2M05A

Structure of module 2 from the e1 domain of c. elegans apl-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
b'EACQFSHVNSRDQCNDYQHWKDEAGKQCKTKKSKGNKDMIVRSFAVLEPCALDMFTGVEFVCCPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-amyloid-like protein
publication title Quantification of copper binding to amyloid precursor protein domain 2 and its Caenorhabditis elegans ortholog. Implications for biological function.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Unknown function
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2012-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2m05A00
2FJZA 2M05A 1OWTA 2FK1A 3KTMA 2FMAA 2FK3A 2FK2A 4PWQA 2FKLA
chains in the Genus database with same CATH superfamily
4A3IG 4I7HA 4NXMH 2XGQA 3HOWG 4ZI7F 4Y8VB 1M0WA 4ED7A 4GC6A 4ECTA 1Y1WG 3HKZA 3KAKA 4MA5A 2BQRA 3K3PA 3WO1A 4ECZA 1E4EA 5KFAA 2RDIA 2V9WA 2NU7B 4DV5H 3KAJA 4WBNF 3GTQA 1HR0H 3CQZA 2YW2A 2Y0SA 2JEJA 2VA3A 2R8KA 1GLVA 2CW7A 5IP9G 2X0SA 5KKNB 5LMUH 3PZPA 5BMVF 2AGOA 1BXRA 4DR4H 4DR5H 5KFLA 2OLSA 2ASLA 1C3OA 4UCSA 3Q2OA 1ZETA 1VBGA 1WCMG 1MZBA 4LFAH 1C30A 2PMZE 4EBCA 5F9NA 3VPDA 3KALA 4JV1A 4B3RH 3WNZA 4JI0H 3LP8A 4R7RA 1KEEA 1SEIA 4FS2A 2FLLA 3HOXG 1N56A 2UVWA 3H20A 3PO3G 3RBEA 3T5JA 4GKJH 3MR3A 2IMWP 4MV9A 5KFBA 3Q8SB 3RB6A 1Y1WA 2C22A 3L4KA 3RAQA 4IRKA 4O4LF 3N43B 3H4DA 1V51A 4JI5H 1WSCA 3OHBA 3N6XA 3ETJA 4JV2A 2DPJA 2RF4A 4FU0A 4BWSC 5EDWA 3FKIA 5CA0F 4FBUA 2JEIA 4BY1G 5HV6A 3RGZA 3OTOH 2XCLA 4ED2A 3RB4A 1DIKA 3GIKA 4YJ3F 1IBMH 1DV1A 3V6HA 5KG3A 5F9LA 1J5EH 3HB9A 4RAYA 3G6XA 5FLXW 4JI2H 3R5XA 5KFNA 5KT3A 4RUCA 2W8LA 1Z2PX 2R92G 1RJRA 4IZOA 4R8UA 1UC8A 2J6SA 1WCMA 3VPBA 3T1HH 1KJIA 2AGQA 4A3KG 3RGXA 1IBLH 4X66H 5BPHA 4KHPH 2ZJTA 1TWCA 2VUGA 3J81W 2HHHH 4O2AF 3GV5B 3GV8B 2HVRA 3PR4A 4BBSG 4BBRG 3HOVG 2JA6G 1DV2A 2QYZA 4ZHQF 4ECSA 3VPCA 3MFIA 1K1QA 4XZ3B 5KT6A 4IR9A 4PDBA 4ECXA 2FE3A 3EPIA 4DR6H 5LYJF 2ATLA 2GPWA 1I50A 1S0MA 5C1OA 2UUAH 4ECUA 4YR3A 1K1SA 3MWDA 3Q8PB 1OWTA 4LH7A 3IN5A 3J7AK 5C5JA 2V58A 1S03G 4APMA 4IWXA 4C2MA 4XYLB 2YZGA 