2M08A

The solution structure of nmpin, the parvuline of nitrosopumilus maritimus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
b'GPSNKIKCSHILVSKQSEALAIMEKLKSGEKFGKLAKELSIDSGSAKKNGNLGYFTKGMMVKPFEDAAFKLQVGEVSEPIKSEFGYHIIKRFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PpiC-type peptidyl-prolyl cis-trans isomerase
publication title NmPin from the marine thaumarchaeote Nitrosopumilus maritimus is an active membrane associated prolyl isomerase.
pubmed doi rcsb
source organism Nitrosopumilus maritimus
molecule tags Isomerase
total genus 14
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2012-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2m08A00
4JFMA 5HW8A 2MLXA 3NI6A 2RURA 4NNRA 2KR7A 5HKGA 1F8AB 4ODNA 5HTGA 3GPKA 2JZVA 3IKGA 1FKHA 4DZ2A 4FAPA 3UQBA 1F40A 2PV1A 1FKTA 2LGOA 3UF8A 3NTPA 4LAVA 3RFWA 1JNSA 2XP9A 4DRKA 1EQ3A 3IK8A 4W9PA 4BF8A 2LKNA 5GPGA 1YATA 2D9FA 5D75A 3TC5A 3WH0A 1D7HA 1FKRA 4MGVA 1PINA 1J4IA 3UI5A 1D7IA 3UQAA 3O5PA 3JYMA 2F4EA 2RSEA 3CGNA 4ODKA 1Q1CA 5HWBA 4ODPA 1A7XA 2M1IA 1JVWA 4TYOA 2FKEA 4ODOA 4R0XA 2KFWA 2PBCA 3KACA 4LAXA 2UZ5A 2XPAA 2L2SA 1FKLA 2VCDA 4QIBA 4IQCA 1T11A 1FD9A 3O5GA 5BXJA 4U84A 1Q6UA 2FAPA 4W9OA 3O5JA 3VAWA 3OOBA 4DRPA 1FKFA 1FKKA 1YW5A 4W9QA 1Y0OA 2MLYA 3IKDA 4G50A 3O5FA 4U85A 2LPVA 3TCZA 4C02B 4DRMA 4DIPA 4DROA 4DRNA 1U79A 5HUAA 1L1PA 1JNTA 4LAYA 2KGJA 4U86A 2XP4A 1Q6HA 1BL4A 2KO7A 2XP5A 2ZR4A 1J6YA 2LJ4A 3H9RB 1KT0A 5HWCA 3O5KA 4JFLA 5HT1A 3PRBA 4QT2A 2DG9A 2VN1A 1J4RA 2ZR5A 3LUOA 3ODKA 3KAFA 1D6OA 3O5LA 3O5QA 4J4NA 4JFKA 2ZR6A 4ODLA 4TNSA 4ITZA 1QPLA 3O5IA 1D7JA 2Y78A 4LAWA 1N1AA 4J4OA 2ITKA 4IQ2A 5B8IC 5I98A 1EYMA 3UI6A 4DT4A 4TW7A 3EY6A 4ODMA 3JXVA 2Q5AA 2DG4A 3TDBA 4DH0A 2ZQSA 3O5DA 4IPXA 3KCEA 2PV2A 4MSPA 2IF4A 4O2TA 4N19A 1ROTA 4JYSA 4TW8A 5DIVA 3KADA 2RUDA 2XP8A 1ZCNA 2PPPA 3KABA 2XP3A 3KAHA 3O5EA 4JFIA 5HW7A 2RUQA 1QZ2A 2PPNA 1QPFA 1ROUA 3B7XA 1KT1A 1PBKA 1W26A 3IHZA 3KZ7A 4GGQA 3O5MA 4TW6A 1J4HA 2MNTA 2XPBA 3RGCA 1M5YA 1FKJA 2ZQTA 2PV3A 3CGMA 3JYJA 3UI4A 2XP7A 2PPOA 5DIUA 5DITA 4DRJA 3PA7A 2F2DA 1B6CA 5J6EA 3O5RA 2K8IA 2MLZA 3NRKA 2ZQUA 1R9HA 4GIVA 4JFJA 4ODRA 4QT3A 1P5QA 1NSGA 2F21A 1FAPA 4DRIA 2MF9A 2XP6A 4DRQA 5HW6A 4DRHA 1FKGA 4TX0A 3PRDA 2KI3A 4G2PA 3KAGA 1FKSA 2ZQVA 1TCOC 1ZK6A 2MPHA 1FKBA 4FN2A 1NMWA 3KAIA 3FAPA 3MDYB 3O5OA 3UQIA 1FKIA 1C9HA 2N87A 2M08A 2RQSA 1FJDA 1FKDA 1BKFA 2AWGA 3I6CA 2RUCA 1Q6IA 2OFNA 2DG3A 2M2AA 1NMVA 4ODQA 1HXVA 4DZ3A 2KE0A
chains in the Genus database with same CATH superfamily
