 A;  2M05 A;  3KTM A;  2FJZ A;  1OWT A;  4PWQ A;  2FKL A;  2FK3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...