2M08A

The solution structure of nmpin, the parvuline of nitrosopumilus maritimus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
GPSNKIKCSHILVSKQSEALAIMEKLKSGEKFGKLAKELSIDSGSAKKNGNLGYFTKGMMVKPFEDAAFKLQVGEVSEPIKSEFGYHIIKRFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PpiC-type peptidyl-prolyl cis-trans isomerase
publication title NmPin from the marine thaumarchaeote Nitrosopumilus maritimus is an active membrane associated prolyl isomerase.
pubmed doi rcsb
source organism Nitrosopumilus maritimus
molecule tags Isomerase
total genus 14
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2012-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2m08A00
3JXVA 3OOBA 4FAPA 2KE0A 2ZQTA 2FKEA 2IF4A 3B7XA 4ODMA 3KAGA 2ZQSA 3IKDA 4U85A 4DT4A 1FAPA 2DG9A 2MLZA 4ODNA 4GGQA 4NNRA 1YW5A 4IQ2A 4LAVA 5HWCA 1JNSA 3I6CA 3O5JA 1D7JA 3O5QA 2XP6A 3PA7A 2MPHA 5I98A 2KI3A 1J4RA 3FAPA 2KO7A 3MDYB 4ODRA 3ODKA 4ODLA 3UI5A 1YATA 3O5KA 4R0XA 2MF9A 3GPKA 3O5OA 4U84A 3NI6A 3O5GA 2PV3A 4LAWA 1J4IA 2XP8A 1KT1A 4QT2A 2ZR6A 3JYMA 3NTPA 2RUCA 1PINA 1NSGA 2LPVA 4DRHA 2F4EA 2ZQUA 1FKDA 2KR7A 4GIVA 2MLYA 2ZQVA 3IK8A 4LAYA 2DG3A 4U86A 1W26A 3UQIA 1Q6HA 2RURA 1P5QA 2JZVA 1NMVA 2PPPA 1A7XA 1Q6UA 1ROTA 3KAFA 5HT1A 1NMWA 2N87A 5HUAA 1EYMA 3CGNA 3PRBA 3VAWA 1D7HA 4TYOA 4DRJA 1L1PA 3O5PA 4JFJA 4TNSA 4JFLA 4IQCA 3O5MA 4JYSA 3RFWA 3KADA 3TDBA 3UI6A 2PPOA 3O5FA 4DROA 4DRQA 4MSPA 3LUOA 1FKJA 3CGMA 4LAXA 3UQAA 3O5RA 1D7IA 2VCDA 4W9PA 3KACA 5HTGA 1D6OA 2AWGA 4TW8A 2M2AA 4ODKA 5HW7A 3WH0A 2PV1A 5HW6A 3RGCA 1C9HA 2XPAA 3KAHA 2XPBA 4J4OA 4FN2A 3O5LA 3PRDA 4JFMA 1U79A 4DZ3A 2LJ4A 4IPXA 1B6CA 2RUQA 2PPNA 1F8AB 4G2PA 1TCOC 2L2SA 1BKFA 2XP9A 4G50A 4BF8A 5D75A 3IKGA 1N1AA 3O5EA 4ITZA 4W9OA 1FKGA 2UZ5A 3TCZA 1EQ3A 2LGOA 1Y0OA 2ITKA 2LKNA 2VN1A 1FKLA 2KFWA 4QIBA 4DRIA 3UI4A 1JVWA 4JFKA 2M1IA 1FKTA 3H9RB 3JYJA 4TX0A 1ROUA 3KZ7A 5HKGA 1BL4A 2PV2A 5GPGA 4TW7A 4DIPA 3TC5A 5BXJA 1FKBA 3O5DA 1FKFA 2XP4A 2KGJA 5DIVA 4DH0A 1ZK6A 1FKRA 1T11A 1FKHA 4JFIA 5DITA 2K8IA 4DRMA 1M5YA 2PBCA 3IHZA 1KT0A 3EY6A 5J6EA 1Q1CA 5DIUA 1PBKA 1Q6IA 1R9HA 2OFNA 2XP3A 1QPLA 4TW6A 2XP7A 3O5IA 2MLXA 1FD9A 2F2DA 1HXVA 5HWBA 4C02B 3KABA 1F40A 2ZR5A 1FKIA 4O2TA 4DRKA 5HW8A 1FKKA 4DRPA 4J4NA 1FJDA 2RQSA 1JNTA 2ZR4A 4DRNA 1ZCNA 3KAIA 3NRKA 4ODOA 2RUDA 2Q5AA 4W9QA 2M08A 4ODPA 2RSEA 2XP5A 2D9FA 4MGVA 1J4HA 2DG4A 1J6YA 2MNTA 5B8IC 4ODQA 1FKSA 3KCEA 4N19A 2F21A 1QZ2A 4DZ2A 2Y78A 3UQBA 1QPFA 3UF8A 4QT3A 2FAPA
chains in the Genus database with same CATH superfamily
