2M06A

Nmr structure of ompx in phopspholipid nanodiscs
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein X
publication title Optimized phospholipid bilayer nanodiscs facilitate high-resolution structure determination of membrane proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 20
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2012-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2m06A00
3QRAA 1MM4A 2M06A 2F1TA 1MM5A 2N2LA 2M07A 2GE4A 2X27X 1Q9FA 3C5OA 3QRCA 1G90A 1Q9GA 3G7GA 3GP6A 4RLCA 2JMMA 1THQA 2K0LA 1QJ8A 2LHFA 1ORMA 2MNHA 2F1VA 1QJ9A 1QJPA 1P4TA 2ERVA 4PUXA 1BXWA 2MHLA 2N2MA
chains in the Genus database with same CATH superfamily
1OSMA 2J1NA 3PGRA 2KZ7A 2XE2A 3POQA 3SYSA 4FRTA 4G76A 4F4BA 2ZFGA 4FMSA 8PRNA 3PGUA 5G39A 1MM4A 5ADXK 1ZHWA 1MM5A 2KZ7B 5H2FO 2GE4A 3JTYA 2X27X 5ADXL 3AA1B 1GFQA 3HOEA 3AA7A 3DA3A 4O3YA 3PF1A 1OPFA 5GV0A 4N58A 2KDYA 4GCPA 2R4PA 4AYID 3AA7B 3AAAB 1ZHXA 4GHBA 3AAEA 4N59A 4N74A 1T16A 4C00A 5B5EO 2K0LA 5DL5A 3SZVA 5G38A 2F1CX 3EMNX 3HW9A 4FUVA 4QQ1A 2LFUA 5TISO 1T1LA 3PGSA 3POXA 2F1VA 4O3ZA 3T24A 1E54A 2Y7SA 4FRXA 3T20A 3AA0B 4G75A 5AFUK 2ERVA 2XE1A 2Y0LA 1BXWA 3PORA 4GCSA 3QRAA 4BUMX 5AFUL 3SYBA 4O4UA 1GFMA 2QTKA 1IZNB 3LK3A 2J4UP 3PQUA 1HXXA 4E1SA 1ZHYA 3AA1A 5EE2A 4JCHA 3VZTX 4GCQA 4AYDC 1GFPA 2XE5A 5IYUA 2PORA 3LK3B 4KRAA 1YS5A 3KVDD 2R4LA 1Q9FA 3LK42 4UB6O 3HOLA 4N75A 2XG6A 4AUIA 3VZUX 3AAAA 3WU2O 3TZGA 2R4NA 2XTRA 5DL8A 4AYNA 3G7GA 2K4TA 3BRYA 1PRNA 4PR7A 2JMMA 3UU2A 4FZLA 2LHFA 4K3BA 1ORMA 4AYEC 2X9KA 3DA4A 3DWOX 3VE1A 2WJQA 3JCUO 3AA0A 2FGRA 6PRNA 1QJ9A 2ZLDA 2O4VA 3SY9A 2WVPA 3DZMA 5KAIO 2MHLA 1IZNA 2N2MA 4FZMA 4AKRB 7PRNA 4AKMA 3BRZA 3UPGA 1BH3A 3K19A 3V8UA 4B61A 4D64A 2JQYA 4O4XA 2M06A 5GTHO 3PRNA 2M07A 3LK2B 3NSGA 4O3XB 3SY7A 1S5LO 2R89A 4UB8O 4LSIA 4RL9A 3C5OA 5B66O 1PHOA 2AXTO 3QRCA 3A2SX 4FSOA 5DL7A 2XE3A 1Q9GA 4FESA 3VY8X 4D65A 5G3AA 3UAQA 4AZLA 4RLCA 3A0HO 1THQA 2XMXA 3DWNA 4LSFA 3KZIO 4O3WA 