2M08A

The solution structure of nmpin, the parvuline of nitrosopumilus maritimus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
GPSNKIKCSHILVSKQSEALAIMEKLKSGEKFGKLAKELSIDSGSAKKNGNLGYFTKGMMVKPFEDAAFKLQVGEVSEPIKSEFGYHIIKRFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NmPin from the marine thaumarchaeote Nitrosopumilus maritimus is an active membrane associated prolyl isomerase.
pubmed doi rcsb
source organism Nitrosopumilus maritimus
molecule tags Isomerase
molecule keywords PpiC-type peptidyl-prolyl cis-trans isomerase
total genus 14
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2012-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2m08A00
3TC5A 2ZR5A 5DIUA 4ITZA 4W9PA 4JYSA 4LAYA 3PRBA 3PRDA 2UZ5A 1EQ3A 4DRNA 4ODLA 1L1PA 1NSGA 1T11A 2K8IA 4TW7A 3KAHA 1HXVA 2AWGA 5HUAA 2RUDA 4N19A 1D7IA 1FKLA 1YATA 3KZ7A 3O5MA 4LAXA 1Q6IA 4J4NA 3NTPA 3WH0A 4DRIA 5HW7A 1J6YA 1Y0OA 2M08A 3O5LA 2F21A 4O2TA 3O5OA 4U84A 3VAWA 4ODNA 3RGCA 2L2SA 1FKBA 2OFNA 4JFMA 1FKFA 2RURA 2VN1A 1U79A 2XP4A 1BKFA 2ZR4A 2ZQUA 4QT3A 2VCDA 3KAGA 5HTGA 3UQIA 4W9QA 2KGJA 2LPVA 1BL4A 1B6CA 1YW5A 3IHZA 2Y78A 4TYOA 4ODPA 3KADA 2Q5AA 4DT4A 1F40A 1Q1CA 3NI6A 1ROTA 3CGMA 1KT1A 4J4OA 3PA7A 2MF9A 3IK8A 1JNTA 4ODQA 1QPFA 2PV2A 1J4RA 2XP9A 5GPGA 4QIBA 1P5QA 1D7HA 2MLYA 3H9RB 3O5PA 1FD9A 4R0XA 2FKEA 3O5QA 1A7XA 1FKSA 2RUCA 1ZCNA 2XPBA 4IQCA 4JFIA 4DH0A 2MLZA 3KACA 4ODMA 3JYJA 1J4HA 1FKDA 4W9OA 4U85A 3B7XA 3O5GA 4DRJA 2DG3A 5B8IC 4FAPA 1FKTA 5BXJA 5J6EA 3UI4A 2DG9A 1F8AB 3O5RA 2PV1A 4DZ2A 1PINA 2F2DA 4GGQA 1D7JA 5HW6A 4FN2A 3KAIA 1FKGA 2XP8A 4G2PA 3GPKA 1NMVA 4ODRA 2F4EA 3FAPA 2IF4A 3KABA 2XPAA 3TDBA 4MSPA 3RFWA 4TW8A 4TNSA 5DITA 2JZVA 4DZ3A 2RQSA 4DRPA 3UQAA 4DRQA 4IQ2A 1NMWA 2DG4A 2LKNA 4G50A 3CGNA 2KI3A 1PBKA 1FAPA 1Q6UA 2M1IA 2MPHA 4BF8A 2XP7A 4DROA 5HKGA 1W26A 3LUOA 2XP5A 4QT2A 3TCZA 1EYMA 4LAWA 4LAVA 2MNTA 3O5DA 1ZK6A 4DRHA 5HWBA 3I6CA 4DRKA 3ODKA 2XP6A 2PV3A 1N1AA 2PPNA 2RUQA 1M5YA 1ROUA 4JFKA 2KE0A 4NNRA 4IPXA 3UI5A 3KCEA 5HWCA 2KR7A 4U86A 4MGVA 1FJDA 2LJ4A 2D9FA 3O5EA 4ODKA 4TW6A 3EY6A 2ZR6A 1D6OA 3IKDA 4GIVA 5D75A 2PPPA 3O5FA 1FKKA 1Q6HA 4JFLA 3OOBA 4TX0A 2MLXA 3O5JA 2N87A 3O5KA 1JVWA 1JNSA 3JYMA 2PPOA 5DIVA 2KO7A 3O5IA 1FKRA 3UF8A 1QPLA 1R9HA 1C9HA 3JXVA 2KFWA 4DIPA 2XP3A 3NRKA 1FKIA 4DRMA 3UQBA 4JFJA 2RSEA 1TCOC 2ZQSA 1J4IA 4ODOA 3IKGA 1QZ2A 1FKJA 3UI6A 2ITKA 5HT1A 2PBCA 3KAFA 2FAPA 2ZQTA 4C02B 2ZQVA 1KT0A 2M2AA 1FKHA 2LGOA 3MDYB 5HW8A 5I98A
