2M05A

Structure of module 2 from the e1 domain of c. elegans apl-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
b'EACQFSHVNSRDQCNDYQHWKDEAGKQCKTKKSKGNKDMIVRSFAVLEPCALDMFTGVEFVCCPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Quantification of copper binding to amyloid precursor protein domain 2 and its Caenorhabditis elegans ortholog. Implications for biological function.
pubmed doi rcsb
molecule keywords Beta-amyloid-like protein
source organism Caenorhabditis elegans
molecule tags Unknown function
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2012-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2m05A00
1OWTA 2FKLA 2FMAA 2FK3A 2FK2A 3KTMA 2FJZA 2FK1A 2M05A 4PWQA
chains in the Genus database with same CATH superfamily
3N6XA 4MV4A 2RF4A 2HJWA 4ECVA 5EWEA 3RAXA 1VAJA 2CW8A 4B3SH 4BBRG 5D1OA 5BR8H 4MAMA 2SCUB 5IYDG 4EYIB 4QIWE 2JA5A 5L1IA 3J81W 4QWEA 2ZM6H 3Q8QB 3KAKA 5JUMA 2ALZA 4RNMA 2XC9A 3JSLA 3V6HA 2RDJA 3PW7A 4F4WA 3VPDA 1XMOH 2W6MA 5KX5F 4Q8FA 4ECYA 1SEIA 4PWQA 5K2MA 2XGPA 2V59A 4RB1A 2BQRA 5J2TF 3G6YA 4G3IA 2R7NA 3JRXA 3OSPA 3GV5B 3RFCA 3HOZG 1EHIA 4JI3H 4K0KH 1R9TA 4MV7A 4JI8H 2DZDA 1T3NA 2UVRA 4DR1H 4GC7A 2X0SA 4X62H 2JA7A 5FD6A 3PO3G 2GPWA 3EPIA 5KFYA 2UVVA 1L2ZA 3VPBA 1EYZA 4RB0A 1GLVA 2UVUA 4HNUA 4ME6A 1EUDB 1JIHA 4MTDA 4MV3A 4U7CA 2C00A 4X65H 3WO1A 3GIIA 4ED7A 4FBUA 4A3BG 3H20A 4LF7H 4J9MA 2W6NA 4LH7A 4QWAA 1ZETA 4LF6H 4A3MG 5EZYF 1IBKH 2VUMG 2HHHH 1DGSA 4TUYF 4IRCA 4BBSG 1TWAA 3L4KA 1JDEA 3K5HA 1BNCA 2FPGB 3MR3A 2MCTA 2R86A 4HQ6A 2F4VH 2W6ZA 3I12A 4BY1G 1I94H 4XX0B 4PDBA 4A2AA 4XZ3B 4A93G 2NVXA 5C5JA 2W7OA 4GLXA 4ED8A 2HGSA 2ASJA 5LMNH 1XMQH 4QW8A 2XCLA 1A9XA 1K83A 2AU0A 1E4EA 4EGJA 3EPGA 2R7LA 3C0FB 2UXBH 3GIPA 4LF5H 4ECTA 5KFLA 4HNVA 3BQ1A 4J9KA 3T5JA 5C3EG 4QWDA 1Z2OX 2M05A 4IAJA 4J9LA 2W9AA 4ED3A 5KFAA 3H40A 2W9CA 2R93A 3UQ8A 4ECWA 3K5IA 3V4ZA 1IOWA 4HR7A 3RUPA 1AUXA 5IYBG 2WTFA 5JVLA 2WDTA 2FJZA 2VPQA 3N41B 3QFFA 3PW4A 1FJGH 1DV1A 4EG0A 2J6UA 4Q0YA 5KG0A 1TWCA 4DV3H 2JEJA 1EZ1A 4YB8B 2YZNA 1JKJB 4BY7G 1W93A 3JSNA 