1EHNA 3RMEA 2MLXA 4MPKA 1FFQA 2B31A 2KR7A 2A3EA 5HKGA 4AY1A 4DZ2A 1F40A 3AQUA 4R5EA 3UF8A 3RFWA 2XP9A 4W9PA 2LKNA 1YATA 1NWUA 1ITXA 1ZL1A 4XAKA 2FDMA 1D7IA 1GRJA 1WB0A 1Q1CA 3B9EA 1A7XA 2AOSA 1EDQA 4TYOA 1W1YA 2FKEA 2DT1A 2UZ5A 1NWRA 1HKJA 4QIBA 4IQCA 1FD9A 3WD4A 4U84A 3OA5A 4W9OA 4WKAA 3CZ8A 1YW5A 1OGBA 1UR8A 4L3NA 1JNTA 1Q6HA 1K9TA 1WNOA 4ZPWR 2PI6A 2DG9A 2ZR5A 4J4NA 3O5QA 4TNSA 4Z2GA 1QPLA 4KQZA 1O6IA 3RM9A 5B8IC 4DT4A 1D2KA 3EY6A 1UR9A 1X6NA 1NWTA 3PR9A 2ZQSA 4P8WA 4IPXA 4MSPA 1H0IA 3KADA 2RUDA 4DWSD 3KABA 4JFIA 5HW7A 3IHZA 3KZ7A 1LG2A 1H0GA 1E6RA 4TW6A 2DPEA 3JYJA 4WKHA 5DIUA 4DRJA 2DT2A 2F2DA 3NRKA 5DEZA 2ZQUA 1R9HA 2DSZA 1IX5A 4IT4A 1P5QA 4Q22A 2MF9A 2DSUA 3WQWA 1TCOC 1ZK6A 2MPHA 4ZPTR 3UQIA 3MDYB 2AWGA 4L72B 1LJYA 4DWSB 4JFMA 5DO2A 4ODNA 4UDMA 4S3JA 3UQBA 2WLYA 2PV1A 3NTPA 4PTMA 4DRKA 1GOIA 4MNJA 5GPGA 2DT0A 2F23A 3WH0A 1D7HA 3ARWA 4MGVA 1PINA 1J4IA 2OLHA 2RSEA 1W1VA 3ARVA 5HWBA 4ODPA 2M1IA 3CHFA 1W1TA 1LL7A 2O92A 5DF0A 2ETNA 4R0XA 4LAXA 2WK2A 1XHGA 1LL4A 1W9UA 5BXJA 4NZCA 2FAPA 4W5UA 4DRPA 4MAVA 4MNKA 3IKDA 4G50A 4U85A 3WD3A 1U79A 3ARYA 5HUAA 4U86A 3FXYA 2XP5A 1J6YA 1TFVA 1VF8A 3O5KA 3ARQA 4JFLA 2VN1A 3ODKA 3AS3A 1D6OA 4JFKA 2ZR6A 1D7JA 2Y78A 2ITKA 1X6LA 4Z2JA 5I98A 3WL1A 1ZBKA 4WKFA 5GQBA 1E6ZA 3KCEA 5DIVA 2IF4A 3CHCA 1ROTA 1LQ0A 4JYSA 2DSWA 4MNMA 4Z2IA 2XP8A 2PPPA 3O5EA 1OWQA 3RM8A 1QZ2A 2PPNA 1ROUA 3AROA 3O5MA 1E6NA 2XPBA 4HBEA 2XP7A 5DITA 2WM0A 1B6CA 1SYTA 3O5RA 3RM4A 4GIVA 2G41A 2F21A 1NSGA 3B8SA 1FAPA 4DRQA 3WKZA 1E44A 2KI3A 5JH8A 2ZQVA 4JFJA 1FKBA 3KAIA 3O5OA 1FJDA 1FKIA 1CTNA 1BKFA 1JCHB 1OGGA 1HJWA 3ARXA 1NMVA 4DZ3A 1ZCNA 1XRVA 3GU0A 3NI6A 1E9LA 1FKHA 2LGOA 2EULA 1HKIA 4LAVA 3IK8A 4BF8A 2D9FA 3TC5A 5GPRA 1FKRA 4Z2LA 4P8VA 3JYMA 2F4EA 3CGNA 3WL0A 1JVWA 2QF8A 3ARSA 2KFWA 3KACA 1FKLA 2VCDA 3CHEA 1T11A 3O5GA 3GTYX 3ARPA 3O5JA 3VAWA 4Z2KA 1E15A 1HKMA 4HARA 4P8XA 4WK9A 2LPVA 4C02B 5HBFA 2IUZA 4DRNA 3WQVA 2KGJA 2XP4A 2KO7A 2LJ4A 3ALFA 3B9AA 5HWCA 1E6PA 5HT1A 3PRBA 3LUOA 3UI4A 3KAFA 3O5LA 3ARZA 3AS2A 4J4OA 4S3KA 3UI6A 4TW7A 4ODMA 2Q5AA 3CHDA 3BMBA 4HBOA 3O5DA 4N19A 1NWSA 3ARTA 2YBUA 1RD6A 3KAHA 1EIBA 2RUQA 4DWSC 1JNEA 1GPFA 1QPFA 3ARUA 2PN0A 4DRMA 1KT1A 1PBKA 1W26A 4GGQA 1J4HA 2P4VA 2DT3A 3RGCA 2PV3A 3G6LA 2PPOA 4MNLA 2G8ZA 2K8IA 2MLZA 4QT3A 4QZVB 4DRIA 3PRDA 4G2PA 1FKSA 1GUVA 4QT2A 2A3AA 4Z2HA 1NMWA 2N87A 2RQSA 3I6CA 2OFNA 2M2AA 4ODQA 5HW8A 2RURA 4NNRA 3PRAA 1F8AB 5HTGA 1W9PA 1ZBVA 3GPKA 2JZVA 3IKGA 3WD1A 4FAPA 1ZBWA 1FKTA 2A3CA 1EQ3A 4URIA 4WIWA 5D75A 3G6MA 1JNDA 1ZBCA 3CH9A 3UQAA 4Q7NA 1ZB5A 3UI5A 3O5PA 4ODKA 2ESCA 4WJXA 4ODOA 1KFWA 2PBCA 3ALGA 2XPAA 2L2SA 1Q6UA 2B5UB 1SR0A 3OOBA 1FKFA 1FKKA 4W9QA 2O9OA 1Y0OA 2WLZA 2MLYA 3O5FA 3TCZA 2DSVA 2YBTA 4DIPA 4DROA 3AS0A 1L1PA 4LAYA 1HXVA 1W9VA 4DWSA 1BL4A 2ZR4A 3H9RB 1KT0A 1FFRA 4KR0B 1NH6A 1J4RA 4ZPVR 1JNSA 4ODLA 