chains in the Genus database with same CATH superfamily
1OGBA 3TC5A 3BXWA 3ARYA 2DT3A 3ARQA 1JNEA 4LAYA 1EQ3A 1L1PA 4IT6A 2RUDA 1JNDA 1YATA 1WB0A 4DRIA 5HW7A 1Q6IA 3B9EA 3O5LA 2F21A 4Z2GA 1JCHB 3RGCA 1KFWA 2L2SA 2XP4A 2RURA 4LGXA 2ZR4A 4QT3A 2ZQUA 2VCDA 4KR0B 2YBUA 1YW5A 1E6RA 4DT4A 4MNJA 1ROTA 3CGMA 1KT1A 4J4OA 3PA7A 1HKIA 2MF9A 1JNTA 3GTYX 1QPFA 3CHFA 4QIBA 2FKEA 3O5QA 4P8XA 2XPBA 1ZCNA 2MLZA 1J4HA 4WK9A 4DRJA 3ARZA 1FKTA 1NWTA 1F8AB 1E6PA 1PINA 1O6IA 4GGQA 1FKGA 4G2PA 4ODRA 4UDMA 2F4EA 2P4VA 1LL7A 2IF4A 3FAPA 2WLYA 4MTVA 4TNSA 3WD2A 2RQSA 1LL4A 4WJXA 2EULA 4NZCA 4IQ2A 4DRQA 3CGNA 4P8VA 4PTMA 3WQVA 2KI3A 1FAPA 2MPHA 2XP7A 2AOSA 1EYMA 2B31A 2MNTA 4URIA 3ODKA 4NSBA 4JFKA 3UI5A 1ITXA 3KCEA 4U86A 4MGVA 2D9FA 1GPFA 4TW6A 1D6OA 3IKDA 4MNMA 5D75A 2PPPA 1FKKA 1Q6HA 2DPEA 4TX0A 1HKMA 2DT2A 2N87A 3O5KA 1JVWA 3RM9A 3JYMA 1HKKA 4WKFA 3WL0A 1E6ZA 1QPLA 1W1TA 3ARUA 2G8ZA 4DIPA 3UI6A 1H0GA 2PBCA 3RM4A 4Q7NA 5HW8A 5I98A 3AS1A 3WD1A 1SYTA 2UZ5A 4DRNA 4ODLA 2K8IA 3KAHA 2AWGA 5HUAA 5HT1A 4N19A 3AROA 3O5MA 3NTPA 1Y0OA 4O2TA 3O5OA 4S3JA 2OFNA 1IX5A 3BMBA 3UQIA 1ZBWA 2LPVA 1BL4A 3IHZA 2Q5AA 3ARPA 1Q1CA 2F23A 3NI6A 3IK8A 4ODQA 2PV2A 1J4RA 1LG1A 2MLYA 4MPKA 4W5UA 4IQCA 4DH0A 4DWSB 3WKZA 2DSWA 1LJYA 4R5EA 2PN0A 2DG3A 2ESCA 3AS0A 5BXJA 5HBFA 2F2DA 3KAIA 1HJWA 2XP8A 1GOIA 3PRAA 3WQWA 4MSPA 3RFWA 1SR0A 2JZVA 1NMWA 1LL6A 1PBKA 4Z2JA 4IT4A 3ALFA 3LUOA 4QT2A 1ZK6A 5HWBA 3I6CA 3OA5A 1N1AA 5DF0A 1FFQA 3W4RA 4NNRA 1RD6A 4P8UA 1WNOA 5HWCA 1E44A 5GQBA 4ODKA 3ARVA 3EY6A 1ZBVA 1X6NA 3O5FA 4JFLA 2O92A 4HBEA 3WD3A 4MNKA 1UR8A 1R9HA 1FFRA 3AS3A 1ZB5A 4ZPTR 3FXYA 2RSEA 3B9AA 2ZQSA 3IKGA 2ITKA 2FAPA 4C02B 2M2AA 4U84A 3MDYB 2ETNA 3CHCA 4W9PA 4JYSA 1VF8A 3PRBA 3PRDA 1NSGA 4MAVA 1HXVA 1NWSA 1W1VA 2DT1A 3KZ7A 3WH0A 4LAXA 4J4NA 2WM0A 3B8SA 1J6YA 1HKJA 3VAWA 1FKBA 4JFMA 1FKFA 2OLHA 2VN1A 1U79A 1H0IA 4ML4A 3KAGA 2B5UB 4W9QA 1F40A 2Y78A 4ODPA 3KADA 3G6LA 1GRJA 1CTNA 4Z2KA 2XP9A 3RMEA 4WKAA 1P5QA 1D7HA 3H9RB 4P8WA 