2ZQTA 1EDQA 4NSBA 2ZQSA 4U85A 4HBEA 2MLZA 4GGQA 5HWCA 4WKFA 1X6NA 3PA7A 1OGBA 1IX5A 5I98A 1J4RA 4NZCA 4MNKA 1HJXA 4MNLA 4ODLA 4WIWA 2PV3A 1KT1A 4R5EA 3JYMA 1PINA 4DRHA 5HW8A 4LAYA 3UQIA 1O6IA 3PR9A 3IK8A 1Q6HA 2PPPA 2N87A 2IUZA 3VAWA 2B31A 3AS2A 4DRJA 4TNSA 4JFLA 4MNJA 3UI6A 3ARSA 2FDMA 3CGMA 4LAXA 2A3CA 4ODKA 5HW6A 3RGCA 4AY1A 1LG2A 3RM8A 1U79A 4DZ3A 2LJ4A 2G8ZA 3WL0A 1NWSA 2L2SA 2G41A 2XP9A 4G50A 3IKGA 4P8UA 4ITZA 3CHFA 3B9DA 1W1VA 5DEZA 3B9AA 4URIA 1Y0OA 2KFWA 1JVWA 1ROUA 4ZPVR 1FKBA 1ZU8A 1FKRA 4MAVA 5DITA 2PI6A 2OFNA 4TW6A 2XP7A 3O5IA 1E44A 1W9VA 4MPKA 1UR8A 4C02B 1OWQA 3KABA 4DRPA 4J4NA 2RQSA 3ARQA 4DRNA 3KAIA 4ODOA 4W9QA 4ODPA 3G6MA 1E15A 1LG1A 2D9FA 2XP5A 2DG4A 5B8IC 3GU0A 1FKSA 1QZ2A 1CTNA 3BMBA 4L72B 3WD3A 3UF8A 1LL6A 4QT3A 4WJXA 2KE0A 1LL7A 2IF4A 1GPFA 1KFWA 1H0IA 2DG9A 1HJVA 1LL4A 4MNMA 1JNSA 3I6CA 3OA5A 2XP6A 2MPHA 3WKZA 1JCHB 1EHNA 2KO7A 3MDYB 4ODRA 3ODKA 1ZBKA 4U84A 3NI6A 1HKIA 1J4IA 2XP8A 3FY1A 2RUCA 1NSGA 2LPVA 1HKJA 2F4EA 1FKDA 3WD1A 4U86A 2YBUA 4Z2KA 1W26A 4MTVA 5HT1A 1P5QA 1ROTA 2WLYA 2PN0A 1EYMA 3ARZA 5HBFA 3CZ8A 1L1PA 3QOKA 3RFWA 3TDBA 2PPOA 4DRQA 4DWSC 4S3KA 4P8WA 3O5RA 1E9LA 1X6LA 1D6OA 1TFVA 2ETNA 4DWSD 3AS3A 1FFQA 2XPAA 3GTYX 2YBTA 1ZL1A 4J4OA 3ARVA 4JFMA 4UDMA 4W5UA 4IPXA 2PPNA 4G2PA 4BF8A 3AROA 3O5EA 4W9OA 1W1TA 4PTMA 2LGOA 4DRIA 3ARXA 2WLZA 1WAWA 1HKKA 3KZ7A 5BXJA 4TW7A 3O5DA 2XP4A 4KR0B 4ZPWR 5DIVA 4DH0A 1GRJA 5DF0A 4JFIA 4DRMA 5J6EA 1Q1CA 2DT3A 4Z2IA 4LGXA 2DSWA 1QPLA 2XP3A 1W1YA 1HXVA 5HWBA 1F40A 1SYTA 4ZS6A 4QZVB 1K9TA 2ZR4A 1ZCNA 1NWRA 4L3NA 3RM9A 3RMEA 1D2KA 4MGVA 1J4HA 1J6YA 2MNTA 2P4VA 5DO2A 2Y78A 1E6NA 3UQBA 2FAPA 4KQZA 3OOBA 2QF8A 2FKEA 3B7XA 3WQWA 3KAGA 3PRAA 4ML4A 2O9OA 3ARWA 4NNRA 1YW5A 4IQ2A 3O5JA 1D7JA 3ARTA 3CHDA 1HKMA 3O5QA 3ALGA 3FAPA 3UI5A 1YATA 1ZBCA 2O92A 3WD0A 2MF9A 3O5OA 3O5GA 3FXYA 1VF8A 1ZB5A 3NTPA 2DT1A 4GIVA 2KR7A 2ZQVA 3B9EA 2DG3A 3CH9A 2JZVA 3KAFA 1NMWA 5HUAA 3PRBA 4HBOA 1D7HA 3O5PA 3O5MA 4JYSA 4DWSB 1WNOA 2OLHA 4MSPA 3LUOA 3UQAA 1D7IA 2VCDA 3ARPA 4W9PA 3KACA 5HTGA 2M2AA 3WH0A 2PV1A 1XRVA 1E6RA 1C9HA 3KAHA 1E6ZA 2A3EA 1OGGA 4FN2A 3O5LA 3PRDA 4IT6A 1B6CA 2RUQA 1W1PA 3ARYA 1FKGA 2AOSA 2UZ5A 3ARRA 1WB0A 2ITKA 2LKNA 2VN1A 1FKLA 4QIBA 1JNEA 2EULA 4JFKA 5GPRA 2DSZA 3H9RB 3JYJA 1W9UA 1BL4A 2PV2A 4DIPA 4Q22A 4HARA 1T11A 2PBCA 3EY6A 1PBKA 1R9HA 3ALFA 1GOIA 2MLXA 2F2DA 3AS1A 3CHCA 1JNTA 3NRKA 4Q7NA 1H0GA 1NH6A 4ODQA 3KCEA 4N19A 1HJWA 3G6LA 1QPFA 2F23A 3JXVA 3WQVA 4FAPA 4ODMA 3IKDA 4DT4A 1FAPA 1LQ0A 4ODNA 4LAVA 1UR9A 5JH8A 3CHEA 2KI3A 4WKHA 4IT4A 4P8XA 3AS0A 4Z2JA 3O5KA 4R0XA 3ARUA 4ZPTR 3GPKA 4LAWA 2DT0A 4QT2A 2ZR6A 2ZQUA 2MLYA 2RURA 1NMVA 1A7XA 1JNDA 1Q6UA 1W9PA 3CGNA 4TYOA 4JFJA 1RD6A 4IQCA 3B8SA 4DROA 3KADA 3O5FA 2DSUA 4WKAA 1ZBWA 4Z2HA 1FKJA 1ITXA 2DSVA 2AWGA 4TW8A 4WK9A 5HW7A 1E6PA 2XPBA 2ESCA 2B5UB 3W4RA 1NWTA 1F8AB 