4ITZA 3O5IA 4LAWA 1N1AA 3EIPA 4IQ2A 4NSBA 1EYMA 4ML4A 1HKKA 3WD0A 3JXVA 2DG4A 3TDBA 4DH0A 3WD2A 1HJVA 4O2TA 2PV2A 3QOKA 4TW8A 3W4RA 4MTVA 1LL6A 2XP3A 3FY1A 1W1PA 3BXWA 3B7XA 3ARRA 3WIJA 1HJXA 2MNTA 3B9DA 1M5YA 1FKJA 2ZQTA 3CGMA 1WAWA 3PA7A 5J6EA 4ODRA 2XP6A 1LG1A 5HW6A 4P8UA 4DRHA 1FKGA 4TX0A 4ZS6A 3KAGA 4LGXA 1ZU8A 4IT6A 4FN2A 3FAPA 1C9HA 2M08A 1FKDA 2RUCA 1Q6IA 2DG3A 3AS1A 2A3BA 2KE0A
chains in the Genus database with same CATH topology
1EHNA 3RMEA 2MLXA 4MPKA 1FFQA 2B31A 2KR7A 2A3EA 5HKGA 4AY1A 4DZ2A 1F40A 3AQUA 4R5EA 3UF8A 3RFWA 2XP9A 4W9PA 2LKNA 1YATA 1NWUA 1ITXA 1ZL1A 4XAKA 2FDMA 1D7IA 1WB0A 1Q1CA 3B9EA 1A7XA 2AOSA 1EDQA 4TYOA 1W1YA 2FKEA 2DT1A 2UZ5A 1NWRA 1HKJA 4QIBA 4IQCA 1FD9A 3WD4A 4U84A 3OA5A 4W9OA 4WKAA 3CZ8A 1YW5A 1OGBA 1UR8A 4L3NA 1JNTA 1Q6HA 1K9TA 1WNOA 4ZPWR 2PI6A 2DG9A 2ZR5A 4J4NA 3O5QA 4TNSA 4Z2GA 1QPLA 4KQZA 1O6IA 3RM9A 5B8IC 4DT4A 1D2KA 3EY6A 1UR9A 1X6NA 1NWTA 3PR9A 2ZQSA 4P8WA 4IPXA 4MSPA 1H0IA 3KADA 2RUDA 4DWSD 3KABA 4JFIA 5HW7A 3IHZA 3KZ7A 1LG2A 1H0GA 1E6RA 4TW6A 2DPEA 3JYJA 4WKHA 5DIUA 4DRJA 2DT2A 2F2DA 3NRKA 5DEZA 2ZQUA 1R9HA 2DSZA 1IX5A 4IT4A 1P5QA 4Q22A 2MF9A 2DSUA 3WQWA 1TCOC 1ZK6A 2MPHA 4ZPTR 3UQIA 3MDYB 2AWGA 4L72B 1LJYA 4DWSB 4JFMA 5DO2A 4ODNA 3UQBA 4S3JA 2WLYA 2PV1A 3NTPA 4PTMA 4DRKA 1GOIA 4MNJA 5GPGA 2DT0A 3WH0A 1D7HA 3ARWA 4MGVA 1PINA 1J4IA 2OLHA 2RSEA 1W1VA 3ARVA 5HWBA 4ODPA 2M1IA 3CHFA 1W1TA 1LL7A 2O92A 5DF0A 4R0XA 4LAXA 2WK2A 1XHGA 1LL4A 1W9UA 5BXJA 4NZCA 2FAPA 4W5UA 4DRPA 4MAVA 4MNKA 3IKDA 4G50A 4U85A 3WD3A 1U79A 3ARYA 5HUAA 4U86A 3FXYA 2XP5A 1J6YA 1TFVA 1VF8A 3O5KA 3ARQA 4JFLA 2VN1A 3ODKA 3AS3A 1D6OA 4JFKA 2ZR6A 1D7JA 2Y78A 2ITKA 1X6LA 4Z2JA 5I98A 3WL1A 1ZBKA 4WKFA 5GQBA 1E6ZA 3KCEA 5DIVA 2IF4A 3CHCA 1ROTA 1LQ0A 4JYSA 2DSWA 4MNMA 4Z2IA 2XP8A 2PPPA 3O5EA 1OWQA 3RM8A 1QZ2A 2PPNA 1ROUA 3AROA 3O5MA 1E6NA 2XPBA 4HBEA 2XP7A 5DITA 2WM0A 1B6CA 1SYTA 3O5RA 3RM4A 4GIVA 2G41A 2F21A 1NSGA 3B8SA 1FAPA 4DRQA 3WKZA 2KI3A 5JH8A 2ZQVA 4JFJA 1FKBA 3KAIA 3O5OA 1FJDA 1FKIA 1CTNA 1BKFA 1OGGA 1HJWA 3ARXA 1NMVA 4DZ3A 1ZCNA 1XRVA 3NI6A 1E9LA 1FKHA 2LGOA 1HKIA 4LAVA 3IK8A 4BF8A 2D9FA 3TC5A 5GPRA 1FKRA 4Z2LA 4P8VA 3JYMA 2F4EA 3CGNA 3WL0A 1JVWA 2QF8A 3ARSA 2KFWA 3KACA 1FKLA 2VCDA 3CHEA 1T11A 3O5GA 3ARPA 3O5JA 3VAWA 4Z2KA 1E15A 1HKMA 4HARA 4P8XA 4WK9A 2LPVA 4C02B 5HBFA 2IUZA 4DRNA 3WQVA 2KGJA 2XP4A 2KO7A 2LJ4A 3ALFA 3B9AA 5HWCA 1E6PA 5HT1A 3PRBA 3LUOA 3UI4A 3KAFA 3O5LA 3ARZA 3AS2A 4J4OA 4S3KA 3UI6A 4TW7A 4ODMA 2Q5AA 3CHDA 4HBOA 3O5DA 4N19A 1NWSA 3ARTA 2YBUA 1RD6A 3KAHA 1EIBA 2RUQA 4DWSC 1JNEA 1GPFA 1QPFA 3ARUA 4DRMA 1KT1A 1PBKA 1W26A 4GGQA 1J4HA 2DT3A 3RGCA 2PV3A 3G6LA 2PPOA 4MNLA 2G8ZA 2K8IA 2MLZA 4QT3A 4QZVB 