2IWWA 2WJRA 5KAFO 5G26A 4XNKA 3WI5A 4AYMC 4E1TA 3POUA 5GTIO 4PUXA 1GFNA 4U9CA 4RLBA 1ZHTA 4Z3TA 3O0EA 3AA6B 1HXTA 1QJPA 4AKRA 3BS0A 2R4OA 3LK41 5JDPA 4KR8A 2IWVA 1GFOA 1G90A 4FZNA 3RBHA 2ODJA 5E79O 3PQSA 5PRNA 3LK2A 4KR4A 2F1TA 2N2LA 2R8AA 3T0SA 2Y0HA 2PRNA 4FSPA 2W81C 4FQEA 4JFBA 4O49A 3VE2A 4C4VA 3HWBA 2YNKA 3WI4A 1MPFA 4FT6A 3VY9X 4C69X 1ZHZA 1BT9A 4AFKA 4K3CA 2KXPA 4C4VB 3GP6A 2XTQA 4GF4A 4LSEA 4CTDA 5FVNA 4FOZA 4RJWA 2KC0A 1QJ8A 3AAEB 2KXPB 5T5FA 2R88A 2W80C 2OMFA 2FGQX 3AA6A 2MNHA 1HXUA 5DL6A 2YPVA 3NJTA 1H6S1 4PJ0O 5D5DA 4LSHA 2Y0KA 4RJXA 4XNLA 3FYXA 3SZDA 1P4TA 3VZWX 2Y2XA 4D5UA 3A0BO 4IL6O
chains in the Genus database with same CATH topology
1OSMA 2J1NA 3POQA 2KZ7A 2XE2A 3SYSA 4F4BA 4FRTA 4G76A 8PRNA 2ZFGA 4FMSA 1MM4A 5ADXK 1ZHWA 1MM5A 2KZ7B 2GE4A 3JTYA 2X27X 5ADXL 3AA1B 1GFQA 3HOEA 3AA7A 3DA3A 4O3YA 5GV0A 1OPFA 4N58A 2KDYA 4GCPA 4AYID 3AA7B 3AAAB 1ZHXA 4GHBA 3AAEA 4N59A 2K0LA 5DL5A 3SZVA 3EMNX 3HW9A 4FUVA 4QQ1A 2LFUA 3POXA 4O3ZA 2F1VA 3T24A 1E54A 2Y7SA 4FRXA 3T20A 3AA0B 4G75A 5AFUK 2XE1A 2ERVA 2Y0LA 1BXWA 3PORA 4GCSA 3QRAA 4BUMX 5AFUL 3SYBA 4O4UA 1GFMA 2QTKA 1IZNB 3LK3A 2J4UP 3PQUA 1HXXA 4E1SA 1ZHYA 3AA1A 5EE2A 4JCHA 3VZTX 4GCQA 4AYDC 1GFPA 2XE5A 5IYUA 2PORA 3LK3B 4KRAA 1YS5A 3KVDD 3LK42 1Q9FA 2XG6A 4AUIA 3VZUX 3AAAA 3TZGA 2XTRA 5DL8A 4AYNA 3G7GA 2K4TA 1PRNA 2JMMA 3UU2A 4FZLA 2LHFA 1ORMA 4AYEC 3DA4A 3VE1A 3AA0A 2FGRA 6PRNA 1QJ9A 2ZLDA 2O4VA 3SY9A 2MHLA 1IZNA 2N2MA 4FZMA 4AKRB 7PRNA 4AKMA 3UPGA 1BH3A 3K19A 3V8UA 4B61A 4D64A 4O4XA 2M06A 3PRNA 2M07A 3LK2B 3NSGA 4O3XB 3SY7A 4LSIA 4RL9A 3C5OA 1PHOA 3QRCA 3A2SX 4FSOA 5DL7A 2XE3A 1Q9GA 4FESA 3VY8X 4D65A 3UAQA 4AZLA 4RLCA 4LSFA 1THQA 2XMXA 4O3WA 5G26A 4XNKA 3WI5A 4AYMC 4E1TA 3POUA 4PUXA 1GFNA 4U9CA 4RLBA 1ZHTA 4Z3TA 3O0EA 3AA6B 1HXTA 1QJPA 4AKRA 3LK41 5JDPA 4KR8A 1GFOA 1G90A 4FZNA 3RBHA 2ODJA 5PRNA 3PQSA 3LK2A 4KR4A 2F1TA 2N2LA 3T0SA 2Y0HA 2PRNA 4FSPA 2W81C 4JFBA 4O49A 3VE2A 3HWBA 2YNKA 3WI4A 1MPFA 4FT6A 