2M06A

Nmr structure of ompx in phopspholipid nanodiscs
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
148
structure length
148
Chain Sequence
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimized phospholipid bilayer nanodiscs facilitate high-resolution structure determination of membrane proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Outer membrane protein X
total genus 20
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2012-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 2m06A00
2N2LA 2M07A 1Q9GA 2ERVA 4RLCA 3GP6A 2MNHA 3C5OA 1MM5A 2F1VA 3QRAA 2JMMA 2M06A 1QJPA 3QRCA 1BXWA 1THQA 3G7GA 1MM4A 2F1TA 1QJ9A 1QJ8A 2N2MA 2LHFA 2MHLA 1G90A 1P4TA 2K0LA 2GE4A 1ORMA 4PUXA 2X27X 1Q9FA
chains in the Genus database with same CATH superfamily
1BH3A 1GFQA 2M07A 3VZWX 2Y2XA 4F4BA 3V8UA 1ZHWA 4AUIA 4LSEA 4K3BA 3LK3B 4FZNA 3K19A 4CTDA 4O3WA 2PRNA 2X9KA 4IL6O 5T5FA 4AKMA 5DL8A 5JDPA 2QTKA 1GFOA 4E1TA 2JMMA 2M06A 2XTRA 3JTYA 1H6S1 2YNKA 2WJQA 1ZHTA 3LK41 3QRCA 4AKRB 4FT6A 2W81C 3AA6B 3HOLA 5DL5A 5G26A 4C69X 3AAAA 4AFKA 5KAIO 2F1TA 3POXA 1QJ9A 2AXTO 2XE2A 3VZTX 2O4VA 2KXPB 1IZNB 3AAEA 3TZGA 5ADXK 5AFUL 2Y0LA 2Y7SA 5TISO 3PGSA 4O3YA 1HXUA 2K0LA 5DL7A 1GFMA 7PRNA 4C00A 1ORMA 3POUA 1YS5A 3PQUA 3KZIO 4GHBA 4PUXA 3SZVA 3SYSA 3UAQA 2XE5A 3PORA 3VY8X 3AA7A 5AFUK 2N2LA 4O49A 4D65A 3AA1A 5ADXL 2ZFGA 3FYXA 3HOEA 4FZLA 5PRNA 4RLCA 3BRYA 2OMFA 2LFUA 3GP6A 5H2FO 4FRXA 4G76A 1OSMA 5D5DA 8PRNA 3SYBA 3C5OA 4FOZA 4RJWA 3SY9A 3HWBA 1GFPA 4KR4A 2F1VA 2R8AA 5DL6A 5B5EO 1QJPA 4FESA 3PF1A 4FRTA 4KRAA 1BXWA 1THQA 4LSHA 1MPFA 4O3ZA 4PJ0O 3AAEB 4GCSA 4AKRA 4JCHA 3WU2O 2ZLDA 4C4VA 2KZ7A 3DWNA 4XNLA 2N2MA 1ZHYA 2MHLA 3NSGA 3PQSA 4N58A 1HXXA 4RL9A 2XTQA 3VE2A 5GTHO 1G90A 2GE4A 2PORA 2XE3A 3LK3A 1E54A 3LK2B 1Q9FA 3BS0A 2XE1A 3AA0A 3KVDD 4FSPA 4RLBA 3SY7A 3T0SA 4GCQA 5EE2A 4AYDC 4AYID 4O4UA 2YPVA 4Z3TA 4UB6O 3RBHA 2JQYA 3AA7B 2IWWA 2ERVA 4N74A 3AA1B 4O3XB 6PRNA 5G3AA 2KDYA 1GFNA 2MNHA 3POQA 4LSIA 