5KG4A 2IP4A 5DG7A 4IWYA 3U9TA 1PK8A 2DLNA 4RB2C 2E5LH 1RK6A 2VQEH 3ORRA 3RB0A 3HOXG 2V4QA 4LSXA 4DL3A 1HNZH 3RJ0A 5FPOA 4JI1H 1SYXB 4NLGA 4JV5H 1SFOA 2NVYA 3M9NB 1WCMA 4O4LF 4J9OA 4RU9A 2Y0SA 4IR9A 3VPCA 4J0MA 4NXMH 5IT9W 2I80A 4I7HA 1O75A 5KFUA 5FPRA 1E4EB 2CQYA 2FK2A 1VBGA 1VBHA 3FKIG 1JLLB 5KFZA 5F9LA 4JYAH 2C28A 2C22A 3G8CA 2XCAA 5J2UF 3WO0A 4XYLB 1MZBA 2QK4A 2UXCH 4YY3H 1S03G 2YW2A 2IMWP 4GC6A 3RB3A 4YR0A 2XCPA 2FE3A 3KALA 3MFIA 2HVRA 5KFGA 3BQ2A 4B3RH 5D8DA 2I87A 2W9BB 1N32H 2V5AA 2HVQA 5KFIA 3RGXA 4FS2A 4DR7H 5KT6A 3FMAA 2GLTA 5KFHA 3KAJA 4DLKA 3KHHA 4QWCA 2R8HA 4AQYH 3HBLA 2NUAB 1HNXH 2R8GA 2YS7A 4J9NA 4I50F 5KT7A 4TQRA 2PMZA 4DL6A 2I8CA 4RNOA 2R8KA 4LH6A 5DQGA 4RUAA 5IWAH 1RJQA 4YBZB 2R92A 3MWMA 5CB4F 4DL7A 2RGRA 1IBMH 5KT2A 1M0TA 4RUCA 2Q2TA 3BABA 3RV3A 3GIKA 4I4TF 4DR5H 3RBEA 1RJPA 1I6UA 2FK3A 3FDSA 5LOVF 2C2DA 2JA7G 3K3PA 1KJJA 2GPSA 4EEQA 1SCUB 4ED2A 5KFJA 1S0OA 4JI7H 1CQJB 4JI5H 1TAEA 5JH7F 3T5LA 3KHLA 4IHJF 5KG5A 4UCRA 5L1KA 2WYOA 3R23A 1J5EH 4ZI7F 2WAQE 4ECUA 3R5XA 4IRDA 3BA8A 3M9MB 3BG5A 5KG7A 5C8YF 3T1YH 2YRXA 1Y14B 1N36H 3GTOA 4XYMB 1C30A 5KFDA 4F4ZA 2WAQA 1N34H 1W96A 3M9OB 3GTPA 3GIMA 4JI4H 4LFBH 3GIDA 4O4HF 1DIKA 2ZDGA 1IBLH 2RGVA 1X9NA 3BAAA 2AGQA 5H80A 4LFAH 1TWGA 5LMUH 3GV8B 1C3OA 4UCOA 4F4YA 3GLKA 1GSOA 5C1OA 2YCHA 4EBEA 5BPFA 1T94A 1KJ8A 1GO3E 3PW2A 2E2IA 2YL2A 5HV6A 2UU9H 1KEEA 4OX9H 2XGQA 4ZHQF 4R8UB 2YU9A 1N56A 3GTKA 1V9PA 4HYKA 1OWTA 4O3PA 1N48A 4DUZH 3HKZA 4RAZA 2FK1A 4YJ3F 3I4MG 1IOVA 1Z2PX 3N40P 5EDWA 3QZ7A 4KHPH 4A3FG 2W71A 3LMLA 1FKAH 4IRKA 1I50A 1E4GT 4O2AF 2W7PA 2FLLA 2R7ZA 3MWDA 1KBLA 2WB1A 4FS1A 5C44G 3BJYA 2ASLA 5HBRB 1XNRH 3HOYG 2P0AA 5I47A 5KG2A 2BQ3A 3PZPA 3Q2OA 2IA6A 3TQ1A 2W9BA 3J80W 3AYHB 3GV7B 2NU7B 2ZJTA 2DPJA 3CQZA 3H3VH 5LYJF 4O3RA 1KJQA 5KFQA 2FPPB 4LF8H 1WR2A 2C2RA 2W8LA 4YP3A 5KG6A 4MV9A 5DGBA 3CVZA 5DLFA 4YR3A 5LA6F 2AGPA 2BQUA 1UC8A 5KFRA 1Y1WA 1WCMG 3ETHA 1GGOA 3ORQA 4A3LG 4J9PA 5IP9G 1AUVA 3Q8SB 1JXLA 2R7MA 1BXRA 4X66H 2VUGA 3GTGA 2JEFA 4MTEA 4RZRA 2ZDQA 3LWBA 2R6FA 3ETJA 5KFKA 2W6QA 4MA0A 1RJRA 2Y0SE 3T5KA 