1FKSA 2A3AA 2RUCA 4ODMA 3JYJA 1FKDA 1OWQA 4W9OA 4U85A 3B7XA 4KQZA 4ZS6A 4FAPA 2O9OA 3UI4A 4FN2A 1NH6A 3GPKA 1X6LA 2XPAA 4TW8A 5DITA 3FY1A 3QOKA 1GUVA 2LKNA 4G50A 3CHEA 5GPRA 2FDMA 4DROA 3PR9A 5HKGA 2XP5A 3ARTA 3ARRA 3TCZA 4LAWA 4LAVA 3O5DA 4Z2HA 4DRHA 4DRKA 4Q22A 2WK2A 4S3KA 4XAKA 3RM8A 2XP6A 1M5YA 3CZ8A 1HJXA 2KR7A 1NWUA 1W1YA 1K9TA 2LJ4A 3O5EA 1LG2A 2ZR6A 3ARWA 3AS2A 2DSVA 2MLXA 3GU0A 1HJVA 4ZPVR 1W9UA 1JNSA 5DIVA 3O5IA 1FKRA 2A3EA 1EHNA 1E15A 4ZPWR 5DO2A 1C9HA 3JXVA 1W9VA 3CHDA 4HARA 1FKIA 3UQBA 4JFJA 1TCOC 1QZ2A 1FKJA 3WIJA 2ZQTA 3O5GA 2DT0A 2ZR5A 3ARXA 5DIUA 4ITZA 3ARSA 1T11A 2DSZA 4TW7A 1D7IA 1FKLA 3EIPA 2M08A 2IUZA 2A3BA 4ODNA 5HTGA 1BKFA 1UR9A 3UF8A 2KGJA 4TYOA 1B6CA 4DWSC 4AY1A 5GPGA 3O5PA 1ZL1A 1EDQA 1FD9A 4R0XA 3WL1A 3WD0A 1A7XA 4JFIA 2QF8A 3KACA 4WKHA 1ZBKA 5B8IC 5J6EA 5JH8A 2DG9A 3O5RA 2PV1A 4DZ2A 1D7JA 1ZBCA 5HW6A 3CH9A 1NMVA 1LQ0A 4MNLA 3KABA 3TDBA 1W9PA 1XHGA 1NWRA 3WD4A 4DZ3A 4DRPA 3UQAA 1OGGA 1XRVA 1E9LA 2DG4A 2DSUA 1D2KA 5DEZA 1Q6UA 2M1IA 1E6NA 4BF8A 1ZU8A 4DWSD 4L3NA 1W26A 4QZVB 3AQUA 2PV3A 2PPNA 2RUQA 1ROUA 2A3CA 2KE0A 4IPXA 4L72B 4DWSA 1FJDA 2PI6A 4GIVA 4WIWA 4Z2IA 3OOBA 1TFVA 3G6MA 3O5JA 1W1PA 2KO7A 4HBOA 3ALGA 2G41A 2KFWA 1WAWA 2XP3A 3NRKA 2WLZA 2YBTA 4DRMA 1J4IA 1EIBA 4ODOA 4Z2LA 3KAFA 2LGOA 3B9DA 2ZQVA 1KT0A 1FKHA 2PPOA
chains in the Genus database with same CATH topology
1OGBA 3TC5A 3BXWA 3ARYA 2DT3A 3ARQA 1JNEA 4LAYA 1EQ3A 1L1PA 4IT6A 2RUDA 1JNDA 1YATA 1WB0A 4DRIA 5HW7A 1Q6IA 3B9EA 3O5LA 2F21A 4Z2GA 3RGCA 1KFWA 2L2SA 2XP4A 2RURA 4LGXA 2ZR4A 4QT3A 2ZQUA 2VCDA 4KR0B 2YBUA 1YW5A 1E6RA 4DT4A 4MNJA 1ROTA 3CGMA 1KT1A 4J4OA 3PA7A 1HKIA 2MF9A 1JNTA 1QPFA 3CHFA 4QIBA 2FKEA 3O5QA 4P8XA 2XPBA 1ZCNA 2MLZA 1J4HA 4WK9A 4DRJA 3ARZA 1FKTA 1NWTA 1F8AB 1E6PA 1PINA 1O6IA 4GGQA 1FKGA 4G2PA 4ODRA 2F4EA 3FAPA 1LL7A 2IF4A 2WLYA 4MTVA 4TNSA 3WD2A 2RQSA 1LL4A 4WJXA 4NZCA 4DRQA 4IQ2A 3CGNA 4P8VA 4PTMA 3WQVA 2KI3A 1FAPA 2MPHA 2XP7A 2AOSA 1EYMA 2B31A 2MNTA 4URIA 3ODKA 4NSBA 4JFKA 3UI5A 1ITXA 3KCEA 4U86A 4MGVA 2D9FA 1GPFA 4TW6A 1D6OA 3IKDA 4MNMA 5D75A 2PPPA 1FKKA 1Q6HA 2DPEA 4TX0A 1HKMA 2DT2A 2N87A 3O5KA 1JVWA 3RM9A 3JYMA 1HKKA 4WKFA 3WL0A 1E6ZA 1QPLA 1W1TA 3ARUA 2G8ZA 4DIPA 3UI6A 1H0GA 2PBCA 