3AQUA 1TCOC 1BKFA 1ZBVA 5D75A 1N1AA 3TCZA 1EQ3A 5GQBA 1SR0A 3WD4A 3UI4A 1GUVA 2DT2A 2M1IA 1FKTA 4TX0A 5HKGA 5GPGA 1EIBA 4P8VA 3RM4A 3EIPA 3TC5A 1FKFA 3WL1A 2KGJA 1ZK6A 1FKHA 2K8IA 2DPEA 1M5YA 2WM0A 3IHZA 1KT0A 5DIUA 4XAKA 4S3JA 1Q6IA 1NWUA 3WD2A 4Z2LA 1FD9A 2ZR5A 1FKIA 4O2TA 4DRKA 1FKKA 1FJDA 3WIJA 2WK2A 2A3BA 1LJYA 2Q5AA 2RUDA 2M08A 2RSEA 4DWSA 2A3AA 3BXWA 1FFRA 2F21A 4DZ2A 4Z2GA 1XHGA
chains in the Genus database with same CATH topology
2ZQTA 1EDQA 4NSBA 2ZQSA 4U85A 4HBEA 2MLZA 4GGQA 5HWCA 4WKFA 1X6NA 3PA7A 1OGBA 1IX5A 5I98A 1J4RA 4NZCA 4MNKA 1HJXA 4MNLA 4ODLA 4WIWA 2PV3A 1KT1A 4R5EA 3JYMA 1PINA 4DRHA 5HW8A 4LAYA 3UQIA 1O6IA 3PR9A 3IK8A 1Q6HA 2PPPA 2N87A 2IUZA 3VAWA 2B31A 3AS2A 4DRJA 4TNSA 4JFLA 4MNJA 3UI6A 3ARSA 2FDMA 3CGMA 4LAXA 2A3CA 4ODKA 5HW6A 3RGCA 4AY1A 1LG2A 3RM8A 1U79A 4DZ3A 2LJ4A 2G8ZA 3WL0A 1NWSA 2L2SA 2G41A 2XP9A 4G50A 3IKGA 4P8UA 4ITZA 3CHFA 3B9DA 1W1VA 5DEZA 3B9AA 4URIA 1Y0OA 2KFWA 1JVWA 1ROUA 4ZPVR 1FKBA 1ZU8A 1FKRA 4MAVA 5DITA 2PI6A 2OFNA 4TW6A 2XP7A 3O5IA 1W9VA 4MPKA 1UR8A 4C02B 1OWQA 3KABA 4DRPA 4J4NA 2RQSA 3ARQA 4DRNA 3KAIA 4ODOA 4W9QA 4ODPA 3G6MA 1E15A 1LG1A 2D9FA 2XP5A 2DG4A 5B8IC 1FKSA 1QZ2A 1CTNA 4L72B 3WD3A 3UF8A 1LL6A 4QT3A 4WJXA 2KE0A 1LL7A 2IF4A 1GPFA 1KFWA 1H0IA 2DG9A 1HJVA 1LL4A 4MNMA 1JNSA 3I6CA 3OA5A 2XP6A 2MPHA 3WKZA 1EHNA 2KO7A 3MDYB 4ODRA 3ODKA 1ZBKA 4U84A 3NI6A 1HKIA 1J4IA 2XP8A 3FY1A 2RUCA 1NSGA 2LPVA 1HKJA 2F4EA 1FKDA 3WD1A 4U86A 2YBUA 4Z2KA 1W26A 4MTVA 5HT1A 1P5QA 1ROTA 2WLYA 1EYMA 3ARZA 5HBFA 3CZ8A 1L1PA 3QOKA 3RFWA 3TDBA 2PPOA 4DRQA 4DWSC 4S3KA 4P8WA 3O5RA 1E9LA 1X6LA 1D6OA 1TFVA 4DWSD 3AS3A 1FFQA 2XPAA 2YBTA 1ZL1A 4J4OA 3ARVA 4JFMA 4W5UA 4IPXA 2PPNA 4G2PA 4BF8A 3AROA 3O5EA 4W9OA 1W1TA 4PTMA 2LGOA 4DRIA 3ARXA 2WLZA 1WAWA 1HKKA 3KZ7A 5BXJA 4TW7A 3O5DA 2XP4A 4KR0B 4ZPWR 5DIVA 4DH0A 5DF0A 4JFIA 4DRMA 5J6EA 1Q1CA 2DT3A 4Z2IA 4LGXA 2DSWA 1QPLA 2XP3A 1W1YA 1HXVA 5HWBA 1F40A 1SYTA 4ZS6A 4QZVB 1K9TA 2ZR4A 1ZCNA 1NWRA 4L3NA 3RM9A 3RMEA 1D2KA 4MGVA 1J4HA 1J6YA 2MNTA 5DO2A 2Y78A 1E6NA 3UQBA 2FAPA 4KQZA 3OOBA 2QF8A 2FKEA 3B7XA 3WQWA 3KAGA 3PRAA 4ML4A 2O9OA 3ARWA 4NNRA 1YW5A 4IQ2A 3O5JA 1D7JA 3ARTA 3CHDA 1HKMA 3O5QA 3ALGA 3FAPA 3UI5A 1YATA 1ZBCA 2O92A 3WD0A 2MF9A 3O5OA 3O5GA 3FXYA 1VF8A 1ZB5A 3NTPA 2DT1A 4GIVA 2KR7A 2ZQVA 3B9EA 2DG3A 3CH9A 2JZVA 3KAFA 1NMWA 5HUAA 3PRBA 4HBOA 1D7HA 3O5PA 3O5MA 4JYSA 4DWSB 1WNOA 2OLHA 4MSPA 3LUOA 3UQAA 1D7IA 2VCDA 3ARPA 4W9PA 3KACA 5HTGA 2M2AA 3WH0A 2PV1A 1XRVA 1E6RA 1C9HA 3KAHA 1E6ZA 2A3EA 1OGGA 4FN2A 3O5LA 3PRDA 4IT6A 1B6CA 2RUQA 1W1PA 3ARYA 1FKGA 2AOSA 2UZ5A 3ARRA 1WB0A 2ITKA 2LKNA 2VN1A 1FKLA 4QIBA 1JNEA 4JFKA 5GPRA 2DSZA 3H9RB 3JYJA 1W9UA 1BL4A 2PV2A 4DIPA 