2PN1A 4DV1H 3HB9A 4WBNF 4IZOA 4YAJB 3JAMW 3GQCA 1S10A 3OSNA 4B3MH 3OHBA 1TWFA 2XD4A 5GONF 2DPIA 5CAEB 4DV2H 4YJ2F 1Z2NX 1XDNA 1BJTA 1ZQ7A 5L1JA 1HNWH 5KFFA 3IG0A 4A3KG 5KFOA 3OUZA 3I4NG 1VS0A 5KG3A 4R7RA 4DV0H 3HOWG 2HVSA 5A2QW 5DG8A 4DV6H 4EGQA 1CS0A 4Q45A 1Y1VA 2YRWA 1M7JA 5EWFA 2UUAH 2W6PA 4AYBA 5DQIA 4YHHH 4EBDA 1UC9A 3OTOH 5KT3A 2VQDA 3NGDA 5KFSA 1S0NA 5KT5A 2DWCA 2R84A 4F50A 2R92G 2B63A 5L9XA 4Q43A 2PMZE 3GIJA 1N33H 4Y8VB 4A3CG 4ECRA 3RAQA 1JX4A 2JA5G 5IYZF 3G6VA 4O3OA 3PW0A 4F4XA 5KG1A 3DF7A 3MWEA 5LXTF 4C5AA 4M7EA 5JQWA 1KC7A 1K1QA 5IYCG 2VA2A 4A3GG 2NU9B 1S97A 3N44B 3OUUA 1AN7A 2PVPA 5IP7G 4ECZA 2VA3A 4A3JG 4O4IF 5BPHA 4EYHB 3RIZA 4A3IG 3H0GA 1RYSA 2E2HA 4IR1A 4U6PA 2FMAA 5JVDF 1I7LA 5CA1F 3N8DA 1PX2A 5KFEA 5BMVF 1S68A 3GTLA 2R7KA 1TWHA 1I7NA 4O3SA 2VR1A 4UCUA 3TIGA 5DGAA 3N43B 2FLNA 4DR6H 4YAKB 1WSCA 5D1PA 4R8UA 3WNZA 2W70A 3L2PA 5KFVA 3TINA 3PO2G 4GKJH 3F8NA 2YYAA 4MV1A 3T5HA 3GILA 3BA9A 3Q8RB 3OHAA 4DR2H 2R8JA 2JA6A 4B3TH 4EFEA 1E4FT 4QW9A 4DR3H 2OWOA 5KFMA 2V58A 3GTMA 3K3VA 4LF9H 2RDIA 2UXDH 2C2EA 1ZHSA 3V6KA 4ZOLF 3U9SA 3VMMA 4A2BA 1V4YA 2VPSA 4IWXA 3H4DA 4DL4A 3MR6A 3T1HH 2J9GA 2ATLA 1M0WA 4BXXG 2VOBA 4JI2H 4A3DG 4QIWA 4JUZA 4E4TA 3RF2A 4MA5A 2Q2UA 2C35B 4HNTA 5EOYA 5KFWA 2YS6A 3SE7A 1RYRA 3M4IA 3HOVG 3PN1A 2OLSA 2JEIA 2FP4B 3Q8PB 4FBTA 3GTJA 3EYYA 3Q1KA 4ZQIA 4CC5A 5KFXA 4LSAA 3G6XA 4TV9F 3HKZE 4C5BA 3GIQA 2QYZA 1UNNC 2R7ZG 1B6SA 1GSAA 5EWGA 5FLMG 5LP6F 4TV8F 3MR5A 4DUYH 2J6TA 2UUBH 2R93G 4DV4H 2OH2A 3J7AK 2W8KA 3TIIA 1ULZA 2UUCH 3E5NA 3JRWA 1EUCB 2NU8B 4RZQA 2AQ4A 1ZHQA 1K1SA 2WB1E 2V4RA 4NXNH 3RGZA 3RV4A 3JZIA 1Y1WG 1B33N 1JDBB 4RB3C 5KFNA 5D1OB 3RTXA 1TA8A 3PVXA 5FLXW 1B04A 3L4JA 2IBKA 3QZ8A 1XNQH 2NU6B 2R87A 5FD5A 2W6OA 2KSWA 1V51A 4DR4H 1S9FA 4JI6H 3HOUG 4UFZA 2R82A 4X64H 3KHGA 3N42B 1KJ9A 4M9UA 5FJ8G 3UFXB 1KJIA 4JV2A 4J9SA 2O03A 2FKLA 2R85A 3MR2A 5KFTA 3V4SA 2FLPA 4CC6A 2CZGA 4Q44A 4J9RA 2VUMA 1T36A 3R5FA 3PR5B 4DL2A 4DL5A 4C5CA 5DQHA 5C4XG 5F9NA 4JV0A 1Y1VG 2FPIB 2AGOA 5DLGA 2JA8G 2R8IA 4DV5H 1M6VA 4GKKH 1GSHA 5KFBA 4JI0H 1I3QA 4UCTA 