2M05A

Structure of module 2 from the e1 domain of c. elegans apl-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
EACQFSHVNSRDQCNDYQHWKDEAGKQCKTKKSKGNKDMIVRSFAVLEPCALDMFTGVEFVCCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-amyloid-like protein
publication title Quantification of copper binding to amyloid precursor protein domain 2 and its Caenorhabditis elegans ortholog. Implications for biological function.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Unknown function
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2012-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2m05A00
1OWTA 2FK3A 3KTMA 2M05A 2FJZA 2FKLA 2FK1A 2FMAA 2FK2A 4PWQA
chains in the Genus database with same CATH superfamily
5LL6b 4MV8A 2ASLA 3J7AK 4ECWA 4DR7H 2ASDA 3OSPA 4B3MH 3MR2A 5BMVF 2Y0SA 3PVXA 5LMNH 2RGRA 2WTFA 4YAKB 2W9BB 2V59A 3UFXB 1BGWA 1IBKH 4YBZB 2UVWA 4Q8FA 3GTPA 5KFZA 2KSWA 2HVQA 5T14A 2FLLA 4MAMA 5BPFA 3HOZG 2ATLA 1S03G 3E5NA 4UCVA 4IAJA 1S0NA 2IBKA 3Q1KA 1Z2PX 4YR0A 3BQ1A 2NVXA 5KFBA 4DR1H 2Q2TA 2R82A 3EYYA 3FMAA 4MV6A 1HNXH 2ZDGA 3OUUA 5LOVF 4DR3H 3KTMA 4DUZH 4DV2H 4QJFA 4HQ6A 5F9LA 4ZOLF 4LFBH 2QYZA 3MWMA 3R23A 4O4IF 4FM9A 3GIDA 3H40A 5KFLA 4ECRA 2CZGA 4J9LA 3GTGA 1S0OA 4B3SH 4B3RH 1TWAA 5DQIA 4X66H 2R93G 5HV6A 2YU9A 5KX5F 4TQSA 2B63A 5JH7F 5KFQA 2J6SA 1BNCA 5F9NA 4JV1A 4A3LG 1IOVA 2W71A 2RDIA 4QIWE 2VPSA 2YRWA 5FD6A 4JI4H 3SE7A 5GONF 4R8UA 5DLGA 2JA5A 5EWFA 5IYDG 2XD4A 3TIGA 3MFHA 4FS1A 3V6KA 4EGQA 2VUMA 3TQ1A 4DL5A 4RB2C 1X9NA 2FB9A 2NUAB 1UC8A 5KT7A 3I4NG 3RB6A 1GLVA 1AUXA 4J9NA 4BBRG 5JVLA 2UVUA 3M4IA 5BR8H 3RFCA 3KHLA 4G3IA 2O03A 5KFYA 5KFVA 2AGOA 3T5HA 4DL4A 2RGVA 2W8LA 5FJ8G 5FPRA 1I50A 2PN1A 4I7HA 4EG0A 1T3NA 3HKZE 4MV7A 3H0GG 3G6XA 2OH2A 2UUBH 2BR0A 3GTQA 3WO0A 3U9SA 4C5BA 3TINA 2JA6G 1FKAH 2VA2A 1ULZA 4UCSA 2P0AA 4WD3A 4A2BA 3HOYG 3GV8B 4YR2A 2OLSA 4J9OA 2UVRA 1XMQH 3HXLA 3N44B 3BABA 3R5FA 1AUVA 1B6SA 3RF2A 5KFFA 4JI5H 4GKKH 5KG0A 4LF6H 2C22A 3N40P 2UXCH 2FPGB 1EZ1A 3N8DA 2W9AA 2R8GA 2IP4A 2R92G 2FK1A 5KFWA 1ZQ7A 1N48A 1EYZA 2YZNA 