2W80C 3PGRA 4XNKA 4G75A 3LK2A 4C4VB 2Y0KA 3T20A 2KZ7B 3JCUO 3VE1A 3HW9A 3VZUX 3G7GA 4AYMC 3UU2A 4AZLA 1S5LO 1T16A 1T1LA 2XG6A 2J4UP 4KR8A 3WI5A 3DWOX 1QJ8A 3SZDA 3AA6A 2R89A 5G38A 5GTIO 1P4TA 2Y0HA 1OPFA 2R4OA 1BT9A 4PR7A 2FGQX 3A0HO 4FMSA 4FQEA 2R4PA 1PHOA 5FVNA 4FSOA 4UB8O 1ZHZA 1PRNA 3UPGA 4LSFA 2R88A 3PRNA 4QQ1A 1Q9GA 2KC0A 4E1SA 2R4LA 3O0EA 2XMXA 4GF4A 4AYEC 4U9CA 3LK42 4O4XA 3WI4A 5E79O 4AYNA 4GCPA 1IZNA 1MM5A 1ZHXA 2J1NA 3AA0B 3QRAA 3EMNX 4JFBA 4N75A 4BUMX 2R4NA 3T24A 4RJXA 3AAAB 3DA3A 3DA4A 1HXTA 2K4TA 1MM4A 4D5UA 3A2SX 3A0BO 3BRZA 4B61A 2KXPA 3PGUA 2ODJA 3DZMA 4K3CA 2F1CX 2FGRA 5GV0A 4FZMA 4FUVA 5IYUA 5B66O 2LHFA 5KAFO 4D64A 2WVPA 3NJTA 2IWVA 2WJRA 2X27X 5G39A 4N59A 3VY9X
chains in the Genus database with same CATH topology
1BH3A 1GFQA 2M07A 3VZWX 2Y2XA 4F4BA 3V8UA 1ZHWA 4AUIA 4LSEA 3LK3B 4FZNA 3K19A 4O3WA 2PRNA 5T5FA 4AKMA 5DL8A 5JDPA 2QTKA 1GFOA 4E1TA 2JMMA 2M06A 2XTRA 3JTYA 1H6S1 2YNKA 3LK41 1ZHTA 3QRCA 4AKRB 4FT6A 2W81C 3AA6B 3HOLA 5DL5A 5G26A 4C69X 3AAAA 4AFKA 2F1TA 3POXA 1QJ9A 5ADXK 2XE2A 3VZTX 2O4VA 2KXPB 1IZNB 3AAEA 3TZGA 5AFUL 2Y0LA 2Y7SA 4O3YA 5DL7A 1HXUA 2K0LA 7PRNA 1GFMA 1ORMA 3POUA 1YS5A 3PQUA 4GHBA 4PUXA 3SYSA 3SZVA 3UAQA 3VY8X 2XE5A 3PORA 3AA7A 5AFUK 2N2LA 4O49A 3AA1A 5ADXL 2ZFGA 3FYXA 3HOEA 4FZLA 5PRNA 4RLCA 2OMFA 2LFUA 3GP6A 4FRXA 4G76A 1OSMA 5D5DA 8PRNA 3SYBA 3C5OA 4FOZA 4RJWA 3SY9A 3HWBA 1GFPA 4KR4A 2F1VA 5DL6A 1QJPA 4FESA 4KRAA 4FRTA 4LSHA 1BXWA 1THQA 4O3ZA 1MPFA 3VZUX 3AAEB 4GCSA 4AKRA 4JCHA 2ZLDA 2KZ7A 4XNLA 2N2MA 1ZHYA 2MHLA 3NSGA 3PQSA 4N58A 1HXXA 4RL9A 2XTQA 3VE2A 1G90A 2GE4A 2PORA 2XE3A 3LK3A 1E54A 3LK2B 1Q9FA 4FSPA 2XE1A 3AA0A 3KVDD 4RLBA 3T0SA 3SY7A 4AYDC 4GCQA 5EE2A 4Z3TA 4AYID 4O4UA 2YPVA 3RBHA 3AA7B 2ERVA 4O3XB 3AA1B 6PRNA 2KDYA 1GFNA 2MNHA 3POQA 4LSIA 2W80C 4XNKA 4G75A 3LK2A 2Y0KA 3T20A 2KZ7B 3VE1A 3HW9A 3G7GA 4AYMC 3UU2A 4AZLA 2XG6A 2J4UP 4KR8A 3WI5A 1QJ8A 3SZDA 3AA6A 1P4TA 2Y0HA 1OPFA 1BT9A 2FGQX 4FMSA 1PHOA 5FVNA 4FSOA 1ZHZA 1PRNA 3UPGA 