5CA0F 2XIGA 1S0MA 2B63G 1DV2A 4AYBE 4L1KA 1WH2A 2CW7A 4APMA 3RBDA 2UVWA 2JEGA 4Q8EA 5KT4A 1P8LA 4O3QA 4QJFA 5LL6b 1CE8A 4UCSA 3TQTA 3PW5A 2DIKA 1BGWA 4LMYA 4WD3A 1FVIA 4MV6A 3RB6A 4JV1A 4ECXA 3MJFA 4FU0A 5DG9A 3IN5A 3H0GG 3KTMA 5KFCA 1GYFA 4O3NA 4BWSC 4O2BF 2ASDA 3MFHA 2BR0A 4TQSA 2VQFH 2W57A 3H4BA 4ED6A 4FM9A 4RNNA 4UCVA 2CKZB 3PR4A 4ED1A 2WE6A 4A3EG 1B6RA 1VKZA 4LF4H 5T14A 4J9QA 5C1PA 4ETSA 2ZDHA 4EBCA 2YZGA 4EEYA 3KXYT 4LFCH 3V6JA 4ECSA 2JA6G 4YR2A 1A0IA 3HXLA 2W9CB 3R5HA 5L1LA 4YQWA 4DV7H 2YZMA 5KFPA 3RB4A 3KHRA 4C2MA 4EFBA 2J6SA 3FKIA 5KKNB 1RK5A 4ED0A 2V9WA 4I55F 4RAYA 3SI8A 3BQ0A 4ECQA 4MV8A 4QWBA 2FB9A 3GTQA 1CQIB 1HR0H 3LP8A 2PBZA
chains in the Genus database with same CATH topology
1OWTA 2FKLA 2FMAA 2FK3A 2FK2A 3KTMA 2FJZA 2FK1A 2M05A 4PWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OWT A;  2FKL A;  2FMA A;  2FK3 A;  2FK2 A;  3KTM A;  2FJZ A;  2FK1 A;  2M05 A;  4PWQ A; 
#chains in the Genus database with same CATH topology
 3N6X A;  4MV4 A;  2RF4 A;  2HJW A;  4ECV A;  5EWE A;  3RAX A;  1VAJ A;  2CW8 A;  4B3S H;  4BBR G;  5D1O A;  5BR8 H;  4MAM A;  2SCU B;  5IYD G;  4EYI B;  4QIW E;  2JA5 A;  5L1I A;  3J81 W;  4QWE A;  2ZM6 H;  3Q8Q B;  3KAK A;  5JUM A;  2ALZ A;  4RNM A;  2XC9 A;  3JSL A;  3V6H A;  2RDJ A;  3PW7 A;  4F4W A;  3VPD A;  1XMO H;  2W6M A;  5KX5 F;  4Q8F A;  4ECY A;  1SEI A;  4PWQ A;  5K2M A;  2XGP A;  2V59 A;  4RB1 A;  2BQR A;  5J2T F;  3G6Y A;  4G3I A;  2R7N A;  3JRX A;  3OSP A;  3GV5 B;  3RFC A;  3HOZ G;  1EHI A;  4JI3 H;  4K0K H;  1R9T A;  4MV7 A;  4JI8 H;  2DZD A;  1T3N A;  2UVR A;  4DR1 H;  4GC7 A;  2X0S A;  4X62 H;  2JA7 A;  5FD6 A;  3PO3 G;  2GPW A;  3EPI A;  5KFY A;  2UVV A;  1L2Z A;  3VPB A;  1EYZ A;  4RB0 A;  1GLV A;  2UVU A;  4HNU A;  4ME6 A;  1EUD B;  1JIH A;  4MTD A;  4MV3 A;  4U7C A;  2C00 A;  4X65 H;  3WO1 A;  3GII A;  4ED7 A;  4FBU A;  4A3B G;  3H20 A;  4LF7 H;  4J9M A;  2W6N A;  4LH7 A;  4QWA A;  1ZET A;  4LF6 H;  4A3M G;  5EZY F;  1IBK H;  2VUM G;  2HHH H;  1DGS A;  4TUY F;  4IRC A;  4BBS G;  1TWA A;  3L4K A;  