2RDJA 2W9AA 1TWAA 2XCAA 5LOVF 1UC9A 4RAZA 3JZIA 3UFXB 5KG7A 2Q2UA 2R92A 5IYDG 2I8CA 4IR1A 2CKZB 2R93G 2IA6A 2W9BB 5L1LA 4Q8FA 4A2AA 4DUYH 1TWFA 4J9LA 4I55F 4J9OA 4X65H 3MR6A 2WTFA 2F4VH 2YU9A 4HNTA 2R85A 4YR0A 5EWEA 5KFUA 3GIMA 1X9NA 2R7ZG 4QWEA 2IBKA 1WH2A 5KFJA 3BA9A 4X64H 3BQ1A 2E2IA 3MWEA 4JUZA 4A3MG 5KFPA 3KTMA 4LF6H 4GLXA 4DV3H 2C35B 4I50F 4MV7A 4HNVA 4TV9F 5KFCA 4ED3A 4DL6A 4JI4H 5KFOA 4FM9A 4ZQIA 2W6PA 1Y1VA 2W6QA 2W7PA 3HOZG 1M6VA 1B33N 5DLGA 2XC9A 3BG5A 5J2TF 5DG8A 4JYAH 4GKKH 2C2RA 3JAMW 1I94H 4ECRA 3VMMA 2VQEH 4K0KH 5IYBG 2R8HA 2FLNA 4DLKA 5LXTF 2W6OA 4UCTA 4JI3H 2R93A 4DR2H 4DR1H 4QIWE 3GTMA 1Z2OX 4YR2A 3RUPA 1GSOA 3HXLA 2VUMG 1EUCB 1JLLB 4F4YA 3JSNA 4A3LG 1EUDB 2NU6B 5DQGA 1A0IA 4RNNA 5EWFA 3M4IA 2UU9H 2R7ZA 1O75A 5D1OB 1KJJA 4AYBE 4LSAA 2M05A 2J9GA 3HOUG 5JVLA 1JDEA 4B3MH 3NGDA 1FJGH 2KSWA 4F50A 1EYZA 1I6UA 4EFBA 1E4FT 4J9RA 3ORQA 2FP4B 1B04A 2R87A 4PWQA 3QZ8A 2R8GA 1ZHSA 2WDTA 1BNCA 2DIKA 4MV8A 5CAEB 5KFSA 4ED8A 3GTJA 4NLGA 4Q8EA 4J9MA 2ZM6H 1V9PA 4IHJF 2JEGA 1IOWA 3LMLA 2WAQA 3EPGA 4J9SA 4MV1A 4AQYH 2FPIB 2R86A 3BAAA 2IP4A 3JRWA 3MWMA 3GTPA 2P0AA 2R8JA 2WE6A 4HYKA 2VUMA 4F4ZA 1N36H 5DLFA 4C5CA 5FJ8G 5CA1F 1K83A 4E4TA 5L1KA 5KFDA 1N32H 3OSPA 3V4SA 2C2EA 4G3IA 5DG7A 4DR7H 3RJ0A 1GSAA 4LH6A 5DQIA 2DZDA 1GGOA 3TIIA 1HNXH 1ZQ7A 1WR2A 4Q43A 4JV0A 1KC7A 5KG4A 5EWGA 4YQWA 2FPGB 1JDBB 2V4RA 5KG5A 3RB3A 3KHGA 3AYHB 4I4TF 2W9CB 3WO0A 4B3TH 2O03A 5C1PA 4UFZA 2Q2TA 4WD3A 4TQRA 4RUAA 3Q1KA 5I47A 2FK1A 4DL2A 1SCUB 2R82A 5T14A 4LSXA 1I7LA 4M7EA 5HBRB 2YCHA 5DGBA 2FB9A 4EBEA 2DPIA 4XX0B 4J9PA 2BQ3A 3MFHA 5KG6A 3G6VA 4MV4A 5KFQA 1N34H 1BJTA 2XD4A 3N42B 2QK4A 2YL2A 3H0GG 4EGJA 1JKJB 3QFFA 2PVPA 4J0MA 4QWDA 4JV5H 3RTXA 1HNZH 2W9BA 5KFYA 1P8LA 4U6PA 1A9XA 4EYIB 3EYYA 3RV3A 4QWBA 3GTOA 4RB3C 5JVDF 3H4BA 4QW8A 3ETHA 2SCUB 4J9NA 4EEYA 5FD5A 1Y14B 3R5HA 5JQWA 2CW8A 5EZYF 4DV0H 5IWAH 1RJPA 1XMOH 5CB4F 4AYBA 1L2ZA 3RFCA 2YZMA 4UCVA 3I4MG 1IOVA 2WB1E 3BJYA 3GTKA 2FJZA 5FD6A 3BQ0A 2GPSA 3J80W 1TWHA 4LMYA 4QWAA 3GTGA 2UXDH 4A3GG 5FPOA 1S10A 3T1YH 1JX4A 1FVIA 3FMAA 1S97A 