4Q22A 4HARA 1T11A 2PBCA 3EY6A 1PBKA 1R9HA 3ALFA 1GOIA 2MLXA 2F2DA 3AS1A 3CHCA 1JNTA 3NRKA 4Q7NA 1H0GA 1NH6A 4ODQA 3KCEA 4N19A 1HJWA 3G6LA 1QPFA 3JXVA 3WQVA 4FAPA 4ODMA 3IKDA 4DT4A 1FAPA 1LQ0A 4ODNA 4LAVA 1UR9A 5JH8A 3CHEA 2KI3A 4WKHA 4IT4A 4P8XA 3AS0A 4Z2JA 3O5KA 4R0XA 3ARUA 4ZPTR 3GPKA 4LAWA 2DT0A 4QT2A 2ZR6A 2ZQUA 2MLYA 2RURA 1NMVA 1A7XA 1JNDA 1Q6UA 1W9PA 3CGNA 4TYOA 4JFJA 1RD6A 4IQCA 3B8SA 4DROA 3KADA 3O5FA 2DSUA 4WKAA 1ZBWA 4Z2HA 1FKJA 1ITXA 2DSVA 2AWGA 4TW8A 4WK9A 5HW7A 1E6PA 2XPBA 2ESCA 3W4RA 1NWTA 1F8AB 3AQUA 1TCOC 1BKFA 1ZBVA 5D75A 1N1AA 3TCZA 1EQ3A 5GQBA 1SR0A 3WD4A 3UI4A 1GUVA 2DT2A 2M1IA 1FKTA 4TX0A 5HKGA 5GPGA 1EIBA 4P8VA 3RM4A 3TC5A 3WL1A 1FKFA 2KGJA 1ZK6A 1FKHA 2K8IA 2DPEA 1M5YA 2WM0A 3IHZA 1KT0A 5DIUA 4XAKA 4S3JA 1Q6IA 1NWUA 3WD2A 4Z2LA 1FD9A 2ZR5A 1FKIA 4O2TA 4DRKA 1FKKA 1FJDA 3WIJA 2WK2A 2A3BA 1LJYA 2Q5AA 2RUDA 2M08A 2RSEA 4DWSA 2A3AA 3BXWA 1FFRA 2F21A 4DZ2A 4Z2GA 1XHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXV A;  3OOB A;  4FAP A;  2KE0 A;  2ZQT A;  2FKE A;  2IF4 A;  3B7X A;  4ODM A;  3KAG A;  2ZQS A;  3IKD A;  4U85 A;  4DT4 A;  1FAP A;  2DG9 A;  2MLZ A;  4ODN A;  4GGQ A;  4NNR A;  1YW5 A;  4IQ2 A;  4LAV A;  5HWC A;  1JNS A;  3I6C A;  3O5J A;  1D7J A;  3O5Q A;  2XP6 A;  3PA7 A;  2MPH A;  5I98 A;  2KI3 A;  1J4R A;  3FAP A;  2KO7 A;  3MDY B;  4ODR A;  3ODK A;  4ODL A;  3UI5 A;  1YAT A;  3O5K A;  4R0X A;  2MF9 A;  3GPK A;  3O5O A;  4U84 A;  3NI6 A;  3O5G A;  2PV3 A;  4LAW A;  1J4I A;  2XP8 A;  1KT1 A;  4QT2 A;  2ZR6 A;  3JYM A;  3NTP A;  2RUC A;  1PIN A;  1NSG A;  2LPV A;  4DRH A;  2F4E A;  2ZQU A;  1FKD A;  2KR7 A;  4GIV A;  2MLY A;  2ZQV A;  3IK8 A;  4LAY A;  2DG3 A;  4U86 A;  1W26 A;  3UQI A;  1Q6H A;  2RUR A;  1P5Q A;  2JZV A;  1NMV A;  2PPP A;  1A7X A;  1Q6U A;  1ROT A;  3KAF A;  5HT1 A;  1NMW A;  2N87 A;  5HUA A;  1EYM A;  3CGN A;  3PRB A;  3VAW A;  1D7H A;  4TYO A;  4DRJ A;  1L1P A;  3O5P A;  4JFJ A;  4TNS A;  4JFL A;  4IQC A;  3O5M A;  4JYS A;  3RFW A;  3KAD A;  3TDB A;  3UI6 A;  2PPO A;  3O5F A;  4DRO A;  4DRQ A;  4MSP A;  3LUO A;  1FKJ A;  3CGM A;  4LAX A;  3UQA A;  3O5R A;  1D7I A;  2VCD A;  4W9P A;  3KAC A;  5HTG A;  1D6O A;  2AWG A;  4TW8 A;  2M2A A;  4ODK A;  5HW7 A;  3WH0 A;  2PV1 A;  5HW6 A;  3RGC A;  1C9H A;  2XPA A;  3KAH A;  2XPB A;  4J4O A;  4FN2 A;  3O5L A;  3PRD A;  4JFM A;  1U79 A;  4DZ3 A;  2LJ4 A;  4IPX A;  1B6C A;  2RUQ A;  2PPN A;  1F8A B;  4G2P A;  1TCO C;  2L2S A;  1BKF A;  2XP9 A;  4G50 A;  4BF8 A;  5D75 A;  3IKG A;  1N1A A;  3O5E A;  4ITZ A;  4W9O A;  1FKG A;  2UZ5 A;  3TCZ A;  1EQ3 A;  2LGO A;  1Y0O A;  2ITK A;  2LKN A;  2VN1 A;  1FKL A;  2KFW A;  4QIB A;  4DRI A;  