1JDE A;  3K5H A;  1BNC A;  2FPG B;  3MR3 A;  2MCT A;  2R86 A;  4HQ6 A;  2F4V H;  2W6Z A;  3I12 A;  4BY1 G;  1I94 H;  4XX0 B;  4PDB A;  4A2A A;  4XZ3 B;  4A93 G;  2NVX A;  5C5J A;  2W7O A;  4GLX A;  4ED8 A;  2HGS A;  2ASJ A;  5LMN H;  1XMQ H;  4QW8 A;  2XCL A;  1A9X A;  1K83 A;  2AU0 A;  1E4E A;  4EGJ A;  3EPG A;  2R7L A;  3C0F B;  2UXB H;  3GIP A;  4LF5 H;  4ECT A;  5KFL A;  4HNV A;  3BQ1 A;  4J9K A;  3T5J A;  5C3E G;  4QWD A;  1Z2O X;  2M05 A;  4IAJ A;  4J9L A;  2W9A A;  4ED3 A;  5KFA A;  3H40 A;  2W9C A;  2R93 A;  3UQ8 A;  4ECW A;  3K5I A;  3V4Z A;  1IOW A;  4HR7 A;  3RUP A;  1AUX A;  5IYB G;  2WTF A;  5JVL A;  2WDT A;  2FJZ A;  2VPQ A;  3N41 B;  3QFF A;  3PW4 A;  1FJG H;  1DV1 A;  4EG0 A;  2J6U A;  4Q0Y A;  5KG0 A;  1TWC A;  4DV3 H;  2JEJ A;  1EZ1 A;  4YB8 B;  2YZN A;  1JKJ B;  4BY7 G;  1W93 A;  3JSN A;  5KG4 A;  2IP4 A;  5DG7 A;  4IWY A;  3U9T A;  1PK8 A;  2DLN A;  4RB2 C;  2E5L H;  1RK6 A;  2VQE H;  3ORR A;  3RB0 A;  3HOX G;  2V4Q A;  4LSX A;  4DL3 A;  1HNZ H;  3RJ0 A;  5FPO A;  4JI1 H;  1SYX B;  4NLG A;  4JV5 H;  1SFO A;  2NVY A;  3M9N B;  1WCM A;  4O4L F;  4J9O A;  4RU9 A;  2Y0S A;  4IR9 A;  3VPC A;  4J0M A;  4NXM H;  5IT9 W;  2I80 A;  4I7H A;  1O75 A;  5KFU A;  5FPR A;  1E4E B;  2CQY A;  2FK2 A;  1VBG A;  1VBH A;  3FKI G;  1JLL B;  5KFZ A;  5F9L A;  4JYA H;  2C28 A;  2C22 A;  3G8C A;  2XCA A;  5J2U F;  3WO0 A;  4XYL B;  1MZB A;  2QK4 A;  2UXC H;  4YY3 H;  1S03 G;  2YW2 A;  2IMW P;  4GC6 A;  3RB3 A;  4YR0 A;  2XCP A;  2FE3 A;  3KAL A;  3MFI A;  2HVR A;  5KFG A;  3BQ2 A;  4B3R H;  5D8D A;  2I87 A;  2W9B B;  1N32 H;  2V5A A;  2HVQ A;  5KFI A;  3RGX A;  4FS2 A;  4DR7 H;  5KT6 A;  3FMA A;  2GLT A;  5KFH A;  3KAJ A;  4DLK A;  3KHH A;  4QWC A;  2R8H A;  4AQY H;  3HBL A;  2NUA B;  1HNX H;  2R8G A;  2YS7 A;  4J9N A;  4I50 F;  5KT7 A;  4TQR A;  2PMZ A;  4DL6 A;  2I8C A;  4RNO A;  2R8K A;  4LH6 A;  5DQG A;  4RUA A;  5IWA H;  1RJQ A;  4YBZ B;  2R92 A;  3MWM A;  5CB4 F;  4DL7 A;  2RGR A;  1IBM H;  5KT2 A;  1M0T A;  4RUC A;  2Q2T A;  3BAB A;  3RV3 A;  3GIK A;  4I4T