4DRIA 3PRDA 4G2PA 1FKSA 1GUVA 4QT2A 2A3AA 4Z2HA 1NMWA 2N87A 2RQSA 3I6CA 2OFNA 2M2AA 4ODQA 5HW8A 2RURA 4NNRA 3PRAA 1F8AB 5HTGA 1W9PA 1ZBVA 3GPKA 2JZVA 3IKGA 3WD1A 4FAPA 1ZBWA 1FKTA 2A3CA 1EQ3A 4URIA 4WIWA 5D75A 3G6MA 1JNDA 1ZBCA 3CH9A 3UQAA 4Q7NA 1ZB5A 3UI5A 3O5PA 4ODKA 2ESCA 4WJXA 4ODOA 1KFWA 2PBCA 3ALGA 2XPAA 2L2SA 1Q6UA 1SR0A 3OOBA 1FKFA 1FKKA 4W9QA 2O9OA 1Y0OA 2WLZA 2MLYA 3O5FA 3TCZA 2DSVA 2YBTA 4DIPA 4DROA 3AS0A 1L1PA 4LAYA 1HXVA 1W9VA 4DWSA 1BL4A 2ZR4A 3H9RB 1KT0A 1FFRA 4KR0B 1NH6A 1J4RA 4ZPVR 1JNSA 4ODLA 4ITZA 3O5IA 4LAWA 1N1AA 4IQ2A 4NSBA 1EYMA 4ML4A 1HKKA 3WD0A 3JXVA 2DG4A 3TDBA 4DH0A 3WD2A 1HJVA 4O2TA 2PV2A 3QOKA 4TW8A 3W4RA 4MTVA 1LL6A 2XP3A 3FY1A 1W1PA 3BXWA 3B7XA 3ARRA 3WIJA 1HJXA 2MNTA 3B9DA 1M5YA 1FKJA 2ZQTA 3CGMA 1WAWA 3PA7A 5J6EA 4ODRA 2XP6A 1LG1A 5HW6A 4P8UA 4DRHA 1FKGA 4TX0A 4ZS6A 3KAGA 4LGXA 1ZU8A 4IT6A 4FN2A 3FAPA 1C9HA 2M08A 1FKDA 2RUCA 1Q6IA 2DG3A 3AS1A 2A3BA 2KE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFM A;  5HW8 A;  2MLX A;  3NI6 A;  2RUR A;  4NNR A;  2KR7 A;  5HKG A;  1F8A B;  4ODN A;  5HTG A;  3GPK A;  2JZV A;  3IKG A;  1FKH A;  4DZ2 A;  4FAP A;  3UQB A;  1F40 A;  2PV1 A;  1FKT A;  2LGO A;  3UF8 A;  3NTP A;  4LAV A;  3RFW A;  1JNS A;  2XP9 A;  4DRK A;  1EQ3 A;  3IK8 A;  4W9P A;  4BF8 A;  2LKN A;  5GPG A;  1YAT A;  2D9F A;  5D75 A;  3TC5 A;  3WH0 A;  1D7H A;  1FKR A;  4MGV A;  1PIN A;  1J4I A;  3UI5 A;  1D7I A;  3UQA A;  3O5P A;  3JYM A;  2F4E A;  2RSE A;  3CGN A;  4ODK A;  1Q1C A;  5HWB A;  4ODP A;  1A7X A;  2M1I A;  1JVW A;  4TYO A;  2FKE A;  4ODO A;  4R0X A;  2KFW A;  2PBC A;  3KAC A;  4LAX A;  2UZ5 A;  2XPA A;  2L2S A;  1FKL A;  2VCD A;  4QIB A;  4IQC A;  1T11 A;  1FD9 A;  3O5G A;  5BXJ A;  4U84 A;  1Q6U A;  2FAP A;  4W9O A;  3O5J A;  3VAW A;  3OOB A;  4DRP A;  1FKF A;  1FKK A;  1YW5 A;  4W9Q A;  1Y0O A;  2MLY A;  3IKD A;  4G50 A;  3O5F A;  4U85 A;  2LPV A;  3TCZ A;  4C02 B;  4DRM A;  4DIP A;  4DRO A;  4DRN A;  1U79 A;  5HUA A;  1L1P A;  1JNT A;  4LAY A;  2KGJ A;  4U86 A;  2XP4 A;  1Q6H A;  1BL4 A;  2KO7 A;  2XP5 A;  2ZR4 A;  1J6Y A;  2LJ4 A;  3H9R B;  1KT0 A;  5HWC A;  3O5K A;  4JFL A;  5HT1 A;  3PRB A;  4QT2 A;  2DG9 A;  2VN1 A;  1J4R A;  2ZR5 A;  3LUO A;  3ODK A;  3KAF A;  1D6O A;  3O5L A;  3O5Q A;  4J4N A;  4JFK A;  2ZR6 A;  4ODL A;  4TNS A;  4ITZ A;  1QPL A;  3O5I A;  1D7J A;  2Y78 A;  4LAW A;  1N1A A;  4J4O A;  2ITK A;  4IQ2 A;  5B8I C;  5I98 A;  1EYM A;  3UI6 A;  4DT4 A;  4TW7 A;  3EY6 A;  4ODM A;  3JXV A;  2Q5A A;  2DG4 A;  3TDB A;  4DH0 A;  2ZQS A;  3O5D A;  4IPX A;  3KCE A;  2PV2 A;  4MSP A;  2IF4 A;  4O2T A;  4N19 A;  1ROT A;  4JYS A;  4TW8 A;  5DIV A;  3KAD A;  2RUD A;  