1EHIA 5C1OA 4RUAA 5L1IA 2XCLA 3OHAA 1Y1VA 2E2HA 2R87A 1CQIB 4M9UA 1RK5A 5D8DA 1I7NA 4DV5H 3FKIA 1W96A 5CA1F 2XGQA 1BXRA 4LF9H 2RF4A 4UCRA 4Y8VB 4A3MG 4UCOA 1RJQA 1TWFA 3GTJA 3R5HA 2R84A 4QWBA 3LWBA 3L2PA 4BBSG 4R8UB 3VPBA 1GSOA 4Q45A 1N34H 2ZJTA 4MV1A 3BQ2A 5EZYF 2W7PA 1O75A 2CKZB 3GIMA 4IHJF 3K5HA 3RGZA 1KJ9A 2YS7A 2M05A 3EPGA 2JEGA 1UC9A 5IYBG 4ECZA 2I80A 3CQZA 3HOUG 5IWAH 1M6VA 5IT9W 3FDSA 4O3PA 2UXBH 2AGQA 1KJQA 2W9CB 1E4EB 4JI2H 4DV3H 4EGJA 2R8JA 4K0KH 1GYFA 2UVVA 1WCMA 2NU6B 3RV3A 5IYCG 2JA7A 3V4ZA 1N56A 1DV2A 1GO3E 2W6QA 2YZGA 1V9PA 4ED3A 3U9TA 5LP6F 4F50A 4ECYA 4J9KA 1Y1WA 1DV1A 4LF7H 1XNRH 3JRWA 3DF7A 2V4RA 2VOBA 4ECTA 2R7ZA 3HOXG 4X64H 4LH7A 3PR5B 2V9WA 3H4DA 5KFIA 3K5IA 5EDWA 5DG8A 5DGAA 4ETSA 3KXYT 2QK4A 4J9RA 1FJGH 1XDNA 3RAXA 3GIPA 3AYHB 4Q0YA 3L4KA 2DZDA 3RBEA 1M0TA 2JEJA 2JA7G 1J5EH 1HNZH 4FU0A 4XZ3B 5FPOA 3JAMW 4O3RA 1VBHA 2J6TA 2PMZE 5C8YF 4YY3H 4MV4A 4ZI7F 4A3EG 2R8KA 1RJPA 1ZHSA 2WE6A 1W93A 3HOWG 4O3QA 1VBGA 2VA3A 3I4MG 2HJWA 2BQ3A 4CC6A 1BJTA 4HNUA 1T36A 5L1LA 4QW8A 4JV0A 4IWYA 2FPIB 3RAQA 2W8KA 4J9QA 3K3PA 3J81W 2V5AA 2VQDA 3EPIA 3V4SA 4J9SA 5FLMG 3TIIA 1IBLH 4DV1H 1TWCA 3MFIA 2XCPA 4B3TH 4YHHH 4A3BG 3ETHA 5J2TF 1Z2NX 4AYBE 2XGPA 4A3IG 2PBZA 4HNVA 1C30A 2FK2A 2C2EA 2R6FA 3MR5A 3JSLA 2FLNA 4O2BF 4UCUA 2W6MA 1K83A 4IRKA 4A3DG 2HVRA 3RBDA 1WR2A 2W6PA 5KFJA 5C44G 3RUPA 4ZQIA 5L1KA 4QIWA 5BPHA 1I3QA 3V6HA 2E5LH 4JI8H 5KFHA 3RGXA 3ETJA 2OWOA 3WNZA 4I55F 4ECVA 4XYMB 2RDJA 3BG5A 2YZMA 4GLXA 5DG9A 1Y14B 5H80A 2CW7A 3T5KA 2MCTA 2UXDH 5C5JA 4DL7A 3PW4A 5KT5A 1EUDB 3PR4A 3MR3A 1TAEA 1M0WA 3PN1A 4JI3H 4HR7A 4O3OA 2PVPA 4MTEA 2X0SA 4NXNH 1XNQH 3MWEA 3GTLA 3RB3A 2HGSA 3RB0A 2DPJA 5D1OA 5C1PA 4A3KG 4YP3A 4XYLB 4A93G 4ECUA 4EFEA 4JI7H 4O2AF 4UFZA 4FS2A 1RJRA 2W70A 2J9GA 3MJFA 3R5XA 4X62H 3HKZA 1I94H 5I47A 4M7EA 3QFFA 4O4HF 1KEEA 3Q8PB 1MZBA 1CQJB 4ED0A 2DPIA 1JKJB 4DUYH 5EWGA 5C4XG 1B6RA 5KT2A 3HOVG 4YJ3F 4DL2A 4DR6H 2AGPA 2GLTA 4JI1H 3I12A 3KHHA 4JV2A 1JIHA 3PW2A 3GIJA 3H20A 2W6ZA 4OX9H 2E2IA 3M9OB 1IOWA 1WSCA 2BQUA 1SEIA 2JA8G 5KG6A 3G6VA 1C3OA 3ORQA 