3UI4 A;  1JVW A;  4JFK A;  2M1I A;  1FKT A;  3H9R B;  3JYJ A;  4TX0 A;  1ROU A;  3KZ7 A;  5HKG A;  1BL4 A;  2PV2 A;  5GPG A;  4TW7 A;  4DIP A;  3TC5 A;  5BXJ A;  1FKB A;  3O5D A;  1FKF A;  2XP4 A;  2KGJ A;  5DIV A;  4DH0 A;  1ZK6 A;  1FKR A;  1T11 A;  1FKH A;  4JFI A;  5DIT A;  2K8I A;  4DRM A;  1M5Y A;  2PBC A;  3IHZ A;  1KT0 A;  3EY6 A;  5J6E A;  1Q1C A;  5DIU A;  1PBK A;  1Q6I A;  1R9H A;  2OFN A;  2XP3 A;  1QPL A;  4TW6 A;  2XP7 A;  3O5I A;  2MLX A;  1FD9 A;  2F2D A;  1HXV A;  5HWB A;  4C02 B;  3KAB A;  1F40 A;  2ZR5 A;  1FKI A;  4O2T A;  4DRK A;  5HW8 A;  1FKK A;  4DRP A;  4J4N A;  1FJD A;  2RQS A;  1JNT A;  2ZR4 A;  4DRN A;  1ZCN A;  3KAI A;  3NRK A;  4ODO A;  2RUD A;  2Q5A A;  4W9Q A;  2M08 A;  4ODP A;  2RSE A;  2XP5 A;  2D9F A;  4MGV A;  1J4H A;  2DG4 A;  1J6Y A;  2MNT A;  5B8I C;  4ODQ A;  1FKS A;  3KCE A;  4N19 A;  2F21 A;  1QZ2 A;  4DZ2 A;  2Y78 A;  3UQB A;  1QPF A;  3UF8 A;  4QT3 A;  2FAP A; 
#chains in the Genus database with same CATH topology
 2ZQT A;  1EDQ A;  4NSB A;  2ZQS A;  4U85 A;  4HBE A;  2MLZ A;  4GGQ A;  5HWC A;  4WKF A;  1X6N A;  3PA7 A;  1OGB A;  1IX5 A;  5I98 A;  1J4R A;  4NZC A;  4MNK A;  1HJX A;  4MNL A;  4ODL A;  4WIW A;  2PV3 A;  1KT1 A;  4R5E A;  3JYM A;  1PIN A;  4DRH A;  5HW8 A;  4LAY A;  3UQI A;  1O6I A;  3PR9 A;  3IK8 A;  1Q6H A;  2PPP A;  2N87 A;  2IUZ A;  3VAW A;  2B31 A;  3AS2 A;  4DRJ A;  4TNS A;  4JFL A;  4MNJ A;  3UI6 A;  3ARS A;  2FDM A;  3CGM A;  4LAX A;  2A3C A;  4ODK A;  5HW6 A;  3RGC A;  4AY1 A;  1LG2 A;  3RM8 A;  1U79 A;  4DZ3 A;  2LJ4 A;  2G8Z A;  3WL0 A;  1NWS A;  2L2S A;  2G41 A;  2XP9 A;  4G50 A;  3IKG A;  4P8U A;  4ITZ A;  3CHF A;  3B9D A;  1W1V A;  5DEZ A;  3B9A A;  4URI A;  1Y0O A;  2KFW A;  1JVW A;  1ROU A;  4ZPV R;  1FKB A;  1ZU8 A;  1FKR A;  4MAV A;  5DIT A;  2PI6 A;  2OFN A;  4TW6 A;  2XP7 A;  3O5I A;  1E44 A;  1W9V A;  4MPK A;  1UR8 A;  4C02 B;  1OWQ A;  3KAB A;  4DRP A;  4J4N A;  2RQS A;  3ARQ A;  4DRN A;  3KAI A;  4ODO A;  4W9Q A;  4ODP A;  3G6M A;  1E15 A;  1LG1 A;  2D9F A;  2XP5 A;  2DG4 A;  5B8I C;  3GU0 A;  1FKS A;  1QZ2 A;  1CTN A;  3BMB A;  4L72 B;  3WD3 A;  3UF8 A;  1LL6 A;  4QT3 A;  4WJX A;  2KE0 A;  1LL7 A;  2IF4 A;  1GPF A;  1KFW A;  1H0I A;  2DG9 A;  1HJV A;  1LL4 A;  4MNM A;  1JNS A;  3I6C A;  3OA5 A;  2XP6 A;  2MPH A;  3WKZ A;  1JCH B;  1EHN A;  2KO7 A;  3MDY B;  4ODR A;  3ODK A;  1ZBK A;  4U84 A;  3NI6 A;  1HKI A;  1J4I A;  2XP8 A;  3FY1 A;  2RUC A;  1NSG A;  2LPV A;  1HKJ A;  2F4E A;  1FKD A;  3WD1 A;  4U86 A;  2YBU A;  4Z2K A;  1W26 A;  4MTV A;  5HT1 A;  1P5Q A;  1ROT A;  2WLY A;  2PN0 A;  1EYM A;  3ARZ A;  5HBF A;  3CZ8 A;  1L1P A;  3QOK A;  3RFW