2XP8 A;  1ZCN A;  2PPP A;  3KAB A;  2XP3 A;  3KAH A;  3O5E A;  4JFI A;  5HW7 A;  2RUQ A;  1QZ2 A;  2PPN A;  1QPF A;  1ROU A;  3B7X A;  1KT1 A;  1PBK A;  1W26 A;  3IHZ A;  3KZ7 A;  4GGQ A;  3O5M A;  4TW6 A;  1J4H A;  2MNT A;  2XPB A;  3RGC A;  1M5Y A;  1FKJ A;  2ZQT A;  2PV3 A;  3CGM A;  3JYJ A;  3UI4 A;  2XP7 A;  2PPO A;  5DIU A;  5DIT A;  4DRJ A;  3PA7 A;  2F2D A;  1B6C A;  5J6E A;  3O5R A;  2K8I A;  2MLZ A;  3NRK A;  2ZQU A;  1R9H A;  4GIV A;  4JFJ A;  4ODR A;  4QT3 A;  1P5Q A;  1NSG A;  2F21 A;  1FAP A;  4DRI A;  2MF9 A;  2XP6 A;  4DRQ A;  5HW6 A;  4DRH A;  1FKG A;  4TX0 A;  3PRD A;  2KI3 A;  4G2P A;  3KAG A;  1FKS A;  2ZQV A;  1TCO C;  1ZK6 A;  2MPH A;  1FKB A;  4FN2 A;  1NMW A;  3KAI A;  3FAP A;  3MDY B;  3O5O A;  3UQI A;  1FKI A;  1C9H A;  2N87 A;  2M08 A;  2RQS A;  1FJD A;  1FKD A;  1BKF A;  2AWG A;  3I6C A;  2RUC A;  1Q6I A;  2OFN A;  2DG3 A;  2M2A A;  1NMV A;  4ODQ A;  1HXV A;  4DZ3 A;  2KE0 A; 
#chains in the Genus database with same CATH topology
 1EHN A;  3RME A;  2MLX A;  4MPK A;  1FFQ A;  2B31 A;  2KR7 A;  2A3E A;  5HKG A;  4AY1 A;  4DZ2 A;  1F40 A;  3AQU A;  4R5E A;  3UF8 A;  3RFW A;  2XP9 A;  4W9P A;  2LKN A;  1YAT A;  1NWU A;  1ITX A;  1ZL1 A;  4XAK A;  2FDM A;  1D7I A;  1GRJ A;  1WB0 A;  1Q1C A;  3B9E A;  1A7X A;  2AOS A;  1EDQ A;  4TYO A;  1W1Y A;  2FKE A;  2DT1 A;  2UZ5 A;  1NWR A;  1HKJ A;  4QIB A;  4IQC A;  1FD9 A;  3WD4 A;  4U84 A;  3OA5 A;  4W9O A;  4WKA A;  3CZ8 A;  1YW5 A;  1OGB A;  1UR8 A;  4L3N A;  1JNT A;  1Q6H A;  1K9T A;  1WNO A;  4ZPW R;  2PI6 A;  2DG9 A;  2ZR5 A;  4J4N A;  3O5Q A;  4TNS A;  4Z2G A;  1QPL A;  4KQZ A;  1O6I A;  3RM9 A;  5B8I C;  4DT4 A;  1D2K A;  3EY6 A;  1UR9 A;  1X6N A;  1NWT A;  3PR9 A;  2ZQS A;  4P8W A;  4IPX A;  4MSP A;  1H0I A;  3KAD A;  2RUD A;  4DWS D;  3KAB A;  4JFI A;  5HW7 A;  3IHZ A;  3KZ7 A;  1LG2 A;  1H0G A;  1E6R A;  4TW6 A;  2DPE A;  3JYJ A;  4WKH A;  5DIU A;  4DRJ A;  2DT2 A;  2F2D A;  3NRK A;  5DEZ A;  2ZQU A;  1R9H A;  2DSZ A;  1IX5 A;  4IT4 A;  1P5Q A;  4Q22 A;  2MF9 A;  2DSU A;  3WQW A;  1TCO C;  1ZK6 A;  2MPH A;  4ZPT R;  3UQI A;  3MDY B;  2AWG A;  4L72 B;  1LJY A;  4DWS B;  4JFM A;  5DO2 A;  4ODN A;  4UDM A;  4S3J A;  3UQB A;  2WLY A;  2PV1 A;  3NTP A;  4PTM A;  4DRK A;  1GOI A;  4MNJ A;  5GPG A;  2DT0 A;  2F23 A;  3WH0 A;  1D7H A;  3ARW A;  4MGV A;  1PIN A;  1J4I A;  2OLH A;  2RSE A;  1W1V A;  3ARV A;  5HWB A;  4ODP A;  2M1I A;  3CHF A;  1W1T A;  1LL7 A;  2O92 A;  5DF0 A;  2ETN A;  4R0X A;  4LAX A;  2WK2 A;  1XHG A;  1LL4 A;  1W9U A;  5BXJ A;  4NZC A;  2FAP A;  4W5U A;  4DRP A;  4MAV A;  4MNK A;  3IKD A;  4G50 A;  4U85 A;  3WD3 A;  1U79 A;  3ARY A;  5HUA