3RM4A 4Q7NA 5HW8A 5I98A 3AS1A 3WD1A 1SYTA 2UZ5A 4DRNA 4ODLA 2K8IA 3KAHA 2AWGA 5HUAA 5HT1A 4N19A 3AROA 3O5MA 3NTPA 1Y0OA 4O2TA 3O5OA 4S3JA 2OFNA 1IX5A 3UQIA 1ZBWA 2LPVA 1BL4A 3IHZA 2Q5AA 3ARPA 1Q1CA 3NI6A 3IK8A 4ODQA 2PV2A 1J4RA 1LG1A 2MLYA 4MPKA 4W5UA 4IQCA 4DH0A 4DWSB 3WKZA 2DSWA 1LJYA 4R5EA 2DG3A 2ESCA 3AS0A 5BXJA 5HBFA 2F2DA 3KAIA 1HJWA 2XP8A 1GOIA 3PRAA 3WQWA 4MSPA 3RFWA 1SR0A 2JZVA 1NMWA 1LL6A 1PBKA 4Z2JA 4IT4A 3ALFA 3LUOA 4QT2A 1ZK6A 5HWBA 3I6CA 3OA5A 1N1AA 5DF0A 1FFQA 3W4RA 4NNRA 1RD6A 4P8UA 1WNOA 5HWCA 5GQBA 4ODKA 3ARVA 3EY6A 1ZBVA 1X6NA 3O5FA 4JFLA 2O92A 4HBEA 3WD3A 4MNKA 1UR8A 1R9HA 1FFRA 3AS3A 1ZB5A 4ZPTR 3FXYA 2RSEA 3B9AA 2ZQSA 3IKGA 2ITKA 2FAPA 4C02B 2M2AA 4U84A 3MDYB 3CHCA 4W9PA 4JYSA 1VF8A 3PRBA 3PRDA 1NSGA 4MAVA 1HXVA 1NWSA 1W1VA 2DT1A 3KZ7A 3WH0A 4LAXA 4J4NA 2WM0A 3B8SA 1J6YA 1HKJA 3VAWA 1FKBA 4JFMA 1FKFA 2OLHA 2VN1A 1U79A 1H0IA 4ML4A 3KAGA 4W9QA 1F40A 2Y78A 4ODPA 3KADA 3G6LA 1CTNA 4Z2KA 2XP9A 3RMEA 4WKAA 1P5QA 1D7HA 3H9RB 4P8WA 1FKSA 2A3AA 2RUCA 4ODMA 3JYJA 1FKDA 1OWQA 4W9OA 4U85A 3B7XA 4KQZA 4ZS6A 4FAPA 2O9OA 3UI4A 4FN2A 1NH6A 3GPKA 1X6LA 2XPAA 4TW8A 5DITA 3FY1A 3QOKA 1GUVA 2LKNA 4G50A 3CHEA 5GPRA 2FDMA 4DROA 3PR9A 5HKGA 2XP5A 3ARTA 3ARRA 3TCZA 4LAWA 4LAVA 3O5DA 4Z2HA 4DRHA 4DRKA 4Q22A 2WK2A 4S3KA 4XAKA 3RM8A 2XP6A 1M5YA 3CZ8A 1HJXA 2KR7A 1NWUA 1W1YA 1K9TA 2LJ4A 3O5EA 1LG2A 2ZR6A 3ARWA 3AS2A 2DSVA 2MLXA 1HJVA 4ZPVR 1W9UA 1JNSA 5DIVA 3O5IA 1FKRA 2A3EA 1EHNA 1E15A 4ZPWR 5DO2A 1C9HA 3JXVA 1W9VA 3CHDA 4HARA 1FKIA 3UQBA 4JFJA 1TCOC 1QZ2A 1FKJA 3WIJA 2ZQTA 3O5GA 2DT0A 2ZR5A 3ARXA 5DIUA 4ITZA 3ARSA 1T11A 2DSZA 4TW7A 1D7IA 1FKLA 2M08A 2IUZA 2A3BA 4ODNA 5HTGA 1BKFA 1UR9A 3UF8A 2KGJA 4TYOA 1B6CA 4DWSC 4AY1A 5GPGA 3O5PA 1ZL1A 1EDQA 1FD9A 4R0XA 3WL1A 3WD0A 1A7XA 4JFIA 2QF8A 3KACA 4WKHA 1ZBKA 5B8IC 5J6EA 5JH8A 2DG9A 3O5RA 2PV1A 4DZ2A 1D7JA 1ZBCA 5HW6A 3CH9A 1NMVA 1LQ0A 4MNLA 3KABA 3TDBA 1W9PA 1XHGA 1NWRA 3WD4A 4DZ3A 4DRPA 3UQAA 1OGGA 1XRVA 1E9LA 2DG4A 2DSUA 1D2KA 5DEZA 1Q6UA 2M1IA 1E6NA 4BF8A 1ZU8A 4DWSD 4L3NA 1W26A 4QZVB 3AQUA 2PV3A 2PPNA 2RUQA 1ROUA 2A3CA 2KE0A 4IPXA 4L72B 4DWSA 1FJDA 2PI6A 4GIVA 4WIWA 4Z2IA 3OOBA 1TFVA 3G6MA 3O5JA 1W1PA 2KO7A 4HBOA 3ALGA 2G41A 2KFWA 1WAWA 2XP3A 3NRKA 