A;  3TDB A;  2PPO A;  4DRQ A;  4DWS C;  4S3K A;  4P8W A;  3O5R A;  1E9L A;  1X6L A;  1D6O A;  1TFV A;  2ETN A;  4DWS D;  3AS3 A;  1FFQ A;  2XPA A;  3GTY X;  2YBT A;  1ZL1 A;  4J4O A;  3ARV A;  4JFM A;  4UDM A;  4W5U A;  4IPX A;  2PPN A;  4G2P A;  4BF8 A;  3ARO A;  3O5E A;  4W9O A;  1W1T A;  4PTM A;  2LGO A;  4DRI A;  3ARX A;  2WLZ A;  1WAW A;  1HKK A;  3KZ7 A;  5BXJ A;  4TW7 A;  3O5D A;  2XP4 A;  4KR0 B;  4ZPW R;  5DIV A;  4DH0 A;  1GRJ A;  5DF0 A;  4JFI A;  4DRM A;  5J6E A;  1Q1C A;  2DT3 A;  4Z2I A;  4LGX A;  2DSW A;  1QPL A;  2XP3 A;  1W1Y A;  1HXV A;  5HWB A;  1F40 A;  1SYT A;  4ZS6 A;  4QZV B;  1K9T A;  2ZR4 A;  1ZCN A;  1NWR A;  4L3N A;  3RM9 A;  3RME A;  1D2K A;  4MGV A;  1J4H A;  1J6Y A;  2MNT A;  2P4V A;  5DO2 A;  2Y78 A;  1E6N A;  3UQB A;  2FAP A;  4KQZ A;  3OOB A;  2QF8 A;  2FKE A;  3B7X A;  3WQW A;  3KAG A;  3PRA A;  4ML4 A;  2O9O A;  3ARW A;  4NNR A;  1YW5 A;  4IQ2 A;  3O5J A;  1D7J A;  3ART A;  3CHD A;  1HKM A;  3O5Q A;  3ALG A;  3FAP A;  3UI5 A;  1YAT A;  1ZBC A;  2O92 A;  3WD0 A;  2MF9 A;  3O5O A;  3O5G A;  3FXY A;  1VF8 A;  1ZB5 A;  3NTP A;  2DT1 A;  4GIV A;  2KR7 A;  2ZQV A;  3B9E A;  2DG3 A;  3CH9 A;  2JZV A;  3KAF A;  1NMW A;  5HUA A;  3PRB A;  4HBO A;  1D7H A;  3O5P A;  3O5M A;  4JYS A;  4DWS B;  1WNO A;  2OLH A;  4MSP A;  3LUO A;  3UQA A;  1D7I A;  2VCD A;  3ARP A;  4W9P A;  3KAC A;  5HTG A;  2M2A A;  3WH0 A;  2PV1 A;  1XRV A;  1E6R A;  1C9H A;  3KAH A;  1E6Z A;  2A3E A;  1OGG A;  4FN2 A;  3O5L A;  3PRD A;  4IT6 A;  1B6C A;  2RUQ A;  1W1P A;  3ARY A;  1FKG A;  2AOS A;  2UZ5 A;  3ARR A;  1WB0 A;  2ITK A;  2LKN A;  2VN1 A;  1FKL A;  4QIB A;  1JNE A;  2EUL A;  4JFK A;  5GPR A;  2DSZ A;  3H9R B;  3JYJ A;  1W9U A;  1BL4 A;  2PV2 A;  4DIP A;  4Q22 A;  4HAR A;  1T11 A;  2PBC A;  3EY6 A;  1PBK A;  1R9H A;  3ALF A;  1GOI A;  2MLX A;  2F2D A;  3AS1 A;  3CHC A;  1JNT A;  3NRK A;  4Q7N A;  1H0G A;  1NH6 A;  4ODQ A;  3KCE A;  4N19 A;  1HJW A;  3G6L A;  1QPF A;  2F23 A;  3JXV A;  3WQV A;  4FAP A;  4ODM A;  3IKD A;  4DT4 A;  1FAP A;  1LQ0 A;  4ODN A;  4LAV A;  1UR9 A;  5JH8 A;  3CHE A;  2KI3 A;  4WKH A;  4IT4 A;  4P8X A;  3AS0 A;  4Z2J A;  3O5K A;  4R0X A;  3ARU A;  4ZPT R;  3GPK A;  4LAW A;  2DT0 A;  4QT2 A;  2ZR6 A;  2ZQU A;  2MLY A;  2RUR A;  1NMV A;  1A7X A;  1JND A;  1Q6U A;  1W9P A;  3CGN A;  4TYO A;  4JFJ A;  1RD6 A;  4IQC A;  3B8S A;  4DRO A;  3KAD A;  3O5F A;  2DSU A;  4WKA A;  1ZBW A;  4Z2H A;  1FKJ A;  1ITX A;  2DSV A;  2AWG A;  4TW8 A;  4WK9 A;  5HW7 A;  1E6P A;  2XPB A;  2ESC A;  2B5U B;  3W4R A;  1NWT A;  1F8A B;  3AQU A;  1TCO C;  1BKF A;  1ZBV A;  5D75 A;  1N1A A;  3TCZ A;  1EQ3 A;  5GQB A;  1SR0 A;  