A;  4U86 A;  3FXY A;  2XP5 A;  1J6Y A;  1TFV A;  1VF8 A;  3O5K A;  3ARQ A;  4JFL A;  2VN1 A;  3ODK A;  3AS3 A;  1D6O A;  4JFK A;  2ZR6 A;  1D7J A;  2Y78 A;  2ITK A;  1X6L A;  4Z2J A;  5I98 A;  3WL1 A;  1ZBK A;  4WKF A;  5GQB A;  1E6Z A;  3KCE A;  5DIV A;  2IF4 A;  3CHC A;  1ROT A;  1LQ0 A;  4JYS A;  2DSW A;  4MNM A;  4Z2I A;  2XP8 A;  2PPP A;  3O5E A;  1OWQ A;  3RM8 A;  1QZ2 A;  2PPN A;  1ROU A;  3ARO A;  3O5M A;  1E6N A;  2XPB A;  4HBE A;  2XP7 A;  5DIT A;  2WM0 A;  1B6C A;  1SYT A;  3O5R A;  3RM4 A;  4GIV A;  2G41 A;  2F21 A;  1NSG A;  3B8S A;  1FAP A;  4DRQ A;  3WKZ A;  1E44 A;  2KI3 A;  5JH8 A;  2ZQV A;  4JFJ A;  1FKB A;  3KAI A;  3O5O A;  1FJD A;  1FKI A;  1CTN A;  1BKF A;  1JCH B;  1OGG A;  1HJW A;  3ARX A;  1NMV A;  4DZ3 A;  1ZCN A;  1XRV A;  3GU0 A;  3NI6 A;  1E9L A;  1FKH A;  2LGO A;  2EUL A;  1HKI A;  4LAV A;  3IK8 A;  4BF8 A;  2D9F A;  3TC5 A;  5GPR A;  1FKR A;  4Z2L A;  4P8V A;  3JYM A;  2F4E A;  3CGN A;  3WL0 A;  1JVW A;  2QF8 A;  3ARS A;  2KFW A;  3KAC A;  1FKL A;  2VCD A;  3CHE A;  1T11 A;  3O5G A;  3GTY X;  3ARP A;  3O5J A;  3VAW A;  4Z2K A;  1E15 A;  1HKM A;  4HAR A;  4P8X A;  4WK9 A;  2LPV A;  4C02 B;  5HBF A;  2IUZ A;  4DRN A;  3WQV A;  2KGJ A;  2XP4 A;  2KO7 A;  2LJ4 A;  3ALF A;  3B9A A;  5HWC A;  1E6P A;  5HT1 A;  3PRB A;  3LUO A;  3UI4 A;  3KAF A;  3O5L A;  3ARZ A;  3AS2 A;  4J4O A;  4S3K A;  3UI6 A;  4TW7 A;  4ODM A;  2Q5A A;  3CHD A;  3BMB A;  4HBO A;  3O5D A;  4N19 A;  1NWS A;  3ART A;  2YBU A;  1RD6 A;  3KAH A;  1EIB A;  2RUQ A;  4DWS C;  1JNE A;  1GPF A;  1QPF A;  3ARU A;  2PN0 A;  4DRM A;  1KT1 A;  1PBK A;  1W26 A;  4GGQ A;  1J4H A;  2P4V A;  2DT3 A;  3RGC A;  2PV3 A;  3G6L A;  2PPO A;  4MNL A;  2G8Z A;  2K8I A;  2MLZ A;  4QT3 A;  4QZV B;  4DRI A;  3PRD A;  4G2P A;  1FKS A;  1GUV A;  4QT2 A;  2A3A A;  4Z2H A;  1NMW A;  2N87 A;  2RQS A;  3I6C A;  2OFN A;  2M2A A;  4ODQ A;  5HW8 A;  2RUR A;  4NNR A;  3PRA A;  1F8A B;  5HTG A;  1W9P A;  1ZBV A;  3GPK A;  2JZV A;  3IKG A;  3WD1 A;  4FAP A;  1ZBW A;  1FKT A;  2A3C A;  1EQ3 A;  4URI A;  4WIW A;  5D75 A;  3G6M A;  1JND A;  1ZBC A;  3CH9 A;  3UQA A;  4Q7N A;  1ZB5 A;  3UI5 A;  3O5P A;  4ODK A;  2ESC A;  4WJX A;  4ODO A;  1KFW A;  2PBC A;  3ALG A;  2XPA A;  2L2S A;  1Q6U A;  2B5U B;  1SR0 A;  3OOB A;  1FKF A;  1FKK A;  4W9Q A;  2O9O A;  1Y0O A;  2WLZ A;  2MLY A;  3O5F A;  3TCZ A;  2DSV A;  2YBT A;  4DIP A;  4DRO A;  3AS0 A;  1L1P A;  4LAY A;  1HXV A;  1W9V A;  4DWS A;  1BL4 A;  2ZR4 A;  3H9R B;  1KT0 A;  1FFR A;  4KR0 B;  1NH6 A;  1J4R A;  4ZPV R;  1JNS A;  4ODL A;  4ITZ A;  3O5I A;  4LAW A;  1N1A A;  3EIP A;  4IQ2 A;  4NSB A;  1EYM A;  4ML4 A;  1HKK A;  