3VY9X 4C69X 1ZHZA 1BT9A 4AFKA 2KXPA 3GP6A 2XTQA 4GF4A 4LSEA 5FVNA 4FOZA 4RJWA 2KC0A 1QJ8A 3AAEB 2KXPB 5T5FA 2W80C 2OMFA 2FGQX 3AA6A 2MNHA 1HXUA 5DL6A 2YPVA 1H6S1 5D5DA 4LSHA 2Y0KA 4RJXA 4XNLA 3FYXA 3SZDA 1P4TA 3VZWX 2Y2XA 4D5UA 3HOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRA A;  1MM4 A;  2M06 A;  2F1T A;  1MM5 A;  2N2L A;  2M07 A;  2GE4 A;  2X27 X;  1Q9F A;  3C5O A;  3QRC A;  1G90 A;  1Q9G A;  3G7G A;  3GP6 A;  4RLC A;  2JMM A;  1THQ A;  2K0L A;  1QJ8 A;  2LHF A;  1ORM A;  2MNH A;  2F1V A;  1QJ9 A;  1QJP A;  1P4T A;  2ERV A;  4PUX A;  1BXW A;  2MHL A;  2N2M A; 
#chains in the Genus database with same CATH topology
 1OSM A;  2J1N A;  3PGR A;  2KZ7 A;  2XE2 A;  3POQ A;  3SYS A;  4FRT A;  4G76 A;  4F4B A;  2ZFG A;  4FMS A;  8PRN A;  3PGU A;  5G39 A;  1MM4 A;  5ADX K;  1ZHW A;  1MM5 A;  2KZ7 B;  5H2F O;  2GE4 A;  3JTY A;  2X27 X;  5ADX L;  3AA1 B;  1GFQ A;  3HOE A;  3AA7 A;  3DA3 A;  4O3Y A;  3PF1 A;  1OPF A;  5GV0 A;  4N58 A;  2KDY A;  4GCP A;  2R4P A;  4AYI D;  3AA7 B;  3AAA B;  1ZHX A;  4GHB A;  3AAE A;  4N59 A;  4N74 A;  1T16 A;  4C00 A;  5B5E O;  2K0L A;  5DL5 A;  3SZV A;  5G38 A;  2F1C X;  3EMN X;  3HW9 A;  4FUV A;  4QQ1 A;  2LFU A;  5TIS O;  1T1L A;  3PGS A;  3POX A;  2F1V A;  4O3Z A;  3T24 A;  1E54 A;  2Y7S A;  4FRX A;  3T20 A;  3AA0 B;  4G75 A;  5AFU K;  2ERV A;  2XE1 A;  2Y0L A;  1BXW A;  3POR A;  4GCS A;  3QRA A;  4BUM X;  5AFU L;  3SYB A;  4O4U A;  1GFM A;  2QTK A;  1IZN B;  3LK3 A;  2J4U P;  3PQU A;  1HXX A;  4E1S A;  1ZHY A;  3AA1 A;  5EE2 A;  4JCH A;  3VZT X;  4GCQ A;  4AYD C;  1GFP A;  2XE5 A;  5IYU A;  2POR A;  3LK3 B;  4KRA A;  1YS5 A;  3KVD D;  2R4L A;  1Q9F A;  3LK4 2;  4UB6 O;  3HOL A;  4N75 A;  2XG6 A;  4AUI A;  3VZU X;  3AAA A;  3WU2 O;  3TZG A;  2R4N A;  2XTR A;  5DL8 A;  4AYN A;  3G7G A;  2K4T A;  3BRY A;  1PRN A;  4PR7 A;  2JMM A;  3UU2 A;  4FZL A;  2LHF A;  4K3B A;  1ORM A;  4AYE C;  2X9K A;  3DA4 A;  3DWO X;  3VE1 A;  2WJQ A;  