3WD4 A;  3UI4 A;  1GUV A;  2DT2 A;  2M1I A;  1FKT A;  4TX0 A;  5HKG A;  5GPG A;  1EIB A;  4P8V A;  3RM4 A;  3EIP A;  3TC5 A;  1FKF A;  3WL1 A;  2KGJ A;  1ZK6 A;  1FKH A;  2K8I A;  2DPE A;  1M5Y A;  2WM0 A;  3IHZ A;  1KT0 A;  5DIU A;  4XAK A;  4S3J A;  1Q6I A;  1NWU A;  3WD2 A;  4Z2L A;  1FD9 A;  2ZR5 A;  1FKI A;  4O2T A;  4DRK A;  1FKK A;  1FJD A;  3WIJ A;  2WK2 A;  2A3B A;  1LJY A;  2Q5A A;  2RUD A;  2M08 A;  2RSE A;  4DWS A;  2A3A A;  3BXW A;  1FFR A;  2F21 A;  4DZ2 A;  4Z2G A;  1XHG A; 
#chains in the Genus database with same CATH homology
 2ZQT A;  1EDQ A;  4NSB A;  2ZQS A;  4U85 A;  4HBE A;  2MLZ A;  4GGQ A;  5HWC A;  4WKF A;  1X6N A;  3PA7 A;  1OGB A;  1IX5 A;  5I98 A;  1J4R A;  4NZC A;  4MNK A;  1HJX A;  4MNL A;  4ODL A;  4WIW A;  2PV3 A;  1KT1 A;  4R5E A;  3JYM A;  1PIN A;  4DRH A;  5HW8 A;  4LAY A;  3UQI A;  1O6I A;  3PR9 A;  3IK8 A;  1Q6H A;  2PPP A;  2N87 A;  2IUZ A;  3VAW A;  2B31 A;  3AS2 A;  4DRJ A;  4TNS A;  4JFL A;  4MNJ A;  3UI6 A;  3ARS A;  2FDM A;  3CGM A;  4LAX A;  2A3C A;  4ODK A;  5HW6 A;  3RGC A;  4AY1 A;  1LG2 A;  3RM8 A;  1U79 A;  4DZ3 A;  2LJ4 A;  2G8Z A;  3WL0 A;  1NWS A;  2L2S A;  2G41 A;  2XP9 A;  4G50 A;  3IKG A;  4P8U A;  4ITZ A;  3CHF A;  3B9D A;  1W1V A;  5DEZ A;  3B9A A;  4URI A;  1Y0O A;  2KFW A;  1JVW A;  1ROU A;  4ZPV R;  1FKB A;  1ZU8 A;  1FKR A;  4MAV A;  5DIT A;  2PI6 A;  2OFN A;  4TW6 A;  2XP7 A;  3O5I A;  1W9V A;  4MPK A;  1UR8 A;  4C02 B;  1OWQ A;  3KAB A;  4DRP A;  4J4N A;  2RQS A;  3ARQ A;  4DRN A;  3KAI A;  4ODO A;  4W9Q A;  4ODP A;  3G6M A;  1E15 A;  1LG1 A;  2D9F A;  2XP5 A;  2DG4 A;  5B8I C;  1FKS A;  1QZ2 A;  1CTN A;  4L72 B;  3WD3 A;  3UF8 A;  1LL6 A;  4QT3 A;  4WJX A;  2KE0 A;  1LL7 A;  2IF4 A;  1GPF A;  1KFW A;  1H0I A;  2DG9 A;  1HJV A;  1LL4 A;  4MNM A;  1JNS A;  3I6C A;  3OA5 A;  2XP6 A;  2MPH A;  3WKZ A;  1EHN A;  2KO7 A;  3MDY B;  4ODR A;  3ODK A;  1ZBK A;  4U84 A;  3NI6 A;  1HKI A;  1J4I A;  2XP8 A;  3FY1 A;  2RUC A;  1NSG A;  2LPV A;  1HKJ A;  2F4E A;  1FKD A;  3WD1 A;  4U86 A;  2YBU A;  4Z2K A;  1W26 A;  4MTV A;  5HT1 A;  1P5Q A;  1ROT A;  2WLY A;  1EYM A;  3ARZ A;  5HBF A;  3CZ8 A;  1L1P A;  3QOK A;  3RFW A;  3TDB A;  2PPO A;  4DRQ A;  4DWS C;  4S3K A;  4P8W A;  3O5R A;  1E9L A;  1X6L A;  1D6O A;  1TFV A;  4DWS D;  3AS3 A;  1FFQ A;  2XPA A;  2YBT A;  1ZL1 A;  4J4O A;  3ARV A;  4JFM A;  4W5U A;  4IPX A;  2PPN A;  4G2P A;  4BF8 A;  3ARO A;  3O5E A;  4W9O A;  1W1T A;  4PTM A;  2LGO A;  4DRI A;  3ARX A;  2WLZ A;  1WAW A;  1HKK A;  3KZ7 A;  5BXJ A;  4TW7 A;  3O5D A;  2XP4 A;  4KR0 B;  4ZPW R;  5DIV A;  4DH0 A;  5DF0 A;  4JFI A;  4DRM A;  5J6E A;  1Q1C A;  2DT3 A;  