4RZRA 5J2UF 5EOYA 4O3SA 4BY1G 4LF4H 2FPPB 1KJ8A 4TUYF 3RV4A 4DR2H 4BY7G 5CA0F 3G8CA 5K2MA 4EBCA 4LF5H 2R93A 5KFGA 1GSHA 4C5AA 2XCAA 3KAJA 5KFRA 3QZ7A 4DLKA 4F4WA 3G6YA 1UNNC 3VPDA 2FK3A 3RB4A 4UCTA 1E4FT 5KFDA 4TV8F 4MA0A 5KFPA 1P8LA 4EEYA 1VKZA 3LP8A 4EEQA 3PO3G 5KFNA 1EUCB 1S68A 3JSNA 1SYXB 4YR3A 4PWQA 1TWGA 5DQGA 3RIZA 4Q43A 2ALZA 1AN7A 3N42B 4TQRA 3GIKA 4F4YA 3JZIA 2B63G 5D1PA 4ME6A 5KT6A 1DGSA 3LMLA 2I87A 4JUZA 1B33N 4DV7H 1R9TA 2DIKA 1XMOH 3VMMA 2UU9H 2JA5G 5KFUA 2WAQE 4ED2A 4KHPH 4QWDA 2W7OA 2VUMG 4LF8H 4RB1A 2C2DA 2NU8B 1JLLB 5A2QW 3H0GA 2ZDQA 1A0IA 2WB1E 2AQ4A 5KT3A 1A9XA 2JA6A 3PW7A 1VS0A 1K1SA 4I4TF 2JEFA 1GGOA 4JV5H 2J6UA 2Y0SE 5KG5A 1OWTA 2YS6A 1RK6A 5IP7G 3QZ8A 2YL2A 4DV4H 1V51A 3BAAA 2WYOA 4RB3C 3OTOH 1N36H 5CAEB 2VQEH 4ECQA 2UUAH 4NLGA 1Z2OX 5JQWA 1TWHA 3K3VA 2R92A 3MWDA 3KHGA 4DL6A 2YCHA 5KFMA 2VR1A 3KAKA 1CE8A 2DLNA 4LH6A 4U6PA 2PMZA 3N43B 4YAJB 3T5JA 5KG3A 4QWEA 2IMWP 3F8NA 3RJ0A 5DQHA 4IRCA 3N6XA 4EYHB 1HNWH 1JX4A 4RNNA 2C35B 4Q8EA 4LSAA 4A3JG 2FMAA 4IWXA 4LMYA 3OSNA 3T1YH 5KFOA 3Q8RB 4E4TA 4RB0A 5KG2A 2NU9B 2WDTA 3GV5B 1S9FA 2Q2UA 5JUMA 1Y1VG 1S10A 2FJZA 1KJJA 2GPWA 4EBEA 4YB8B 4TV9F 2HVSA 3FKIG 3KALA 4DL3A 1IBMH 5KT4A 4LSXA 1S97A 4J9PA 4AYBA 5FLXW 4LFCH 4I50F 4MV9A 5KFEA 2XIGA 4EYIB 5KG4A 2F4VH 3MR6A 2V4QA 4WBNF 1RYRA 1L2ZA 4IR9A 2BQRA 1ZHQA 2VUGA 2SCUB 3OUZA 2W6OA 4GC6A 4F4ZA 1SFOA 5DGBA 4J9MA 4CC5A 4ECXA 3Q2OA 1JDBB 4A3GG 4DR5H 4QWAA 3H4BA 3NGDA 4O3NA 1SCUB 3GTMA 4NXMH 2I8CA 3ORRA 5L1JA 2R7MA 4BXXG 2R8HA 3GLKA 3GQCA 3L4JA 4DR4H 4EFBA 5KFXA 1WCMG 2V58A 1DIKA 2FKLA 2W9CA 1E4EA 4DV6H 2R85A 1KBLA 4YQWA 1T94A 2GPSA 3J80W 4RAZA 5CB4F 5KG7A 4HYKA 4ED8A 3PW0A 1N32H 4RNMA 3GILA 1HR0H 1I7LA 5KFCA 4APMA 4RUCA 4RU9A 4HNTA 1Y1WG 1JXLA 4MV3A 4ED7A 4IR1A 2YYAA 2XC9A 2R7ZG 2VPQA 4J0MA 3UQ8A 4FBTA 4X65H 5KFAA 4PDBA 3RTXA 5KFKA 4FBUA 4ZHQF 5IP9G 3Q8SB 2ASJA 1B04A 5EWEA 2UUCH 1JDEA 1PK8A 3BA9A 4C2MA 2W9BA 3JRXA 4A3CG 2R8IA 3PO2G 4XX0B 4JI0H 5FD5A 3IG0A 4F4XA 1RYSA 4JI6H 1VAJA 2FP4B 4RZQA 4GKJH 1E4GT 4A3FG 5C3EG 4R7RA 1V4YA 3CVZA 5KKNB 4U7CA 3Q8QB 