4LSFA 4QQ1A 3PRNA 1Q9GA 2KC0A 4E1SA 3O0EA 2XMXA 4GF4A 4AYEC 4U9CA 3LK42 4O4XA 3WI4A 4AYNA 4D65A 4GCPA 1IZNA 1MM5A 1ZHXA 2J1NA 3AA0B 3QRAA 3EMNX 4JFBA 4BUMX 3T24A 4RJXA 3AAAB 3DA3A 3DA4A 1HXTA 2K4TA 1MM4A 4D5UA 3A2SX 4B61A 2KXPA 2ODJA 2FGRA 5GV0A 4FZMA 4FUVA 5IYUA 2LHFA 4D64A 2X27X 4N59A 3VY9X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N2L A;  2M07 A;  1Q9G A;  2ERV A;  4RLC A;  3GP6 A;  2MNH A;  3C5O A;  1MM5 A;  2F1V A;  3QRA A;  2JMM A;  2M06 A;  1QJP A;  3QRC A;  1BXW A;  1THQ A;  3G7G A;  1MM4 A;  2F1T A;  1QJ9 A;  1QJ8 A;  2N2M A;  2LHF A;  2MHL A;  1G90 A;  1P4T A;  2K0L A;  2GE4 A;  1ORM A;  4PUX A;  2X27 X;  1Q9F A; 
#chains in the Genus database with same CATH topology
 1BH3 A;  1GFQ A;  2M07 A;  3VZW X;  2Y2X A;  4F4B A;  3V8U A;  1ZHW A;  4AUI A;  4LSE A;  4K3B A;  3LK3 B;  4FZN A;  3K19 A;  4CTD A;  4O3W A;  2PRN A;  2X9K A;  4IL6 O;  5T5F A;  4AKM A;  5DL8 A;  5JDP A;  2QTK A;  1GFO A;  4E1T A;  2JMM A;  2M06 A;  2XTR A;  3JTY A;  1H6S 1;  2YNK A;  2WJQ A;  1ZHT A;  3LK4 1;  3QRC A;  4AKR B;  4FT6 A;  2W81 C;  3AA6 B;  3HOL A;  5DL5 A;  5G26 A;  4C69 X;  3AAA A;  4AFK A;  5KAI O;  2F1T A;  3POX A;  1QJ9 A;  2AXT O;  2XE2 A;  3VZT X;  2O4V A;  2KXP B;  1IZN B;  3AAE A;  3TZG A;  5ADX K;  5AFU L;  2Y0L A;  2Y7S A;  5TIS O;  3PGS A;  4O3Y A;  1HXU A;  2K0L A;  5DL7 A;  1GFM A;  7PRN A;  4C00 A;  1ORM A;  3POU A;  1YS5 A;  3PQU A;  3KZI O;  4GHB A;  4PUX A;  3SZV A;  3SYS A;  3UAQ A;  2XE5 A;  3POR A;  3VY8 X;  3AA7 A;  5AFU K;  2N2L A;  4O49 A;  4D65 A;  3AA1 A;  5ADX L;  2ZFG A;  3FYX A;  3HOE A;  4FZL A;  5PRN A;  4RLC A;  3BRY A;  2OMF A;  2LFU A;  3GP6 A;  5H2F O;  4FRX A;  4G76 A;  1OSM A;  5D5D A;  8PRN A;  3SYB A;  3C5O A;  4FOZ A;  4RJW A;  3SY9 A;  3HWB A;  1GFP A;  4KR4 A;  2F1V A;  2R8A A;  5DL6 A;  5B5E O;  1QJP A;  4FES A;  3PF1 A;  4FRT A;  4KRA A;  1BXW A;  1THQ A;  4LSH A;  1MPF A;  4O3Z A;  4PJ0 O;  3AAE B;  4GCS A;  4AKR A;  4JCH A;  3WU2 O;  2ZLD