2WLZA 2YBTA 4DRMA 1J4IA 1EIBA 4ODOA 4Z2LA 3KAFA 2LGOA 3B9DA 2ZQVA 1KT0A 1FKHA 2PPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TC5 A;  2ZR5 A;  5DIU A;  4ITZ A;  4W9P A;  4JYS A;  4LAY A;  3PRB A;  3PRD A;  2UZ5 A;  1EQ3 A;  4DRN A;  4ODL A;  1L1P A;  1NSG A;  1T11 A;  2K8I A;  4TW7 A;  3KAH A;  1HXV A;  2AWG A;  5HUA A;  2RUD A;  4N19 A;  1D7I A;  1FKL A;  1YAT A;  3KZ7 A;  3O5M A;  4LAX A;  1Q6I A;  4J4N A;  3NTP A;  3WH0 A;  4DRI A;  5HW7 A;  1J6Y A;  1Y0O A;  2M08 A;  3O5L A;  2F21 A;  4O2T A;  3O5O A;  4U84 A;  3VAW A;  4ODN A;  3RGC A;  2L2S A;  1FKB A;  2OFN A;  4JFM A;  1FKF A;  2RUR A;  2VN1 A;  1U79 A;  2XP4 A;  1BKF A;  2ZR4 A;  2ZQU A;  4QT3 A;  2VCD A;  3KAG A;  5HTG A;  3UQI A;  4W9Q A;  2KGJ A;  2LPV A;  1BL4 A;  1B6C A;  1YW5 A;  3IHZ A;  2Y78 A;  4TYO A;  4ODP A;  3KAD A;  2Q5A A;  4DT4 A;  1F40 A;  1Q1C A;  3NI6 A;  1ROT A;  3CGM A;  1KT1 A;  4J4O A;  3PA7 A;  2MF9 A;  3IK8 A;  1JNT A;  4ODQ A;  1QPF A;  2PV2 A;  1J4R A;  2XP9 A;  5GPG A;  4QIB A;  1P5Q A;  1D7H A;  2MLY A;  3H9R B;  3O5P A;  1FD9 A;  4R0X A;  2FKE A;  3O5Q A;  1A7X A;  1FKS A;  2RUC A;  1ZCN A;  2XPB A;  4IQC A;  4JFI A;  4DH0 A;  2MLZ A;  3KAC A;  4ODM A;  3JYJ A;  1J4H A;  1FKD A;  4W9O A;  4U85 A;  3B7X A;  3O5G A;  4DRJ A;  2DG3 A;  5B8I C;  4FAP A;  1FKT A;  5BXJ A;  5J6E A;  3UI4 A;  2DG9 A;  1F8A B;  3O5R A;  2PV1 A;  4DZ2 A;  1PIN A;  2F2D A;  4GGQ A;  1D7J A;  5HW6 A;  4FN2 A;  3KAI A;  1FKG A;  2XP8 A;  4G2P A;  3GPK A;  1NMV A;  4ODR A;  2F4E A;  3FAP A;  2IF4 A;  3KAB A;  2XPA A;  3TDB A;  4MSP A;  3RFW A;  4TW8 A;  4TNS A;  5DIT A;  2JZV A;  4DZ3 A;  2RQS A;  4DRP A;  3UQA A;  4DRQ A;  4IQ2 A;  1NMW A;  2DG4 A;  2LKN A;  4G50 A;  3CGN A;  2KI3 A;  1PBK A;  1FAP A;  1Q6U A;  2M1I A;  2MPH A;  4BF8 A;  2XP7 A;  4DRO A;  5HKG A;  1W26 A;  3LUO A;  2XP5 A;  4QT2 A;  3TCZ A;  1EYM A;  4LAW A;  4LAV A;  2MNT A;  3O5D A;  1ZK6 A;  4DRH A;  5HWB A;  3I6C A;  4DRK A;  3ODK A;  2XP6 A;  2PV3 A;  1N1A A;  2PPN A;  2RUQ A;  1M5Y A;  1ROU A;  4JFK A;  2KE0 A;  4NNR A;  4IPX A;  3UI5 A;  3KCE A;  5HWC A;  2KR7 A;  4U86 A;  4MGV A;  1FJD A;  2LJ4 A;  2D9F A;  3O5E A;  4ODK A;  4TW6 A;  3EY6 A;  2ZR6 