3GIIA 3GV7B 4RNOA 3T1HH 2R7LA 3BQ0A 2FLPA 3H3VH 2AU0A 3N41B 1WH2A 2FE3A 4QW9A 2ZDHA 2W57A 4ED1A 2C00A 3V6JA 1S0MA 1N33H 3C0FB 2R7KA 4DV0H 1TA8A 4YJ2F 5LXTF 4ED6A 1M7JA 4QWCA 2NVYA 3OHBA 5JVDF 3M9MB 3GTKA 3GIQA 4MA5A 2C28A 1KJIA 3IN5A 3SI8A 4Q44A 2IA6A 4MTDA 4L1KA 2DWCA 2HHHH 4IRDA 2YRXA 2ZM6H 3BA8A 5LYJF 3BJYA 5KFTA 3VPCA 2VQFH 3M9NB 4EBDA 5LMUH 5IYZF 1PX2A 4A2AA 4JYAH 1CS0A 1FVIA 2W6NA 5D1OB 4AQYH 2R86A 5HBRB 2JEIA 1ZETA 5DLFA 3KHRA 1GSAA 3T5LA 1K1QA 3GTOA 3WO1A 2WAQA 5LA6F 2C2RA 4C5CA 2YW2A 5KG1A 5DG7A 4BWSC 3TQTA 3PW5A 4O4LF 4LFAH 2CQYA 5KFSA 4RAYA 1I6UA 3HBLA 4IZOA 5L9XA 2NU7B 2R7NA 2CW8A 2WB1A 3HB9A 1KC7A 4GC7A 3PZPA 4ECSA
chains in the Genus database with same CATH topology
1OWTA 2FK3A 3KTMA 2M05A 2FJZA 2FKLA 2FK1A 2FMAA 2FK2A 4PWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OWT A;  2FK3 A;  3KTM A;  2M05 A;  2FJZ A;  2FKL A;  2FK1 A;  2FMA A;  2FK2 A;  4PWQ A; 
#chains in the Genus database with same CATH topology
 5LL6 b;  4MV8 A;  2ASL A;  3J7A K;  4ECW A;  4DR7 H;  2ASD A;  3OSP A;  4B3M H;  3MR2 A;  5BMV F;  2Y0S A;  3PVX A;  5LMN H;  2RGR A;  2WTF A;  4YAK B;  2W9B B;  2V59 A;  3UFX B;  1BGW A;  1IBK H;  4YBZ B;  2UVW A;  4Q8F A;  3GTP A;  5KFZ A;  2KSW A;  2HVQ A;  5T14 A;  2FLL A;  4MAM A;  5BPF A;  3HOZ G;  2ATL A;  1S03 G;  3E5N A;  4UCV A;  4IAJ A;  1S0N A;  2IBK A;  3Q1K A;  1Z2P X;  4YR0 A;  3BQ1 A;  2NVX A;  5KFB A;  4DR1 H;  2Q2T A;  2R82 A;  3EYY A;  3FMA A;  4MV6 A;  1HNX H;  2ZDG A;  3OUU A;  5LOV F;  4DR3 H;  3KTM A;  4DUZ H;  4DV2 H;  4QJF A;  4HQ6 A;  5F9L A;  4ZOL F;  4LFB H;  2QYZ A;  3MWM A;  3R23 A;  4O4I F;  4FM9 A;  3GID A;  3H40 A;  5KFL A;  4ECR A;  2CZG A;  4J9L A;  3GTG A;  1S0O A;  4B3S H;  4B3R H;  1TWA A;  5DQI A;  4X66 H;  2R93 G;  5HV6 A;  2YU9 A;  5KX5 F;  4TQS A;  2B63 A;  5JH7 F;  5KFQ A;  2J6S A;  1BNC A;  5F9N A;  4JV1 A;  4A3L G;  1IOV A;  2W71 A;  2RDI A;  4QIW E;  2VPS A;  2YRW A;  5FD6 A;  4JI4 H;  3SE7 A;  5GON F;  4R8U A;  5DLG A;  2JA5 A;  5EWF A;  5IYD G;  2XD4 A;  3TIG A;  3MFH A;  4FS1 A;  3V6K