2NUAB 1XNQH 3BABA 4GC7A 4C5AA 3V6JA 1S0NA 1TWGA 3UQ8A 3KHHA 5KFWA 3I4NG 3PW0A 4YHHH 5KFVA 5KG0A 5C8YF 1GO3E 1W96A 2W6MA 5IT9W 3KHLA 5L1JA 1RJQA 3GILA 4RU9A 2JA6A 4EBDA 4EEQA 1XDNA 1BGWA 1KJQA 4NXNH 4O3QA 2R7NA 4L1KA 3V4ZA 2JEFA 2PMZA 4LF5H 4TQSA 1S0OA 1PX2A 5KFFA 3KXYT 1GYFA 3N44B 1RYRA 3RAXA 2J6TA 5KFKA 4A2BA 2HVQA 3OSNA 4J9QA 4IRCA 4MTDA 2HGSA 2YYAA 3JSLA 3CVZA 1RYSA 4O3SA 3GLKA 4A3DG 5KFEA 2FK2A 1B6RA 3N40P 5D1OA 3MR5A 4DV6H 1V4YA 4XYMB 4UCRA 4Q44A 3N41B 1N48A 4ZOLF 2WYOA 4O4IF 5L9XA 3RB0A 2FK3A 3C0FB 5DGAA 3OUZA 2BQUA 4M9UA 3HOYG 2VA2A 2VOBA 5FLMG 4X62H 4OX9H 4CC5A 4EFEA 3GTLA 4MA0A 3RIZA 3H40A 4O4HF 3Q8RB 3H3VH 4YB8B 3G8CA 4DV4H 4YP3A 4EGQA 5KT5A 3L4JA 3GIIA 5KFGA 2FPPB 2VPSA 5FPRA 4MV3A 1EHIA 4A3FG 5C4XG 2VQFH 2CZGA 3GQCA 1UNNC 3GIDA 4UCOA 2JA5G 1CE8A 2RGVA 3E5NA 5GONF 2RGRA 2YS7A 4ECWA 3PW7A 4ED0A 3T5HA 2OWOA 4O3OA 3K5IA 3IG0A 2J6UA 3R23A 5KFXA 1W93A 4HNUA 4MAMA 4UCUA 2UVUA 3MJFA 4YJ2F 2MCTA 1TA8A 3M9OB 4LFBH 4F4WA 5C44G 5C3EG 1E4GT 1KJ9A 3QZ7A 4HR7A 4YAKB 2JA7G 2WB1A 1JIHA 4ETSA 2C28A 4A3JG 5KX5F 2R6FA 2OH2A 4RNOA 2W9CA 4DV2H 4MV6A 5LA6F 2V4QA 3KHRA 1AUXA 3SE7A 5KFZA 2W71A 3FKIG 4O3NA 2NVYA 2V5AA 3JRXA 3LWBA 5D1PA 2ZDGA 4JI8H 1CS0A 1JXLA 4A3BG 2JA8G 3K5HA 5KG2A 2UUBH 2JA5A 1DGSA 3PR5B 2UUCH 1T94A 2YS6A 4LF9H 4LFCH 1SYXB 2B63G 4BXXG 4O2BF 5L1IA 1ULZA 4YY3H 3PO2G 4FS1A 4FBTA 1RK6A 4DL4A 1S68A 1T36A 2GLTA 5KG1A 4YAJB 1M7JA 1E4EB 2R8IA 1XMQH 5IYCG 4Q0YA 5LL6b 1T3NA 5KT7A 4LF4H 4RZRA 4DV7H 2C2DA 5BPFA 1VS0A 4JI1H 5KFIA 3RV4A 5J2UF 2UVVA 5KFMA 4CC6A 2R7KA 3T5LA 1IBKH 2UXCH 2I80A 1ZHQA 2AQ4A 2UVRA 2R7MA 2NU8B 4ED1A 1S9FA 1AN7A 4DUZH 3OUUA 2FKLA 1XNRH 1FKAH 4F4XA 4C5BA 4ED6A 1EZ1A 2ASJA 4QIWA 4HQ6A 3T5KA 2VR1A 5KFHA 5K2MA 4DL3A 3R5FA 3V6KA 2W57A 4IRDA 4MTEA 5IP7G 2B63A 2XGPA 5A2QW 1VAJA 4RB0A 4A3EG 1N33H 2UXBH 1Z2NX 1VBHA 2YRXA 3HKZE 3N8DA 4ECVA 1I3QA 2ALZA 2ASDA 2W6ZA 2AU0A 4JI7H 1TAEA 1GSHA 1PK8A 4O3RA 4RB2C 4ECQA 4B3SH 3OHAA 1CQIB 3M9NB 2AGPA 2R7LA 3U9TA 3GIPA 2FLPA 4J9KA 2Y0SE 1B6SA 1VKZA 5LMNH 3ORRA 5DG9A 4ME6A 4RB1A 3GIJA 4DL5A 1I7NA 4RNMA 4TUYF 4YBZB 