A;  1D6O A;  3IKD A;  4GIV A;  5D75 A;  2PPP A;  3O5F A;  1FKK A;  1Q6H A;  4JFL A;  3OOB A;  4TX0 A;  2MLX A;  3O5J A;  2N87 A;  3O5K A;  1JVW A;  1JNS A;  3JYM A;  2PPO A;  5DIV A;  2KO7 A;  3O5I A;  1FKR A;  3UF8 A;  1QPL A;  1R9H A;  1C9H A;  3JXV A;  2KFW A;  4DIP A;  2XP3 A;  3NRK A;  1FKI A;  4DRM A;  3UQB A;  4JFJ A;  2RSE A;  1TCO C;  2ZQS A;  1J4I A;  4ODO A;  3IKG A;  1QZ2 A;  1FKJ A;  3UI6 A;  2ITK A;  5HT1 A;  2PBC A;  3KAF A;  2FAP A;  2ZQT A;  4C02 B;  2ZQV A;  1KT0 A;  2M2A A;  1FKH A;  2LGO A;  3MDY B;  5HW8 A;  5I98 A; 
#chains in the Genus database with same CATH topology
 1OGB A;  3TC5 A;  3BXW A;  3ARY A;  2DT3 A;  3ARQ A;  1JNE A;  4LAY A;  1EQ3 A;  1L1P A;  4IT6 A;  2RUD A;  1JND A;  1YAT A;  1WB0 A;  4DRI A;  5HW7 A;  1Q6I A;  3B9E A;  3O5L A;  2F21 A;  4Z2G A;  1JCH B;  3RGC A;  1KFW A;  2L2S A;  2XP4 A;  2RUR A;  4LGX A;  2ZR4 A;  4QT3 A;  2ZQU A;  2VCD A;  4KR0 B;  2YBU A;  1YW5 A;  1E6R A;  4DT4 A;  4MNJ A;  1ROT A;  3CGM A;  1KT1 A;  4J4O A;  3PA7 A;  1HKI A;  2MF9 A;  1JNT A;  3GTY X;  1QPF A;  3CHF A;  4QIB A;  2FKE A;  3O5Q A;  4P8X A;  2XPB A;  1ZCN A;  2MLZ A;  1J4H A;  4WK9 A;  4DRJ A;  3ARZ A;  1FKT A;  1NWT A;  1F8A B;  1E6P A;  1PIN A;  1O6I A;  4GGQ A;  1FKG A;  4G2P A;  4ODR A;  4UDM A;  2F4E A;  2P4V A;  1LL7 A;  2IF4 A;  3FAP A;  2WLY A;  4MTV A;  4TNS A;  3WD2 A;  2RQS A;  1LL4 A;  4WJX A;  2EUL A;  4NZC A;  4IQ2 A;  4DRQ A;  3CGN A;  4P8V A;  4PTM A;  3WQV A;  2KI3 A;  1FAP A;  2MPH A;  2XP7 A;  2AOS A;  1EYM A;  2B31 A;  2MNT A;  4URI A;  3ODK A;  4NSB A;  4JFK A;  3UI5 A;  1ITX A;  3KCE A;  4U86 A;  4MGV A;  2D9F A;  1GPF A;  4TW6 A;  1D6O A;  3IKD A;  4MNM A;  5D75 A;  2PPP A;  1FKK A;  1Q6H A;  2DPE A;  4TX0 A;  1HKM A;  2DT2 A;  2N87 A;  3O5K A;  1JVW A;  3RM9 A;  3JYM A;  1HKK A;  4WKF A;  3WL0 A;  1E6Z A;  1QPL A;  1W1T A;  3ARU A;  2G8Z A;  4DIP A;  3UI6 A;  1H0G A;  2PBC A;  3RM4 A;  4Q7N A;  5HW8 A;  5I98 A;  3AS1 A;  3WD1 A;  1SYT A;  2UZ5 A;  4DRN A;  4ODL A;  2K8I A;  3KAH A;  2AWG A;  5HUA A;  5HT1 A;  4N19 A;  3ARO A;  3O5M A;  3NTP A;  1Y0O A;  4O2T A;  3O5O A;  4S3J A;  2OFN A;  1IX5 A;  3BMB A;  3UQI A;  1ZBW A;  2LPV A;  1BL4 A;  