F;  4DR5 H;  3RBE A;  1RJP A;  1I6U A;  2FK3 A;  3FDS A;  5LOV F;  2C2D A;  2JA7 G;  3K3P A;  1KJJ A;  2GPS A;  4EEQ A;  1SCU B;  4ED2 A;  5KFJ A;  1S0O A;  4JI7 H;  1CQJ B;  4JI5 H;  1TAE A;  5JH7 F;  3T5L A;  3KHL A;  4IHJ F;  5KG5 A;  4UCR A;  5L1K A;  2WYO A;  3R23 A;  1J5E H;  4ZI7 F;  2WAQ E;  4ECU A;  3R5X A;  4IRD A;  3BA8 A;  3M9M B;  3BG5 A;  5KG7 A;  5C8Y F;  3T1Y H;  2YRX A;  1Y14 B;  1N36 H;  3GTO A;  4XYM B;  1C30 A;  5KFD A;  4F4Z A;  2WAQ A;  1N34 H;  1W96 A;  3M9O B;  3GTP A;  3GIM A;  4JI4 H;  4LFB H;  3GID A;  4O4H F;  1DIK A;  2ZDG A;  1IBL H;  2RGV A;  1X9N A;  3BAA A;  2AGQ A;  5H80 A;  4LFA H;  1TWG A;  5LMU H;  3GV8 B;  1C3O A;  4UCO A;  4F4Y A;  3GLK A;  1GSO A;  5C1O A;  2YCH A;  4EBE A;  5BPF A;  1T94 A;  1KJ8 A;  1GO3 E;  3PW2 A;  2E2I A;  2YL2 A;  5HV6 A;  2UU9 H;  1KEE A;  4OX9 H;  2XGQ A;  4ZHQ F;  4R8U B;  2YU9 A;  1N56 A;  3GTK A;  1V9P A;  4HYK A;  1OWT A;  4O3P A;  1N48 A;  4DUZ H;  3HKZ A;  4RAZ A;  2FK1 A;  4YJ3 F;  3I4M G;  1IOV A;  1Z2P X;  3N40 P;  5EDW A;  3QZ7 A;  4KHP H;  4A3F G;  2W71 A;  3LML A;  1FKA H;  4IRK A;  1I50 A;  1E4G T;  4O2A F;  2W7P A;  2FLL A;  2R7Z A;  3MWD A;  1KBL A;  2WB1 A;  4FS1 A;  5C44 G;  3BJY A;  2ASL A;  5HBR B;  1XNR H;  3HOY G;  2P0A A;  5I47 A;  5KG2 A;  2BQ3 A;  3PZP A;  3Q2O A;  2IA6 A;  3TQ1 A;  2W9B A;  3J80 W;  3AYH B;  3GV7 B;  2NU7 B;  2ZJT A;  2DPJ A;  3CQZ A;  3H3V H;  5LYJ F;  4O3R A;  1KJQ A;  5KFQ A;  2FPP B;  4LF8 H;  1WR2 A;  2C2R A;  2W8L A;  4YP3 A;  5KG6 A;  4MV9 A;  5DGB A;  3CVZ A;  5DLF A;  4YR3 A;  5LA6 F;  2AGP A;  2BQU A;  1UC8 A;  5KFR A;  1Y1W A;  1WCM G;  3ETH A;  1GGO A;  3ORQ A;  4A3L G;  4J9P A;  5IP9 G;  1AUV A;  3Q8S B;  1JXL A;  2R7M A;  1BXR A;  4X66 H;  2VUG A;  3GTG A;  2JEF A;  4MTE A;  4RZR A;  2ZDQ A;  3LWB A;  2R6F A;  3ETJ A;  5KFK A;  2W6Q A;  4MA0 A;  1RJR A;  2Y0S E;  3T5K A;  2PN1 A;  4DV1 H;  3HB9 A;  4WBN F;  4IZO A;  4YAJ B;  3JAM W;  3GQC A;  1S10 A;  3OSN A;  4B3M H;  3OHB A;  1TWF A;  2XD4 A;  5GON F;  2DPI A;  5CAE B;  4DV2 H;  4YJ2 F;  