4Z2I A;  4LGX A;  2DSW A;  1QPL A;  2XP3 A;  1W1Y A;  1HXV A;  5HWB A;  1F40 A;  1SYT A;  4ZS6 A;  4QZV B;  1K9T A;  2ZR4 A;  1ZCN A;  1NWR A;  4L3N A;  3RM9 A;  3RME A;  1D2K A;  4MGV A;  1J4H A;  1J6Y A;  2MNT A;  5DO2 A;  2Y78 A;  1E6N A;  3UQB A;  2FAP A;  4KQZ A;  3OOB A;  2QF8 A;  2FKE A;  3B7X A;  3WQW A;  3KAG A;  3PRA A;  4ML4 A;  2O9O A;  3ARW A;  4NNR A;  1YW5 A;  4IQ2 A;  3O5J A;  1D7J A;  3ART A;  3CHD A;  1HKM A;  3O5Q A;  3ALG A;  3FAP A;  3UI5 A;  1YAT A;  1ZBC A;  2O92 A;  3WD0 A;  2MF9 A;  3O5O A;  3O5G A;  3FXY A;  1VF8 A;  1ZB5 A;  3NTP A;  2DT1 A;  4GIV A;  2KR7 A;  2ZQV A;  3B9E A;  2DG3 A;  3CH9 A;  2JZV A;  3KAF A;  1NMW A;  5HUA A;  3PRB A;  4HBO A;  1D7H A;  3O5P A;  3O5M A;  4JYS A;  4DWS B;  1WNO A;  2OLH A;  4MSP A;  3LUO A;  3UQA A;  1D7I A;  2VCD A;  3ARP A;  4W9P A;  3KAC A;  5HTG A;  2M2A A;  3WH0 A;  2PV1 A;  1XRV A;  1E6R A;  1C9H A;  3KAH A;  1E6Z A;  2A3E A;  1OGG A;  4FN2 A;  3O5L A;  3PRD A;  4IT6 A;  1B6C A;  2RUQ A;  1W1P A;  3ARY A;  1FKG A;  2AOS A;  2UZ5 A;  3ARR A;  1WB0 A;  2ITK A;  2LKN A;  2VN1 A;  1FKL A;  4QIB A;  1JNE A;  4JFK A;  5GPR A;  2DSZ A;  3H9R B;  3JYJ A;  1W9U A;  1BL4 A;  2PV2 A;  4DIP A;  4Q22 A;  4HAR A;  1T11 A;  2PBC A;  3EY6 A;  1PBK A;  1R9H A;  3ALF A;  1GOI A;  2MLX A;  2F2D A;  3AS1 A;  3CHC A;  1JNT A;  3NRK A;  4Q7N A;  1H0G A;  1NH6 A;  4ODQ A;  3KCE A;  4N19 A;  1HJW A;  3G6L A;  1QPF A;  3JXV A;  3WQV A;  4FAP A;  4ODM A;  3IKD A;  4DT4 A;  1FAP A;  1LQ0 A;  4ODN A;  4LAV A;  1UR9 A;  5JH8 A;  3CHE A;  2KI3 A;  4WKH A;  4IT4 A;  4P8X A;  3AS0 A;  4Z2J A;  3O5K A;  4R0X A;  3ARU A;  4ZPT R;  3GPK A;  4LAW A;  2DT0 A;  4QT2 A;  2ZR6 A;  2ZQU A;  2MLY A;  2RUR A;  1NMV A;  1A7X A;  1JND A;  1Q6U A;  1W9P A;  3CGN A;  4TYO A;  4JFJ A;  1RD6 A;  4IQC A;  3B8S A;  4DRO A;  3KAD A;  3O5F A;  2DSU A;  4WKA A;  1ZBW A;  4Z2H A;  1FKJ A;  1ITX A;  2DSV A;  2AWG A;  4TW8 A;  4WK9 A;  5HW7 A;  1E6P A;  2XPB A;  2ESC A;  3W4R A;  1NWT A;  1F8A B;  3AQU A;  1TCO C;  1BKF A;  1ZBV A;  5D75 A;  1N1A A;  3TCZ A;  1EQ3 A;  5GQB A;  1SR0 A;  3WD4 A;  3UI4 A;  1GUV A;  2DT2 A;  2M1I A;  1FKT A;  4TX0 A;  5HKG A;  5GPG A;  1EIB A;  4P8V A;  3RM4 A;  3TC5 A;  3WL1 A;  1FKF A;  2KGJ A;  1ZK6 A;  1FKH A;  2K8I A;  2DPE A;  1M5Y A;  2WM0 A;  3IHZ A;  1KT0 A;  5DIU A;  4XAK A;  4S3J A;  1Q6I A;  1NWU A;  3WD2 A;  4Z2L A;  1FD9 A;  2ZR5 A;  1FKI A;  4O2T A;  4DRK A;  1FKK A;  1FJD A;  3WIJ A;  2WK2 A;  2A3B A;  1LJY A;  2Q5A A;  2RUD A;  2M08 A;  2RSE A;  4DWS A;  2A3A A;  3BXW A;  1FFR A;  2F21 A;  4DZ2 A;  4Z2G A;  1XHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...