2DWCA 2PN1A 4R8UB 5KFRA 2WAQE 4LF7H 3H0GA 1HNWH 1Y1VG 4U7CA 1R9TA 3GIQA 4IWYA 3TINA 4EG0A 4IAJA 3I12A 4QJFA 5EOYA 3BA8A 3TQ1A 3HBLA 5KFTA 2ZDQA 2BR0A 5D8DA 1AUVA 4DV1H 3RBDA 3PW5A 5BR8H 4BY7G 2W6NA 3G6YA 2ZDHA 2JA7A 3PVXA 1RK5A 2NU9B 1KJ8A 3TQTA 2PBZA 2XCPA 2VPQA 3DF7A 1SFOA 2HVSA 5JUMA 4ECYA 3MR2A 1M0TA 3Q8QB 2HJWA 4EYHB 4Q45A 2CQYA 4QW9A 5KT4A 5JH7F 3M9MB 3PW2A 4DL7A 2DLNA 5LP6F 3BQ2A 2FMAA 2V59A 3GV7B 3RF2A 3SI8A 2I87A 3TIGA 5H80A 5KT2A 2YRWA 2W8KA 2E2HA 2NVXA 3K3VA 5IYZF 5DQHA 4DR3H 4A93G 4LF8H 2E5LH 3F8NA 4RZQA 3L2PA 3PN1A 3FDSA 1CQJB 4TV8F 2XIGA 4O3PA 4QWCA 3PW4A 4A3CG 2YZNA 4JI6H 1KBLA 2VQDA 3U9SA 2W7OA 2C00A 2R84A 2W70A
chains in the Genus database with same CATH topology
2FJZA 2M05A 1OWTA 2FK1A 3KTMA 2FMAA 2FK3A 2FK2A 4PWQA 2FKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJZ A;  2M05 A;  1OWT A;  2FK1 A;  3KTM A;  2FMA A;  2FK3 A;  2FK2 A;  4PWQ A;  2FKL A; 
#chains in the Genus database with same CATH topology
 4A3I G;  4I7H A;  4NXM H;  2XGQ A;  3HOW G;  4ZI7 F;  4Y8V B;  1M0W A;  4ED7 A;  4GC6 A;  4ECT A;  1Y1W G;  3HKZ A;  3KAK A;  4MA5 A;  2BQR A;  3K3P A;  3WO1 A;  4ECZ A;  1E4E A;  5KFA A;  2RDI A;  2V9W A;  2NU7 B;  4DV5 H;  3KAJ A;  4WBN F;  3GTQ A;  1HR0 H;  3CQZ A;  2YW2 A;  2Y0S A;  2JEJ A;  2VA3 A;  2R8K A;  1GLV A;  2CW7 A;  5IP9 G;  2X0S A;  5KKN B;  5LMU H;  3PZP A;  5BMV F;  2AGO A;  1BXR A;  4DR4 H;  4DR5 H;  5KFL A;  2OLS A;  2ASL A;  1C3O A;  4UCS A;  3Q2O A;  1ZET A;  1VBG A;  1WCM G;  1MZB A;  4LFA H;  1C30 A;  2PMZ E;  4EBC A;  5F9N A;  3VPD A;  3KAL A;  4JV1 A;  4B3R H;  3WNZ A;  4JI0 H;  3LP8 A;  4R7R A;  1KEE A;  1SEI A;  4FS2 A;  2FLL A;  3HOX G;  1N56 A;  2UVW A;  3H20 A;  3PO3 G;  3RBE A;  3T5J A;  4GKJ H;  3MR3 A;  2IMW P;  4MV9 A;  5KFB A;  3Q8S B;  3RB6 A;  1Y1W A;  2C22 A;  3L4K A;  3RAQ A;  4IRK A;  4O4L F;  3N43 B;  3H4D A;  1V51 A;  4JI5 H;  1WSC A;  3OHB A;  3N6X A;  3ETJ A;  4JV2 A;  2DPJ A;  2RF4 A;  4FU0 A;  4BWS C;  5EDW A;  3FKI A;  5CA0 F;  4FBU A;  2JEI A;  4BY1 G;  5HV6 A;  3RGZ A;  3OTO H;  