3IHZ A;  2Q5A A;  3ARP A;  1Q1C A;  2F23 A;  3NI6 A;  3IK8 A;  4ODQ A;  2PV2 A;  1J4R A;  1LG1 A;  2MLY A;  4MPK A;  4W5U A;  4IQC A;  4DH0 A;  4DWS B;  3WKZ A;  2DSW A;  1LJY A;  4R5E A;  2PN0 A;  2DG3 A;  2ESC A;  3AS0 A;  5BXJ A;  5HBF A;  2F2D A;  3KAI A;  1HJW A;  2XP8 A;  1GOI A;  3PRA A;  3WQW A;  4MSP A;  3RFW A;  1SR0 A;  2JZV A;  1NMW A;  1LL6 A;  1PBK A;  4Z2J A;  4IT4 A;  3ALF A;  3LUO A;  4QT2 A;  1ZK6 A;  5HWB A;  3I6C A;  3OA5 A;  1N1A A;  5DF0 A;  1FFQ A;  3W4R A;  4NNR A;  1RD6 A;  4P8U A;  1WNO A;  5HWC A;  1E44 A;  5GQB A;  4ODK A;  3ARV A;  3EY6 A;  1ZBV A;  1X6N A;  3O5F A;  4JFL A;  2O92 A;  4HBE A;  3WD3 A;  4MNK A;  1UR8 A;  1R9H A;  1FFR A;  3AS3 A;  1ZB5 A;  4ZPT R;  3FXY A;  2RSE A;  3B9A A;  2ZQS A;  3IKG A;  2ITK A;  2FAP A;  4C02 B;  2M2A A;  4U84 A;  3MDY B;  2ETN A;  3CHC A;  4W9P A;  4JYS A;  1VF8 A;  3PRB A;  3PRD A;  1NSG A;  4MAV A;  1HXV A;  1NWS A;  1W1V A;  2DT1 A;  3KZ7 A;  3WH0 A;  4LAX A;  4J4N A;  2WM0 A;  3B8S A;  1J6Y A;  1HKJ A;  3VAW A;  1FKB A;  4JFM A;  1FKF A;  2OLH A;  2VN1 A;  1U79 A;  1H0I A;  4ML4 A;  3KAG A;  2B5U B;  4W9Q A;  1F40 A;  2Y78 A;  4ODP A;  3KAD A;  3G6L A;  1GRJ A;  1CTN A;  4Z2K A;  2XP9 A;  3RME A;  4WKA A;  1P5Q A;  1D7H A;  3H9R B;  4P8W A;  1FKS A;  2A3A A;  2RUC A;  4ODM A;  3JYJ A;  1FKD A;  1OWQ A;  4W9O A;  4U85 A;  3B7X A;  4KQZ A;  4ZS6 A;  4FAP A;  2O9O A;  3UI4 A;  4FN2 A;  1NH6 A;  3GPK A;  1X6L A;  2XPA A;  4TW8 A;  5DIT A;  3FY1 A;  3QOK A;  1GUV A;  2LKN A;  4G50 A;  3CHE A;  5GPR A;  2FDM A;  4DRO A;  3PR9 A;  5HKG A;  2XP5 A;  3ART A;  3ARR A;  3TCZ A;  4LAW A;  4LAV A;  3O5D A;  4Z2H A;  4DRH A;  4DRK A;  4Q22 A;  2WK2 A;  4S3K A;  4XAK A;  3RM8 A;  2XP6 A;  1M5Y A;  3CZ8 A;  1HJX A;  2KR7 A;  1NWU A;  1W1Y A;  1K9T A;  2LJ4 A;  3O5E A;  1LG2 A;  2ZR6 A;  3ARW A;  3AS2 A;  2DSV A;  2MLX A;  3GU0 A;  1HJV A;  4ZPV R;  1W9U A;  1JNS A;  5DIV A;  3O5I A;  1FKR A;  2A3E A;  1EHN A;  1E15 A;  4ZPW R;  5DO2 A;  1C9H A;  3JXV A;  1W9V A;  3CHD A;  4HAR A;  1FKI A;  3UQB A;  4JFJ A;  1TCO C;  1QZ2 A;  1FKJ A;  3WIJ A;  2ZQT A;  3O5G A;  2DT0 A;  2ZR5 A;  3ARX A;  5DIU A;  4ITZ A;  3ARS A;  1T11 A;  2DSZ A;  4TW7 A;  