A;  4C4V A;  2KZ7 A;  3DWN A;  4XNL A;  2N2M A;  1ZHY A;  2MHL A;  3NSG A;  3PQS A;  4N58 A;  1HXX A;  4RL9 A;  2XTQ A;  3VE2 A;  5GTH O;  1G90 A;  2GE4 A;  2POR A;  2XE3 A;  3LK3 A;  1E54 A;  3LK2 B;  1Q9F A;  3BS0 A;  2XE1 A;  3AA0 A;  3KVD D;  4FSP A;  4RLB A;  3SY7 A;  3T0S A;  4GCQ A;  5EE2 A;  4AYD C;  4AYI D;  4O4U A;  2YPV A;  4Z3T A;  4UB6 O;  3RBH A;  2JQY A;  3AA7 B;  2IWW A;  2ERV A;  4N74 A;  3AA1 B;  4O3X B;  6PRN A;  5G3A A;  2KDY A;  1GFN A;  2MNH A;  3POQ A;  4LSI A;  2W80 C;  3PGR A;  4XNK A;  4G75 A;  3LK2 A;  4C4V B;  2Y0K A;  3T20 A;  2KZ7 B;  3JCU O;  3VE1 A;  3HW9 A;  3VZU X;  3G7G A;  4AYM C;  3UU2 A;  4AZL A;  1S5L O;  1T16 A;  1T1L A;  2XG6 A;  2J4U P;  4KR8 A;  3WI5 A;  3DWO X;  1QJ8 A;  3SZD A;  3AA6 A;  2R89 A;  5G38 A;  5GTI O;  1P4T A;  2Y0H A;  1OPF A;  2R4O A;  1BT9 A;  4PR7 A;  2FGQ X;  3A0H O;  4FMS A;  4FQE A;  2R4P A;  1PHO A;  5FVN A;  4FSO A;  4UB8 O;  1ZHZ A;  1PRN A;  3UPG A;  4LSF A;  2R88 A;  3PRN A;  4QQ1 A;  1Q9G A;  2KC0 A;  4E1S A;  2R4L A;  3O0E A;  2XMX A;  4GF4 A;  4AYE C;  4U9C A;  3LK4 2;  4O4X A;  3WI4 A;  5E79 O;  4AYN A;  4GCP A;  1IZN A;  1MM5 A;  1ZHX A;  2J1N A;  3AA0 B;  3QRA A;  3EMN X;  4JFB A;  4N75 A;  4BUM X;  2R4N A;  3T24 A;  4RJX A;  3AAA B;  3DA3 A;  3DA4 A;  1HXT A;  2K4T A;  1MM4 A;  4D5U A;  3A2S X;  3A0B O;  3BRZ A;  4B61 A;  2KXP A;  3PGU A;  2ODJ A;  3DZM A;  4K3C A;  2F1C X;  2FGR A;  5GV0 A;  4FZM A;  4FUV A;  5IYU A;  5B66 O;  2LHF A;  5KAF O;  4D64 A;  2WVP A;  3NJT A;  2IWV A;  2WJR A;  2X27 X;  5G39 A;  4N59 A;  3VY9 X; 
#chains in the Genus database with same CATH homology
 1BH3 A;  1GFQ A;  2M07 A;  3VZW X;  2Y2X A;  4F4B A;  3V8U A;  1ZHW A;  4AUI A;  4LSE A;  3LK3 B;  4FZN A;  3K19 A;  4O3W A;  2PRN A;  5T5F A;  4AKM A;  5DL8 A;  5JDP A;  2QTK A;  1GFO A;  4E1T A;  2JMM A;  2M06 A;  2XTR A;  3JTY A;  1H6S 1;  2YNK A;  3LK4 1;  1ZHT A;  3QRC A;  4AKR B;  4FT6 A;  2W81 C;  3AA6 B;  3HOL A;  5DL5 A;  