2XCL A;  4ED2 A;  3RB4 A;  1DIK A;  3GIK A;  4YJ3 F;  1IBM H;  1DV1 A;  3V6H A;  5KG3 A;  5F9L A;  1J5E H;  3HB9 A;  4RAY A;  3G6X A;  5FLX W;  4JI2 H;  3R5X A;  5KFN A;  5KT3 A;  4RUC A;  2W8L A;  1Z2P X;  2R92 G;  1RJR A;  4IZO A;  4R8U A;  1UC8 A;  2J6S A;  1WCM A;  3VPB A;  3T1H H;  1KJI A;  2AGQ A;  4A3K G;  3RGX A;  1IBL H;  4X66 H;  5BPH A;  4KHP H;  2ZJT A;  1TWC A;  2VUG A;  3J81 W;  2HHH H;  4O2A F;  3GV5 B;  3GV8 B;  2HVR A;  3PR4 A;  4BBS G;  4BBR G;  3HOV G;  2JA6 G;  1DV2 A;  2QYZ A;  4ZHQ F;  4ECS A;  3VPC A;  3MFI A;  1K1Q A;  4XZ3 B;  5KT6 A;  4IR9 A;  4PDB A;  4ECX A;  2FE3 A;  3EPI A;  4DR6 H;  5LYJ F;  2ATL A;  2GPW A;  1I50 A;  1S0M A;  5C1O A;  2UUA H;  4ECU A;  4YR3 A;  1K1S A;  3MWD A;  3Q8P B;  1OWT A;  4LH7 A;  3IN5 A;  3J7A K;  5C5J A;  2V58 A;  1S03 G;  4APM A;  4IWX A;  4C2M A;  4XYL B;  2YZG A;  2RDJ A;  2W9A A;  1TWA A;  2XCA A;  5LOV F;  1UC9 A;  4RAZ A;  3JZI A;  3UFX B;  5KG7 A;  2Q2U A;  2R92 A;  5IYD G;  2I8C A;  4IR1 A;  2CKZ B;  2R93 G;  2IA6 A;  2W9B B;  5L1L A;  4Q8F A;  4A2A A;  4DUY H;  1TWF A;  4J9L A;  4I55 F;  4J9O A;  4X65 H;  3MR6 A;  2WTF A;  2F4V H;  2YU9 A;  4HNT A;  2R85 A;  4YR0 A;  5EWE A;  5KFU A;  3GIM A;  1X9N A;  2R7Z G;  4QWE A;  2IBK A;  1WH2 A;  5KFJ A;  3BA9 A;  4X64 H;  3BQ1 A;  2E2I A;  3MWE A;  4JUZ A;  4A3M G;  5KFP A;  3KTM A;  4LF6 H;  4GLX A;  4DV3 H;  2C35 B;  4I50 F;  4MV7 A;  4HNV A;  4TV9 F;  5KFC A;  4ED3 A;  4DL6 A;  4JI4 H;  5KFO A;  4FM9 A;  4ZQI A;  2W6P A;  1Y1V A;  2W6Q A;  2W7P A;  3HOZ G;  1M6V A;  1B33 N;  5DLG A;  2XC9 A;  3BG5 A;  5J2T F;  5DG8 A;  4JYA H;  4GKK H;  2C2R A;  3JAM W;  1I94 H;  4ECR A;  3VMM A;  2VQE H;  4K0K H;  5IYB G;  2R8H A;  2FLN A;  4DLK A;  5LXT F;  2W6O A;  4UCT A;  4JI3 H;  2R93 A;  4DR2 H;  4DR1 H;  4QIW E;  3GTM A;  1Z2O X;  4YR2 A;  3RUP A;  1GSO A;  3HXL A;  2VUM G;  1EUC B;  1JLL B;  4F4Y A;  3JSN A;  4A3L G;  1EUD B;  2NU6 B;  5DQG A;  1A0I A;  4RNN A;  5EWF A;  3M4I A;  2UU9 H;  2R7Z A;  1O75 A;  5D1O B;  1KJJ A;  4AYB E;  4LSA A;  2M05 A;  2J9G