A;  4EGQ A;  2VUM A;  3TQ1 A;  4DL5 A;  4RB2 C;  1X9N A;  2FB9 A;  2NUA B;  1UC8 A;  5KT7 A;  3I4N G;  3RB6 A;  1GLV A;  1AUX A;  4J9N A;  4BBR G;  5JVL A;  2UVU A;  3M4I A;  5BR8 H;  3RFC A;  3KHL A;  4G3I A;  2O03 A;  5KFY A;  5KFV A;  2AGO A;  3T5H A;  4DL4 A;  2RGV A;  2W8L A;  5FJ8 G;  5FPR A;  1I50 A;  2PN1 A;  4I7H A;  4EG0 A;  1T3N A;  3HKZ E;  4MV7 A;  3H0G G;  3G6X A;  2OH2 A;  2UUB H;  2BR0 A;  3GTQ A;  3WO0 A;  3U9S A;  4C5B A;  3TIN A;  2JA6 G;  1FKA H;  2VA2 A;  1ULZ A;  4UCS A;  2P0A A;  4WD3 A;  4A2B A;  3HOY G;  3GV8 B;  4YR2 A;  2OLS A;  4J9O A;  2UVR A;  1XMQ H;  3HXL A;  3N44 B;  3BAB A;  3R5F A;  1AUV A;  1B6S A;  3RF2 A;  5KFF A;  4JI5 H;  4GKK H;  5KG0 A;  4LF6 H;  2C22 A;  3N40 P;  2UXC H;  2FPG B;  1EZ1 A;  3N8D A;  2W9A A;  2R8G A;  2IP4 A;  2R92 G;  2FK1 A;  5KFW A;  1ZQ7 A;  1N48 A;  1EYZ A;  2YZN A;  1EHI A;  5C1O A;  4RUA A;  5L1I A;  2XCL A;  3OHA A;  1Y1V A;  2E2H A;  2R87 A;  1CQI B;  4M9U A;  1RK5 A;  5D8D A;  1I7N A;  4DV5 H;  3FKI A;  1W96 A;  5CA1 F;  2XGQ A;  1BXR A;  4LF9 H;  2RF4 A;  4UCR A;  4Y8V B;  4A3M G;  4UCO A;  1RJQ A;  1TWF A;  3GTJ A;  3R5H A;  2R84 A;  4QWB A;  3LWB A;  3L2P A;  4BBS G;  4R8U B;  3VPB A;  1GSO A;  4Q45 A;  1N34 H;  2ZJT A;  4MV1 A;  3BQ2 A;  5EZY F;  2W7P A;  1O75 A;  2CKZ B;  3GIM A;  4IHJ F;  3K5H A;  3RGZ A;  1KJ9 A;  2YS7 A;  2M05 A;  3EPG A;  2JEG A;  1UC9 A;  5IYB G;  4ECZ A;  2I80 A;  3CQZ A;  3HOU G;  5IWA H;  1M6V A;  5IT9 W;  3FDS A;  4O3P A;  2UXB H;  2AGQ A;  1KJQ A;  2W9C B;  1E4E B;  4JI2 H;  4DV3 H;  4EGJ A;  2R8J A;  4K0K H;  1GYF A;  2UVV A;  1WCM A;  2NU6 B;  3RV3 A;  5IYC G;  2JA7 A;  3V4Z A;  1N56 A;  1DV2 A;  1GO3 E;  2W6Q A;  2YZG A;  1V9P A;  4ED3 A;  3U9T A;  5LP6 F;  4F50 A;  4ECY A;  4J9K A;  1Y1W A;  1DV1 A;  4LF7 H;  1XNR H;  3JRW A;  3DF7 A;  2V4R A;  2VOB A;  4ECT A;  2R7Z A;  3HOX G;  4X64 H;  4LH7 A;  3PR5 B;  2V9W A;  3H4D A;  5KFI A;  3K5I A;  5EDW A;  5DG8 A;  5DGA A;  4ETS A;  3KXY T;  2QK4 A;  4J9R A;  1FJG H;  1XDN A;  3RAX A;  3GIP A;  3AYH B;  4Q0Y