1Z2N X;  1XDN A;  1BJT A;  1ZQ7 A;  5L1J A;  1HNW H;  5KFF A;  3IG0 A;  4A3K G;  5KFO A;  3OUZ A;  3I4N G;  1VS0 A;  5KG3 A;  4R7R A;  4DV0 H;  3HOW G;  2HVS A;  5A2Q W;  5DG8 A;  4DV6 H;  4EGQ A;  1CS0 A;  4Q45 A;  1Y1V A;  2YRW A;  1M7J A;  5EWF A;  2UUA H;  2W6P A;  4AYB A;  5DQI A;  4YHH H;  4EBD A;  1UC9 A;  3OTO H;  5KT3 A;  2VQD A;  3NGD A;  5KFS A;  1S0N A;  5KT5 A;  2DWC A;  2R84 A;  4F50 A;  2R92 G;  2B63 A;  5L9X A;  4Q43 A;  2PMZ E;  3GIJ A;  1N33 H;  4Y8V B;  4A3C G;  4ECR A;  3RAQ A;  1JX4 A;  2JA5 G;  5IYZ F;  3G6V A;  4O3O A;  3PW0 A;  4F4X A;  5KG1 A;  3DF7 A;  3MWE A;  5LXT F;  4C5A A;  4M7E A;  5JQW A;  1KC7 A;  1K1Q A;  5IYC G;  2VA2 A;  4A3G G;  2NU9 B;  1S97 A;  3N44 B;  3OUU A;  1AN7 A;  2PVP A;  5IP7 G;  4ECZ A;  2VA3 A;  4A3J G;  4O4I F;  5BPH A;  4EYH B;  3RIZ A;  4A3I G;  3H0G A;  1RYS A;  2E2H A;  4IR1 A;  4U6P A;  2FMA A;  5JVD F;  1I7L A;  5CA1 F;  3N8D A;  1PX2 A;  5KFE A;  5BMV F;  1S68 A;  3GTL A;  2R7K A;  1TWH A;  1I7N A;  4O3S A;  2VR1 A;  4UCU A;  3TIG A;  5DGA A;  3N43 B;  2FLN A;  4DR6 H;  4YAK B;  1WSC A;  5D1P A;  4R8U A;  3WNZ A;  2W70 A;  3L2P A;  5KFV A;  3TIN A;  3PO2 G;  4GKJ H;  3F8N A;  2YYA A;  4MV1 A;  3T5H A;  3GIL A;  3BA9 A;  3Q8R B;  3OHA A;  4DR2 H;  2R8J A;  2JA6 A;  4B3T H;  4EFE A;  1E4F T;  4QW9 A;  4DR3 H;  2OWO A;  5KFM A;  2V58 A;  3GTM A;  3K3V A;  4LF9 H;  2RDI A;  2UXD H;  2C2E A;  1ZHS A;  3V6K A;  4ZOL F;  3U9S A;  3VMM A;  4A2B A;  1V4Y A;  2VPS A;  4IWX A;  3H4D A;  4DL4 A;  3MR6 A;  3T1H H;  2J9G A;  2ATL A;  1M0W A;  4BXX G;  2VOB A;  4JI2 H;  4A3D G;  4QIW A;  4JUZ A;  4E4T A;  3RF2 A;  4MA5 A;  2Q2U A;  2C35 B;  4HNT A;  5EOY A;  5KFW A;  2YS6 A;  3SE7 A;  1RYR A;  3M4I A;  3HOV G;  3PN1 A;  2OLS A;  2JEI A;  2FP4 B;  3Q8P B;  4FBT A;  3GTJ A;  3EYY A;  3Q1K A;  4ZQI A;  4CC5 A;  5KFX A;  4LSA A;  3G6X A;  4TV9 F;  3HKZ E;  4C5B A;  3GIQ A;  2QYZ A;  1UNN C;  2R7Z G;  1B6S A;  1GSA A;  5EWG A;  5FLM G;  5LP6 F;  4TV8 F;  3MR5 A;  4DUY H;  2J6T A;  2UUB H;  2R93 G;  4DV4 H;  2OH2 A;  