A;  3HOU G;  5JVL A;  1JDE A;  4B3M H;  3NGD A;  1FJG H;  2KSW A;  4F50 A;  1EYZ A;  1I6U A;  4EFB A;  1E4F T;  4J9R A;  3ORQ A;  2FP4 B;  1B04 A;  2R87 A;  4PWQ A;  3QZ8 A;  2R8G A;  1ZHS A;  2WDT A;  1BNC A;  2DIK A;  4MV8 A;  5CAE B;  5KFS A;  4ED8 A;  3GTJ A;  4NLG A;  4Q8E A;  4J9M A;  2ZM6 H;  1V9P A;  4IHJ F;  2JEG A;  1IOW A;  3LML A;  2WAQ A;  3EPG A;  4J9S A;  4MV1 A;  4AQY H;  2FPI B;  2R86 A;  3BAA A;  2IP4 A;  3JRW A;  3MWM A;  3GTP A;  2P0A A;  2R8J A;  2WE6 A;  4HYK A;  2VUM A;  4F4Z A;  1N36 H;  5DLF A;  4C5C A;  5FJ8 G;  5CA1 F;  1K83 A;  4E4T A;  5L1K A;  5KFD A;  1N32 H;  3OSP A;  3V4S A;  2C2E A;  4G3I A;  5DG7 A;  4DR7 H;  3RJ0 A;  1GSA A;  4LH6 A;  5DQI A;  2DZD A;  1GGO A;  3TII A;  1HNX H;  1ZQ7 A;  1WR2 A;  4Q43 A;  4JV0 A;  1KC7 A;  5KG4 A;  5EWG A;  4YQW A;  2FPG B;  1JDB B;  2V4R A;  5KG5 A;  3RB3 A;  3KHG A;  3AYH B;  4I4T F;  2W9C B;  3WO0 A;  4B3T H;  2O03 A;  5C1P A;  4UFZ A;  2Q2T A;  4WD3 A;  4TQR A;  4RUA A;  3Q1K A;  5I47 A;  2FK1 A;  4DL2 A;  1SCU B;  2R82 A;  5T14 A;  4LSX A;  1I7L A;  4M7E A;  5HBR B;  2YCH A;  5DGB A;  2FB9 A;  4EBE A;  2DPI A;  4XX0 B;  4J9P A;  2BQ3 A;  3MFH A;  5KG6 A;  3G6V A;  4MV4 A;  5KFQ A;  1N34 H;  1BJT A;  2XD4 A;  3N42 B;  2QK4 A;  2YL2 A;  3H0G G;  4EGJ A;  1JKJ B;  3QFF A;  2PVP A;  4J0M A;  4QWD A;  4JV5 H;  3RTX A;  1HNZ H;  2W9B A;  5KFY A;  1P8L A;  4U6P A;  1A9X A;  4EYI B;  3EYY A;  3RV3 A;  4QWB A;  3GTO A;  4RB3 C;  5JVD F;  3H4B A;  4QW8 A;  3ETH A;  2SCU B;  4J9N A;  4EEY A;  5FD5 A;  1Y14 B;  3R5H A;  5JQW A;  2CW8 A;  5EZY F;  4DV0 H;  5IWA H;  1RJP A;  1XMO H;  5CB4 F;  4AYB A;  1L2Z A;  3RFC A;  2YZM A;  4UCV A;  3I4M G;  1IOV A;  2WB1 E;  3BJY A;  3GTK A;  2FJZ A;  5FD6 A;  3BQ0 A;  2GPS A;  3J80 W;  1TWH A;  4LMY A;  4QWA A;  3GTG A;  2UXD H;  4A3G G;  5FPO A;  1S10 A;  3T1Y H;  1JX4 A;  1FVI A;  3FMA A;  1S97 A;  2NUA B;  1XNQ H;  3BAB A;  4GC7 A;  4C5A A;  3V6J A;  1S0N A;  1TWG A;  3UQ8 A;  3KHH A;  5KFW A;  3I4N G;  3PW0 A;  4YHH H;  5KFV A;  5KG0 A;  5C8Y F;  1GO3 