5G26 A;  4C69 X;  3AAA A;  4AFK A;  2F1T A;  3POX A;  1QJ9 A;  5ADX K;  2XE2 A;  3VZT X;  2O4V A;  2KXP B;  1IZN B;  3AAE A;  3TZG A;  5AFU L;  2Y0L A;  2Y7S A;  4O3Y A;  5DL7 A;  1HXU A;  2K0L A;  7PRN A;  1GFM A;  1ORM A;  3POU A;  1YS5 A;  3PQU A;  4GHB A;  4PUX A;  3SYS A;  3SZV A;  3UAQ A;  3VY8 X;  2XE5 A;  3POR A;  3AA7 A;  5AFU K;  2N2L A;  4O49 A;  3AA1 A;  5ADX L;  2ZFG A;  3FYX A;  3HOE A;  4FZL A;  5PRN A;  4RLC A;  2OMF A;  2LFU A;  3GP6 A;  4FRX A;  4G76 A;  1OSM A;  5D5D A;  8PRN A;  3SYB A;  3C5O A;  4FOZ A;  4RJW A;  3SY9 A;  3HWB A;  1GFP A;  4KR4 A;  2F1V A;  5DL6 A;  1QJP A;  4FES A;  4KRA A;  4FRT A;  4LSH A;  1BXW A;  1THQ A;  4O3Z A;  1MPF A;  3VZU X;  3AAE B;  4GCS A;  4AKR A;  4JCH A;  2ZLD A;  2KZ7 A;  4XNL A;  2N2M A;  1ZHY A;  2MHL A;  3NSG A;  3PQS A;  4N58 A;  1HXX A;  4RL9 A;  2XTQ A;  3VE2 A;  1G90 A;  2GE4 A;  2POR A;  2XE3 A;  3LK3 A;  1E54 A;  3LK2 B;  1Q9F A;  4FSP A;  2XE1 A;  3AA0 A;  3KVD D;  4RLB A;  3T0S A;  3SY7 A;  4AYD C;  4GCQ A;  5EE2 A;  4Z3T A;  4AYI D;  4O4U A;  2YPV A;  3RBH A;  3AA7 B;  2ERV A;  4O3X B;  3AA1 B;  6PRN A;  2KDY A;  1GFN A;  2MNH A;  3POQ A;  4LSI A;  2W80 C;  4XNK A;  4G75 A;  3LK2 A;  2Y0K A;  3T20 A;  2KZ7 B;  3VE1 A;  3HW9 A;  3G7G A;  4AYM C;  3UU2 A;  4AZL A;  2XG6 A;  2J4U P;  4KR8 A;  3WI5 A;  1QJ8 A;  3SZD A;  3AA6 A;  1P4T A;  2Y0H A;  1OPF A;  1BT9 A;  2FGQ X;  4FMS A;  1PHO A;  5FVN A;  4FSO A;  1ZHZ A;  1PRN A;  3UPG A;  4LSF A;  4QQ1 A;  3PRN A;  1Q9G A;  2KC0 A;  4E1S A;  3O0E A;  2XMX A;  4GF4 A;  4AYE C;  4U9C A;  3LK4 2;  4O4X A;  3WI4 A;  4AYN A;  4D65 A;  4GCP A;  1IZN A;  1MM5 A;  1ZHX A;  2J1N A;  3AA0 B;  3QRA A;  3EMN X;  4JFB A;  4BUM X;  3T24 A;  4RJX A;  3AAA B;  3DA3 A;  3DA4 A;  1HXT A;  2K4T A;  1MM4 A;  4D5U A;  3A2S X;  4B61 A;  2KXP A;  2ODJ A;  2FGR A;  5GV0 A;  4FZM A;  4FUV A;  5IYU A;  2LHF A;  4D64 A;  2X27 X;  4N59 A;  3VY9 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...