A;  3L4K A;  2DZD A;  3RBE A;  1M0T A;  2JEJ A;  2JA7 G;  1J5E H;  1HNZ H;  4FU0 A;  4XZ3 B;  5FPO A;  3JAM W;  4O3R A;  1VBH A;  2J6T A;  2PMZ E;  5C8Y F;  4YY3 H;  4MV4 A;  4ZI7 F;  4A3E G;  2R8K A;  1RJP A;  1ZHS A;  2WE6 A;  1W93 A;  3HOW G;  4O3Q A;  1VBG A;  2VA3 A;  3I4M G;  2HJW A;  2BQ3 A;  4CC6 A;  1BJT A;  4HNU A;  1T36 A;  5L1L A;  4QW8 A;  4JV0 A;  4IWY A;  2FPI B;  3RAQ A;  2W8K A;  4J9Q A;  3K3P A;  3J81 W;  2V5A A;  2VQD A;  3EPI A;  3V4S A;  4J9S A;  5FLM G;  3TII A;  1IBL H;  4DV1 H;  1TWC A;  3MFI A;  2XCP A;  4B3T H;  4YHH H;  4A3B G;  3ETH A;  5J2T F;  1Z2N X;  4AYB E;  2XGP A;  4A3I G;  2PBZ A;  4HNV A;  1C30 A;  2FK2 A;  2C2E A;  2R6F A;  3MR5 A;  3JSL A;  2FLN A;  4O2B F;  4UCU A;  2W6M A;  1K83 A;  4IRK A;  4A3D G;  2HVR A;  3RBD A;  1WR2 A;  2W6P A;  5KFJ A;  5C44 G;  3RUP A;  4ZQI A;  5L1K A;  4QIW A;  5BPH A;  1I3Q A;  3V6H A;  2E5L H;  4JI8 H;  5KFH A;  3RGX A;  3ETJ A;  2OWO A;  3WNZ A;  4I55 F;  4ECV A;  4XYM B;  2RDJ A;  3BG5 A;  2YZM A;  4GLX A;  5DG9 A;  1Y14 B;  5H80 A;  2CW7 A;  3T5K A;  2MCT A;  2UXD H;  5C5J A;  4DL7 A;  3PW4 A;  5KT5 A;  1EUD B;  3PR4 A;  3MR3 A;  1TAE A;  1M0W A;  3PN1 A;  4JI3 H;  4HR7 A;  4O3O A;  2PVP A;  4MTE A;  2X0S A;  4NXN H;  1XNQ H;  3MWE A;  3GTL A;  3RB3 A;  2HGS A;  3RB0 A;  2DPJ A;  5D1O A;  5C1P A;  4A3K G;  4YP3 A;  4XYL B;  4A93 G;  4ECU A;  4EFE A;  4JI7 H;  4O2A F;  4UFZ A;  4FS2 A;  1RJR A;  2W70 A;  2J9G A;  3MJF A;  3R5X A;  4X62 H;  3HKZ A;  1I94 H;  5I47 A;  4M7E A;  3QFF A;  4O4H F;  1KEE A;  3Q8P B;  1MZB A;  1CQJ B;  4ED0 A;  2DPI A;  1JKJ B;  4DUY H;  5EWG A;  5C4X G;  1B6R A;  5KT2 A;  3HOV G;  4YJ3 F;  4DL2 A;  4DR6 H;  2AGP A;  2GLT A;  4JI1 H;  3I12 A;  3KHH A;  4JV2 A;  1JIH A;  3PW2 A;  3GIJ A;  3H20 A;  2W6Z A;  4OX9 H;  2E2I A;  3M9O B;  1IOW A;  1WSC A;  2BQU A;  1SEI A;  2JA8 G;  5KG6 A;  3G6V A;  1C3O A;  3ORQ A;  4RZR A;  5J2U F;  5EOY A;  4O3S A;  4BY1 G;  4LF4 H;  2FPP B;  1KJ8 A;  4TUY F;  3RV4 A;  4DR2 H;  4BY7 G;  5CA0 F;  3G8C A;  5K2M A;  4EBC A;  4LF5 