3JCU O;  3AA0 A;  2FGR A;  6PRN A;  1QJ9 A;  2ZLD A;  2O4V A;  3SY9 A;  2WVP A;  3DZM A;  5KAI O;  2MHL A;  1IZN A;  2N2M A;  4FZM A;  4AKR B;  7PRN A;  4AKM A;  3BRZ A;  3UPG A;  1BH3 A;  3K19 A;  3V8U A;  4B61 A;  4D64 A;  2JQY A;  4O4X A;  2M06 A;  5GTH O;  3PRN A;  2M07 A;  3LK2 B;  3NSG A;  4O3X B;  3SY7 A;  1S5L O;  2R89 A;  4UB8 O;  4LSI A;  4RL9 A;  3C5O A;  5B66 O;  1PHO A;  2AXT O;  3QRC A;  3A2S X;  4FSO A;  5DL7 A;  2XE3 A;  1Q9G A;  4FES A;  3VY8 X;  4D65 A;  5G3A A;  3UAQ A;  4AZL A;  4RLC A;  3A0H O;  1THQ A;  2XMX A;  3DWN A;  4LSF A;  3KZI O;  4O3W A;  2IWW A;  2WJR A;  5KAF O;  5G26 A;  4XNK A;  3WI5 A;  4AYM C;  4E1T A;  3POU A;  5GTI O;  4PUX A;  1GFN A;  4U9C A;  4RLB A;  1ZHT A;  4Z3T A;  3O0E A;  3AA6 B;  1HXT A;  1QJP A;  4AKR A;  3BS0 A;  2R4O A;  3LK4 1;  5JDP A;  4KR8 A;  2IWV A;  1GFO A;  1G90 A;  4FZN A;  3RBH A;  2ODJ A;  5E79 O;  3PQS A;  5PRN A;  3LK2 A;  4KR4 A;  2F1T A;  2N2L A;  2R8A A;  3T0S A;  2Y0H A;  2PRN A;  4FSP A;  2W81 C;  4FQE A;  4JFB A;  4O49 A;  3VE2 A;  4C4V A;  3HWB A;  2YNK A;  3WI4 A;  1MPF A;  4FT6 A;  3VY9 X;  4C69 X;  1ZHZ A;  1BT9 A;  4AFK A;  4K3C A;  2KXP A;  4C4V B;  3GP6 A;  2XTQ A;  4GF4 A;  4LSE A;  4CTD A;  5FVN A;  4FOZ A;  4RJW A;  2KC0 A;  1QJ8 A;  3AAE B;  2KXP B;  5T5F A;  2R88 A;  2W80 C;  2OMF A;  2FGQ X;  3AA6 A;  2MNH A;  1HXU A;  5DL6 A;  2YPV A;  3NJT A;  1H6S 1;  4PJ0 O;  5D5D A;  4LSH A;  2Y0K A;  4RJX A;  4XNL A;  3FYX A;  3SZD A;  1P4T A;  3VZW X;  2Y2X A;  4D5U A;  3A0B O;  4IL6 O; 
#chains in the Genus database with same CATH homology
 1OSM A;  2J1N A;  3POQ A;  2KZ7 A;  2XE2 A;  3SYS A;  4F4B A;  4FRT A;  4G76 A;  8PRN A;  2ZFG A;  4FMS A;  1MM4 A;  5ADX K;  1ZHW A;  1MM5 A;  2KZ7 B;  2GE4 A;  3JTY A;  2X27 X;  5ADX L;  3AA1 B;  1GFQ A;  3HOE A;  3AA7 A;  3DA3 A;  4O3Y A;  5GV0 A;  1OPF A;  4N58 A;  2KDY A;  4GCP A;  4AYI D;  3AA7 B;  3AAA B;  1ZHX A;  4GHB A;  3AAE A;  4N59 A;  