3WD0 A;  3JXV A;  2DG4 A;  3TDB A;  4DH0 A;  3WD2 A;  1HJV A;  4O2T A;  2PV2 A;  3QOK A;  4TW8 A;  3W4R A;  4MTV A;  1LL6 A;  2XP3 A;  3FY1 A;  1W1P A;  3BXW A;  3B7X A;  3ARR A;  3WIJ A;  1HJX A;  2MNT A;  3B9D A;  1M5Y A;  1FKJ A;  2ZQT A;  3CGM A;  1WAW A;  3PA7 A;  5J6E A;  4ODR A;  2XP6 A;  1LG1 A;  5HW6 A;  4P8U A;  4DRH A;  1FKG A;  4TX0 A;  4ZS6 A;  3KAG A;  4LGX A;  1ZU8 A;  4IT6 A;  4FN2 A;  3FAP A;  1C9H A;  2M08 A;  1FKD A;  2RUC A;  1Q6I A;  2DG3 A;  3AS1 A;  2A3B A;  2KE0 A; 
#chains in the Genus database with same CATH homology
 1EHN A;  3RME A;  2MLX A;  4MPK A;  1FFQ A;  2B31 A;  2KR7 A;  2A3E A;  5HKG A;  4AY1 A;  4DZ2 A;  1F40 A;  3AQU A;  4R5E A;  3UF8 A;  3RFW A;  2XP9 A;  4W9P A;  2LKN A;  1YAT A;  1NWU A;  1ITX A;  1ZL1 A;  4XAK A;  2FDM A;  1D7I A;  1WB0 A;  1Q1C A;  3B9E A;  1A7X A;  2AOS A;  1EDQ A;  4TYO A;  1W1Y A;  2FKE A;  2DT1 A;  2UZ5 A;  1NWR A;  1HKJ A;  4QIB A;  4IQC A;  1FD9 A;  3WD4 A;  4U84 A;  3OA5 A;  4W9O A;  4WKA A;  3CZ8 A;  1YW5 A;  1OGB A;  1UR8 A;  4L3N A;  1JNT A;  1Q6H A;  1K9T A;  1WNO A;  4ZPW R;  2PI6 A;  2DG9 A;  2ZR5 A;  4J4N A;  3O5Q A;  4TNS A;  4Z2G A;  1QPL A;  4KQZ A;  1O6I A;  3RM9 A;  5B8I C;  4DT4 A;  1D2K A;  3EY6 A;  1UR9 A;  1X6N A;  1NWT A;  3PR9 A;  2ZQS A;  4P8W A;  4IPX A;  4MSP A;  1H0I A;  3KAD A;  2RUD A;  4DWS D;  3KAB A;  4JFI A;  5HW7 A;  3IHZ A;  3KZ7 A;  1LG2 A;  1H0G A;  1E6R A;  4TW6 A;  2DPE A;  3JYJ A;  4WKH A;  5DIU A;  4DRJ A;  2DT2 A;  2F2D A;  3NRK A;  5DEZ A;  2ZQU A;  1R9H A;  2DSZ A;  1IX5 A;  4IT4 A;  1P5Q A;  4Q22 A;  2MF9 A;  2DSU A;  3WQW A;  1TCO C;  1ZK6 A;  2MPH A;  4ZPT R;  3UQI A;  3MDY B;  2AWG A;  4L72 B;  1LJY A;  4DWS B;  4JFM A;  5DO2 A;  4ODN A;  3UQB A;  4S3J A;  2WLY A;  2PV1 A;  3NTP A;  4PTM A;  4DRK A;  1GOI A;  4MNJ A;  5GPG A;  2DT0 A;  3WH0 A;  1D7H A;  3ARW A;  4MGV A;  1PIN A;  1J4I A;  2OLH A;  2RSE A;  1W1V A;  3ARV A;  5HWB A;  4ODP A;  2M1I A;  3CHF A;  1W1T A;  1LL7 A;  2O92 A;  5DF0 A;  4R0X A;  4LAX A;  2WK2 A;  1XHG A;  1LL4 A;  1W9U A;  5BXJ A;  4NZC A;  2FAP A;  4W5U A;  4DRP A;  4MAV A;  4MNK A;  3IKD A;  4G50 A;  4U85 A;  3WD3 A;  1U79 A;  3ARY A;  5HUA A;  4U86 A;  3FXY A;  2XP5 A;  1J6Y A;  1TFV A;  1VF8 A;  3O5K A;  3ARQ A;  4JFL A;  2VN1 A;  3ODK A;  3AS3 A;  1D6O A;  4JFK A;  2ZR6 A;  1D7J A;  2Y78 A;  2ITK A;  1X6L A;  4Z2J A;  5I98 A;  3WL1 A;  1ZBK A;  4WKF A;  5GQB A;  1E6Z A;  3KCE A;  5DIV A;  2IF4 A;  3CHC A;  1ROT A;  1LQ0 A;  4JYS A;  2DSW A;  4MNM A;  4Z2I A;  2XP8 A;  2PPP A;  3O5E A;  1OWQ A;  3RM8 A;  1QZ2 A;  2PPN A;  1ROU A;  3ARO A;  3O5M A;  1E6N A;  2XPB A;  4HBE A;  2XP7 A;  