H;  2R93 A;  5KFG A;  1GSH A;  4C5A A;  2XCA A;  3KAJ A;  5KFR A;  3QZ7 A;  4DLK A;  4F4W A;  3G6Y A;  1UNN C;  3VPD A;  2FK3 A;  3RB4 A;  4UCT A;  1E4F T;  5KFD A;  4TV8 F;  4MA0 A;  5KFP A;  1P8L A;  4EEY A;  1VKZ A;  3LP8 A;  4EEQ A;  3PO3 G;  5KFN A;  1EUC B;  1S68 A;  3JSN A;  1SYX B;  4YR3 A;  4PWQ A;  1TWG A;  5DQG A;  3RIZ A;  4Q43 A;  2ALZ A;  1AN7 A;  3N42 B;  4TQR A;  3GIK A;  4F4Y A;  3JZI A;  2B63 G;  5D1P A;  4ME6 A;  5KT6 A;  1DGS A;  3LML A;  2I87 A;  4JUZ A;  1B33 N;  4DV7 H;  1R9T A;  2DIK A;  1XMO H;  3VMM A;  2UU9 H;  2JA5 G;  5KFU A;  2WAQ E;  4ED2 A;  4KHP H;  4QWD A;  2W7O A;  2VUM G;  4LF8 H;  4RB1 A;  2C2D A;  2NU8 B;  1JLL B;  5A2Q W;  3H0G A;  2ZDQ A;  1A0I A;  2WB1 E;  2AQ4 A;  5KT3 A;  1A9X A;  2JA6 A;  3PW7 A;  1VS0 A;  1K1S A;  4I4T F;  2JEF A;  1GGO A;  4JV5 H;  2J6U A;  2Y0S E;  5KG5 A;  1OWT A;  2YS6 A;  1RK6 A;  5IP7 G;  3QZ8 A;  2YL2 A;  4DV4 H;  1V51 A;  3BAA A;  2WYO A;  4RB3 C;  3OTO H;  1N36 H;  5CAE B;  2VQE H;  4ECQ A;  2UUA H;  4NLG A;  1Z2O X;  5JQW A;  1TWH A;  3K3V A;  2R92 A;  3MWD A;  3KHG A;  4DL6 A;  2YCH A;  5KFM A;  2VR1 A;  3KAK A;  1CE8 A;  2DLN A;  4LH6 A;  4U6P A;  2PMZ A;  3N43 B;  4YAJ B;  3T5J A;  5KG3 A;  4QWE A;  2IMW P;  3F8N A;  3RJ0 A;  5DQH A;  4IRC A;  3N6X A;  4EYH B;  1HNW H;  1JX4 A;  4RNN A;  2C35 B;  4Q8E A;  4LSA A;  4A3J G;  2FMA A;  4IWX A;  4LMY A;  3OSN A;  3T1Y H;  5KFO A;  3Q8R B;  4E4T A;  4RB0 A;  5KG2 A;  2NU9 B;  2WDT A;  3GV5 B;  1S9F A;  2Q2U A;  5JUM A;  1Y1V G;  1S10 A;  2FJZ A;  1KJJ A;  2GPW A;  4EBE A;  4YB8 B;  4TV9 F;  2HVS A;  3FKI G;  3KAL A;  4DL3 A;  1IBM H;  5KT4 A;  4LSX A;  1S97 A;  4J9P A;  4AYB A;  5FLX W;  4LFC H;  4I50 F;  4MV9 A;  5KFE A;  2XIG A;  4EYI B;  5KG4 A;  2F4V H;  3MR6 A;  2V4Q A;  4WBN F;  1RYR A;  1L2Z A;  4IR9 A;  2BQR A;  1ZHQ A;  2VUG A;  2SCU B;  3OUZ A;  2W6O A;  4GC6 A;  4F4Z A;  1SFO A;  5DGB A;  4J9M A;  4CC5 A;  4ECX A;  3Q2O A;  1JDB B;  4A3G G;  4DR5 H;  4QWA A;  3H4B A;  3NGD A;  4O3N A;  1SCU B;  3GTM A;  4NXM H;  2I8C A;  3ORR