3J7A K;  2W8K A;  3TII A;  1ULZ A;  2UUC H;  3E5N A;  3JRW A;  1EUC B;  2NU8 B;  4RZQ A;  2AQ4 A;  1ZHQ A;  1K1S A;  2WB1 E;  2V4R A;  4NXN H;  3RGZ A;  3RV4 A;  3JZI A;  1Y1W G;  1B33 N;  1JDB B;  4RB3 C;  5KFN A;  5D1O B;  3RTX A;  1TA8 A;  3PVX A;  5FLX W;  1B04 A;  3L4J A;  2IBK A;  3QZ8 A;  1XNQ H;  2NU6 B;  2R87 A;  5FD5 A;  2W6O A;  2KSW A;  1V51 A;  4DR4 H;  1S9F A;  4JI6 H;  3HOU G;  4UFZ A;  2R82 A;  4X64 H;  3KHG A;  3N42 B;  1KJ9 A;  4M9U A;  5FJ8 G;  3UFX B;  1KJI A;  4JV2 A;  4J9S A;  2O03 A;  2FKL A;  2R85 A;  3MR2 A;  5KFT A;  3V4S A;  2FLP A;  4CC6 A;  2CZG A;  4Q44 A;  4J9R A;  2VUM A;  1T36 A;  3R5F A;  3PR5 B;  4DL2 A;  4DL5 A;  4C5C A;  5DQH A;  5C4X G;  5F9N A;  4JV0 A;  1Y1V G;  2FPI B;  2AGO A;  5DLG A;  2JA8 G;  2R8I A;  4DV5 H;  1M6V A;  4GKK H;  1GSH A;  5KFB A;  4JI0 H;  1I3Q A;  4UCT A;  5CA0 F;  2XIG A;  1S0M A;  2B63 G;  1DV2 A;  4AYB E;  4L1K A;  1WH2 A;  2CW7 A;  4APM A;  3RBD A;  2UVW A;  2JEG A;  4Q8E A;  5KT4 A;  1P8L A;  4O3Q A;  4QJF A;  5LL6 b;  1CE8 A;  4UCS A;  3TQT A;  3PW5 A;  2DIK A;  1BGW A;  4LMY A;  4WD3 A;  1FVI A;  4MV6 A;  3RB6 A;  4JV1 A;  4ECX A;  3MJF A;  4FU0 A;  5DG9 A;  3IN5 A;  3H0G G;  3KTM A;  5KFC A;  1GYF A;  4O3N A;  4BWS C;  4O2B F;  2ASD A;  3MFH A;  2BR0 A;  4TQS A;  2VQF H;  2W57 A;  3H4B A;  4ED6 A;  4FM9 A;  4RNN A;  4UCV A;  2CKZ B;  3PR4 A;  4ED1 A;  2WE6 A;  4A3E G;  1B6R A;  1VKZ A;  4LF4 H;  5T14 A;  4J9Q A;  5C1P A;  4ETS A;  2ZDH A;  4EBC A;  2YZG A;  4EEY A;  3KXY T;  4LFC H;  3V6J A;  4ECS A;  2JA6 G;  4YR2 A;  1A0I A;  3HXL A;  2W9C B;  3R5H A;  5L1L A;  4YQW A;  4DV7 H;  2YZM A;  5KFP A;  3RB4 A;  3KHR A;  4C2M A;  4EFB A;  2J6S A;  3FKI A;  5KKN B;  1RK5 A;  4ED0 A;  2V9W A;  4I55 F;  4RAY A;  3SI8 A;  3BQ0 A;  4ECQ A;  4MV8 A;  4QWB A;  2FB9 A;  3GTQ A;  1CQI B;  1HR0 H;  3LP8 A;  2PBZ A; 
#chains in the Genus database with same CATH homology
 1OWT A;  2FKL A;  2FMA A;  2FK3 A;  2FK2 A;  3KTM A;  2FJZ A;  2FK1 A;  2M05 A;  4PWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...