5DIT A;  2WM0 A;  1B6C A;  1SYT A;  3O5R A;  3RM4 A;  4GIV A;  2G41 A;  2F21 A;  1NSG A;  3B8S A;  1FAP A;  4DRQ A;  3WKZ A;  2KI3 A;  5JH8 A;  2ZQV A;  4JFJ A;  1FKB A;  3KAI A;  3O5O A;  1FJD A;  1FKI A;  1CTN A;  1BKF A;  1OGG A;  1HJW A;  3ARX A;  1NMV A;  4DZ3 A;  1ZCN A;  1XRV A;  3NI6 A;  1E9L A;  1FKH A;  2LGO A;  1HKI A;  4LAV A;  3IK8 A;  4BF8 A;  2D9F A;  3TC5 A;  5GPR A;  1FKR A;  4Z2L A;  4P8V A;  3JYM A;  2F4E A;  3CGN A;  3WL0 A;  1JVW A;  2QF8 A;  3ARS A;  2KFW A;  3KAC A;  1FKL A;  2VCD A;  3CHE A;  1T11 A;  3O5G A;  3ARP A;  3O5J A;  3VAW A;  4Z2K A;  1E15 A;  1HKM A;  4HAR A;  4P8X A;  4WK9 A;  2LPV A;  4C02 B;  5HBF A;  2IUZ A;  4DRN A;  3WQV A;  2KGJ A;  2XP4 A;  2KO7 A;  2LJ4 A;  3ALF A;  3B9A A;  5HWC A;  1E6P A;  5HT1 A;  3PRB A;  3LUO A;  3UI4 A;  3KAF A;  3O5L A;  3ARZ A;  3AS2 A;  4J4O A;  4S3K A;  3UI6 A;  4TW7 A;  4ODM A;  2Q5A A;  3CHD A;  4HBO A;  3O5D A;  4N19 A;  1NWS A;  3ART A;  2YBU A;  1RD6 A;  3KAH A;  1EIB A;  2RUQ A;  4DWS C;  1JNE A;  1GPF A;  1QPF A;  3ARU A;  4DRM A;  1KT1 A;  1PBK A;  1W26 A;  4GGQ A;  1J4H A;  2DT3 A;  3RGC A;  2PV3 A;  3G6L A;  2PPO A;  4MNL A;  2G8Z A;  2K8I A;  2MLZ A;  4QT3 A;  4QZV B;  4DRI A;  3PRD A;  4G2P A;  1FKS A;  1GUV A;  4QT2 A;  2A3A A;  4Z2H A;  1NMW A;  2N87 A;  2RQS A;  3I6C A;  2OFN A;  2M2A A;  4ODQ A;  5HW8 A;  2RUR A;  4NNR A;  3PRA A;  1F8A B;  5HTG A;  1W9P A;  1ZBV A;  3GPK A;  2JZV A;  3IKG A;  3WD1 A;  4FAP A;  1ZBW A;  1FKT A;  2A3C A;  1EQ3 A;  4URI A;  4WIW A;  5D75 A;  3G6M A;  1JND A;  1ZBC A;  3CH9 A;  3UQA A;  4Q7N A;  1ZB5 A;  3UI5 A;  3O5P A;  4ODK A;  2ESC A;  4WJX A;  4ODO A;  1KFW A;  2PBC A;  3ALG A;  2XPA A;  2L2S A;  1Q6U A;  1SR0 A;  3OOB A;  1FKF A;  1FKK A;  4W9Q A;  2O9O A;  1Y0O A;  2WLZ A;  2MLY A;  3O5F A;  3TCZ A;  2DSV A;  2YBT A;  4DIP A;  4DRO A;  3AS0 A;  1L1P A;  4LAY A;  1HXV A;  1W9V A;  4DWS A;  1BL4 A;  2ZR4 A;  3H9R B;  1KT0 A;  1FFR A;  4KR0 B;  1NH6 A;  1J4R A;  4ZPV R;  1JNS A;  4ODL A;  4ITZ A;  3O5I A;  4LAW A;  1N1A A;  4IQ2 A;  4NSB A;  1EYM A;  4ML4 A;  1HKK A;  3WD0 A;  3JXV A;  2DG4 A;  3TDB A;  4DH0 A;  3WD2 A;  1HJV A;  4O2T A;  2PV2 A;  3QOK A;  4TW8 A;  3W4R A;  4MTV A;  1LL6 A;  2XP3 A;  3FY1 A;  1W1P A;  3BXW A;  3B7X A;  3ARR A;  3WIJ A;  1HJX A;  2MNT A;  3B9D A;  1M5Y A;  1FKJ A;  2ZQT A;  3CGM A;  1WAW A;  3PA7 A;  5J6E A;  4ODR A;  2XP6 A;  1LG1 A;  5HW6 A;  4P8U A;  4DRH A;  1FKG A;  4TX0 A;  4ZS6 A;  3KAG A;  4LGX A;  1ZU8 A;  4IT6 A;  4FN2 A;  3FAP A;  1C9H A;  2M08 A;  1FKD A;  2RUC A;  1Q6I A;  2DG3 A;  3AS1 A;  2A3B A;  2KE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...