A;  5L1J A;  2R7M A;  4BXX G;  2R8H A;  3GLK A;  3GQC A;  3L4J A;  4DR4 H;  4EFB A;  5KFX A;  1WCM G;  2V58 A;  1DIK A;  2FKL A;  2W9C A;  1E4E A;  4DV6 H;  2R85 A;  1KBL A;  4YQW A;  1T94 A;  2GPS A;  3J80 W;  4RAZ A;  5CB4 F;  5KG7 A;  4HYK A;  4ED8 A;  3PW0 A;  1N32 H;  4RNM A;  3GIL A;  1HR0 H;  1I7L A;  5KFC A;  4APM A;  4RUC A;  4RU9 A;  4HNT A;  1Y1W G;  1JXL A;  4MV3 A;  4ED7 A;  4IR1 A;  2YYA A;  2XC9 A;  2R7Z G;  2VPQ A;  4J0M A;  3UQ8 A;  4FBT A;  4X65 H;  5KFA A;  4PDB A;  3RTX A;  5KFK A;  4FBU A;  4ZHQ F;  5IP9 G;  3Q8S B;  2ASJ A;  1B04 A;  5EWE A;  2UUC H;  1JDE A;  1PK8 A;  3BA9 A;  4C2M A;  2W9B A;  3JRX A;  4A3C G;  2R8I A;  3PO2 G;  4XX0 B;  4JI0 H;  5FD5 A;  3IG0 A;  4F4X A;  1RYS A;  4JI6 H;  1VAJ A;  2FP4 B;  4RZQ A;  4GKJ H;  1E4G T;  4A3F G;  5C3E G;  4R7R A;  1V4Y A;  3CVZ A;  5KKN B;  4U7C A;  3Q8Q B;  3GII A;  3GV7 B;  4RNO A;  3T1H H;  2R7L A;  3BQ0 A;  2FLP A;  3H3V H;  2AU0 A;  3N41 B;  1WH2 A;  2FE3 A;  4QW9 A;  2ZDH A;  2W57 A;  4ED1 A;  2C00 A;  3V6J A;  1S0M A;  1N33 H;  3C0F B;  2R7K A;  4DV0 H;  1TA8 A;  4YJ2 F;  5LXT F;  4ED6 A;  1M7J A;  4QWC A;  2NVY A;  3OHB A;  5JVD F;  3M9M B;  3GTK A;  3GIQ A;  4MA5 A;  2C28 A;  1KJI A;  3IN5 A;  3SI8 A;  4Q44 A;  2IA6 A;  4MTD A;  4L1K A;  2DWC A;  2HHH H;  4IRD A;  2YRX A;  2ZM6 H;  3BA8 A;  5LYJ F;  3BJY A;  5KFT A;  3VPC A;  2VQF H;  3M9N B;  4EBD A;  5LMU H;  5IYZ F;  1PX2 A;  4A2A A;  4JYA H;  1CS0 A;  1FVI A;  2W6N A;  5D1O B;  4AQY H;  2R86 A;  5HBR B;  2JEI A;  1ZET A;  5DLF A;  3KHR A;  1GSA A;  3T5L A;  1K1Q A;  3GTO A;  3WO1 A;  2WAQ A;  5LA6 F;  2C2R A;  4C5C A;  2YW2 A;  5KG1 A;  5DG7 A;  4BWS C;  3TQT A;  3PW5 A;  4O4L F;  4LFA H;  2CQY A;  5KFS A;  4RAY A;  1I6U A;  3HBL A;  4IZO A;  5L9X A;  2NU7 B;  2R7N A;  2CW8 A;  2WB1 A;  3HB9 A;  1KC7 A;  4GC7 A;  3PZP A;  4ECS A; 
#chains in the Genus database with same CATH homology
 1OWT A;  2FK3 A;  3KTM A;  2M05 A;  2FJZ A;  2FKL A;  2FK1 A;  2FMA A;  2FK2 A;  4PWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...