E;  1W96 A;  2W6M A;  5IT9 W;  3KHL A;  5L1J A;  1RJQ A;  3GIL A;  4RU9 A;  2JA6 A;  4EBD A;  4EEQ A;  1XDN A;  1BGW A;  1KJQ A;  4NXN H;  4O3Q A;  2R7N A;  4L1K A;  3V4Z A;  2JEF A;  2PMZ A;  4LF5 H;  4TQS A;  1S0O A;  1PX2 A;  5KFF A;  3KXY T;  1GYF A;  3N44 B;  1RYR A;  3RAX A;  2J6T A;  5KFK A;  4A2B A;  2HVQ A;  3OSN A;  4J9Q A;  4IRC A;  4MTD A;  2HGS A;  2YYA A;  3JSL A;  3CVZ A;  1RYS A;  4O3S A;  3GLK A;  4A3D G;  5KFE A;  2FK2 A;  1B6R A;  3N40 P;  5D1O A;  3MR5 A;  4DV6 H;  1V4Y A;  4XYM B;  4UCR A;  4Q44 A;  3N41 B;  1N48 A;  4ZOL F;  2WYO A;  4O4I F;  5L9X A;  3RB0 A;  2FK3 A;  3C0F B;  5DGA A;  3OUZ A;  2BQU A;  4M9U A;  3HOY G;  2VA2 A;  2VOB A;  5FLM G;  4X62 H;  4OX9 H;  4CC5 A;  4EFE A;  3GTL A;  4MA0 A;  3RIZ A;  3H40 A;  4O4H F;  3Q8R B;  3H3V H;  4YB8 B;  3G8C A;  4DV4 H;  4YP3 A;  4EGQ A;  5KT5 A;  3L4J A;  3GII A;  5KFG A;  2FPP B;  2VPS A;  5FPR A;  4MV3 A;  1EHI A;  4A3F G;  5C4X G;  2VQF H;  2CZG A;  3GQC A;  1UNN C;  3GID A;  4UCO A;  2JA5 G;  1CE8 A;  2RGV A;  3E5N A;  5GON F;  2RGR A;  2YS7 A;  4ECW A;  3PW7 A;  4ED0 A;  3T5H A;  2OWO A;  4O3O A;  3K5I A;  3IG0 A;  2J6U A;  3R23 A;  5KFX A;  1W93 A;  4HNU A;  4MAM A;  4UCU A;  2UVU A;  3MJF A;  4YJ2 F;  2MCT A;  1TA8 A;  3M9O B;  4LFB H;  4F4W A;  5C44 G;  5C3E G;  1E4G T;  1KJ9 A;  3QZ7 A;  4HR7 A;  4YAK B;  2JA7 G;  2WB1 A;  1JIH A;  4ETS A;  2C28 A;  4A3J G;  5KX5 F;  2R6F A;  2OH2 A;  4RNO A;  2W9C A;  4DV2 H;  4MV6 A;  5LA6 F;  2V4Q A;  3KHR A;  1AUX A;  3SE7 A;  5KFZ A;  2W71 A;  3FKI G;  4O3N A;  2NVY A;  2V5A A;  3JRX A;  3LWB A;  5D1P A;  2ZDG A;  4JI8 H;  1CS0 A;  1JXL A;  4A3B G;  2JA8 G;  3K5H A;  5KG2 A;  2UUB H;  2JA5 A;  1DGS A;  3PR5 B;  2UUC H;  1T94 A;  2YS6 A;  4LF9 H;  4LFC H;  1SYX B;  2B63 G;  4BXX G;  4O2B F;  5L1I A;  1ULZ A;  4YY3 H;  3PO2 G;  4FS1 A;  4FBT A;  1RK6 A;  4DL4 A;  1S68 A;  1T36 A;  2GLT A;  5KG1 A;  4YAJ B;  1M7J A;  1E4E B;  2R8I A;  1XMQ H;  5IYC G;  4Q0Y A;  5LL6 b;  1T3N A;  5KT7 A;  4LF4 H;  4RZR A;  4DV7 H;  2C2D A;  5BPF A;  1VS0 