2K0L A;  5DL5 A;  3SZV A;  3EMN X;  3HW9 A;  4FUV A;  4QQ1 A;  2LFU A;  3POX A;  4O3Z A;  2F1V A;  3T24 A;  1E54 A;  2Y7S A;  4FRX A;  3T20 A;  3AA0 B;  4G75 A;  5AFU K;  2XE1 A;  2ERV A;  2Y0L A;  1BXW A;  3POR A;  4GCS A;  3QRA A;  4BUM X;  5AFU L;  3SYB A;  4O4U A;  1GFM A;  2QTK A;  1IZN B;  3LK3 A;  2J4U P;  3PQU A;  1HXX A;  4E1S A;  1ZHY A;  3AA1 A;  5EE2 A;  4JCH A;  3VZT X;  4GCQ A;  4AYD C;  1GFP A;  2XE5 A;  5IYU A;  2POR A;  3LK3 B;  4KRA A;  1YS5 A;  3KVD D;  3LK4 2;  1Q9F A;  2XG6 A;  4AUI A;  3VZU X;  3AAA A;  3TZG A;  2XTR A;  5DL8 A;  4AYN A;  3G7G A;  2K4T A;  1PRN A;  2JMM A;  3UU2 A;  4FZL A;  2LHF A;  1ORM A;  4AYE C;  3DA4 A;  3VE1 A;  3AA0 A;  2FGR A;  6PRN A;  1QJ9 A;  2ZLD A;  2O4V A;  3SY9 A;  2MHL A;  1IZN A;  2N2M A;  4FZM A;  4AKR B;  7PRN A;  4AKM A;  3UPG A;  1BH3 A;  3K19 A;  3V8U A;  4B61 A;  4D64 A;  4O4X A;  2M06 A;  3PRN A;  2M07 A;  3LK2 B;  3NSG A;  4O3X B;  3SY7 A;  4LSI A;  4RL9 A;  3C5O A;  1PHO A;  3QRC A;  3A2S X;  4FSO A;  5DL7 A;  2XE3 A;  1Q9G A;  4FES A;  3VY8 X;  4D65 A;  3UAQ A;  4AZL A;  4RLC A;  4LSF A;  1THQ A;  2XMX A;  4O3W A;  5G26 A;  4XNK A;  3WI5 A;  4AYM C;  4E1T A;  3POU A;  4PUX A;  1GFN A;  4U9C A;  4RLB A;  1ZHT A;  4Z3T A;  3O0E A;  3AA6 B;  1HXT A;  1QJP A;  4AKR A;  3LK4 1;  5JDP A;  4KR8 A;  1GFO A;  1G90 A;  4FZN A;  3RBH A;  2ODJ A;  5PRN A;  3PQS A;  3LK2 A;  4KR4 A;  2F1T A;  2N2L A;  3T0S A;  2Y0H A;  2PRN A;  4FSP A;  2W81 C;  4JFB A;  4O49 A;  3VE2 A;  3HWB A;  2YNK A;  3WI4 A;  1MPF A;  4FT6 A;  3VY9 X;  4C69 X;  1ZHZ A;  1BT9 A;  4AFK A;  2KXP A;  3GP6 A;  2XTQ A;  4GF4 A;  4LSE A;  5FVN A;  4FOZ A;  4RJW A;  2KC0 A;  1QJ8 A;  3AAE B;  2KXP B;  5T5F A;  2W80 C;  2OMF A;  2FGQ X;  3AA6 A;  2MNH A;  1HXU A;  5DL6 A;  2YPV A;  1H6S 1;  5D5D A;  4LSH A;  2Y0K A;  4RJX A;  4XNL A;  3FYX A;  3SZD A;  1P4T A;  3VZW X;  2Y2X A;  4D5U A;  3HOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...