A;  4JI1 H;  5KFI A;  3RV4 A;  5J2U F;  2UVV A;  5KFM A;  4CC6 A;  2R7K A;  3T5L A;  1IBK H;  2UXC H;  2I80 A;  1ZHQ A;  2AQ4 A;  2UVR A;  2R7M A;  2NU8 B;  4ED1 A;  1S9F A;  1AN7 A;  4DUZ H;  3OUU A;  2FKL A;  1XNR H;  1FKA H;  4F4X A;  4C5B A;  4ED6 A;  1EZ1 A;  2ASJ A;  4QIW A;  4HQ6 A;  3T5K A;  2VR1 A;  5KFH A;  5K2M A;  4DL3 A;  3R5F A;  3V6K A;  2W57 A;  4IRD A;  4MTE A;  5IP7 G;  2B63 A;  2XGP A;  5A2Q W;  1VAJ A;  4RB0 A;  4A3E G;  1N33 H;  2UXB H;  1Z2N X;  1VBH A;  2YRX A;  3HKZ E;  3N8D A;  4ECV A;  1I3Q A;  2ALZ A;  2ASD A;  2W6Z A;  2AU0 A;  4JI7 H;  1TAE A;  1GSH A;  1PK8 A;  4O3R A;  4RB2 C;  4ECQ A;  4B3S H;  3OHA A;  1CQI B;  3M9N B;  2AGP A;  2R7L A;  3U9T A;  3GIP A;  2FLP A;  4J9K A;  2Y0S E;  1B6S A;  1VKZ A;  5LMN H;  3ORR A;  5DG9 A;  4ME6 A;  4RB1 A;  3GIJ A;  4DL5 A;  1I7N A;  4RNM A;  4TUY F;  4YBZ B;  2DWC A;  2PN1 A;  4R8U B;  5KFR A;  2WAQ E;  4LF7 H;  3H0G A;  1HNW H;  1Y1V G;  4U7C A;  1R9T A;  3GIQ A;  4IWY A;  3TIN A;  4EG0 A;  4IAJ A;  3I12 A;  4QJF A;  5EOY A;  3BA8 A;  3TQ1 A;  3HBL A;  5KFT A;  2ZDQ A;  2BR0 A;  5D8D A;  1AUV A;  4DV1 H;  3RBD A;  3PW5 A;  5BR8 H;  4BY7 G;  2W6N A;  3G6Y A;  2ZDH A;  2JA7 A;  3PVX A;  1RK5 A;  2NU9 B;  1KJ8 A;  3TQT A;  2PBZ A;  2XCP A;  2VPQ A;  3DF7 A;  1SFO A;  2HVS A;  5JUM A;  4ECY A;  3MR2 A;  1M0T A;  3Q8Q B;  2HJW A;  4EYH B;  4Q45 A;  2CQY A;  4QW9 A;  5KT4 A;  5JH7 F;  3M9M B;  3PW2 A;  4DL7 A;  2DLN A;  5LP6 F;  3BQ2 A;  2FMA A;  2V59 A;  3GV7 B;  3RF2 A;  3SI8 A;  2I87 A;  3TIG A;  5H80 A;  5KT2 A;  2YRW A;  2W8K A;  2E2H A;  2NVX A;  3K3V A;  5IYZ F;  5DQH A;  4DR3 H;  4A93 G;  4LF8 H;  2E5L H;  3F8N A;  4RZQ A;  3L2P A;  3PN1 A;  3FDS A;  1CQJ B;  4TV8 F;  2XIG A;  4O3P A;  4QWC A;  3PW4 A;  4A3C G;  2YZN A;  4JI6 H;  1KBL A;  2VQD A;  3U9S A;  2W7O A;  2C00 A;  2R84 A;  2W70 A; 
#chains in the Genus database with same CATH homology
 2FJZ A;  2M05 A;  1OWT A;  2FK1 A;  3KTM A;  2FMA A;  2FK3 A;  2FK2 A;  4PWQ A;  2FKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...