1D7I A;  1FKL A;  3EIP A;  2M08 A;  2IUZ A;  2A3B A;  4ODN A;  5HTG A;  1BKF A;  1UR9 A;  3UF8 A;  2KGJ A;  4TYO A;  1B6C A;  4DWS C;  4AY1 A;  5GPG A;  3O5P A;  1ZL1 A;  1EDQ A;  1FD9 A;  4R0X A;  3WL1 A;  3WD0 A;  1A7X A;  4JFI A;  2QF8 A;  3KAC A;  4WKH A;  1ZBK A;  5B8I C;  5J6E A;  5JH8 A;  2DG9 A;  3O5R A;  2PV1 A;  4DZ2 A;  1D7J A;  1ZBC A;  5HW6 A;  3CH9 A;  1NMV A;  1LQ0 A;  4MNL A;  3KAB A;  3TDB A;  1W9P A;  1XHG A;  1NWR A;  3WD4 A;  4DZ3 A;  4DRP A;  3UQA A;  1OGG A;  1XRV A;  1E9L A;  2DG4 A;  2DSU A;  1D2K A;  5DEZ A;  1Q6U A;  2M1I A;  1E6N A;  4BF8 A;  1ZU8 A;  4DWS D;  4L3N A;  1W26 A;  4QZV B;  3AQU A;  2PV3 A;  2PPN A;  2RUQ A;  1ROU A;  2A3C A;  2KE0 A;  4IPX A;  4L72 B;  4DWS A;  1FJD A;  2PI6 A;  4GIV A;  4WIW A;  4Z2I A;  3OOB A;  1TFV A;  3G6M A;  3O5J A;  1W1P A;  2KO7 A;  4HBO A;  3ALG A;  2G41 A;  2KFW A;  1WAW A;  2XP3 A;  3NRK A;  2WLZ A;  2YBT A;  4DRM A;  1J4I A;  1EIB A;  4ODO A;  4Z2L A;  3KAF A;  2LGO A;  3B9D A;  2ZQV A;  1KT0 A;  1FKH A;  2PPO A; 
#chains in the Genus database with same CATH homology
 1OGB A;  3TC5 A;  3BXW A;  3ARY A;  2DT3 A;  3ARQ A;  1JNE A;  4LAY A;  1EQ3 A;  1L1P A;  4IT6 A;  2RUD A;  1JND A;  1YAT A;  1WB0 A;  4DRI A;  5HW7 A;  1Q6I A;  3B9E A;  3O5L A;  2F21 A;  4Z2G A;  3RGC A;  1KFW A;  2L2S A;  2XP4 A;  2RUR A;  4LGX A;  2ZR4 A;  4QT3 A;  2ZQU A;  2VCD A;  4KR0 B;  2YBU A;  1YW5 A;  1E6R A;  4DT4 A;  4MNJ A;  1ROT A;  3CGM A;  1KT1 A;  4J4O A;  3PA7 A;  1HKI A;  2MF9 A;  1JNT A;  1QPF A;  3CHF A;  4QIB A;  2FKE A;  3O5Q A;  4P8X A;  2XPB A;  1ZCN A;  2MLZ A;  1J4H A;  4WK9 A;  4DRJ A;  3ARZ A;  1FKT A;  1NWT A;  1F8A B;  1E6P A;  1PIN A;  1O6I A;  4GGQ A;  1FKG A;  4G2P A;  4ODR A;  2F4E A;  3FAP A;  1LL7 A;  2IF4 A;  2WLY A;  4MTV A;  4TNS A;  3WD2 A;  2RQS A;  1LL4 A;  4WJX A;  4NZC A;  4DRQ A;  4IQ2 A;  3CGN A;  4P8V A;  4PTM A;  3WQV A;  2KI3 A;  1FAP A;  2MPH A;  2XP7 A;  2AOS A;  1EYM A;  2B31 A;  2MNT A;  4URI A;  3ODK A;  4NSB A;  4JFK A;  3UI5 A;  1ITX A;  3KCE A;  4U86 A;  4MGV A;  2D9F A;  1GPF A;  4TW6 A;  1D6O A;  3IKD A;  4MNM A;  5D75 A;  2PPP A;  1FKK A;  1Q6H A;  2DPE A;  4TX0 A;  1HKM A;  2DT2 A;  2N87 A;  3O5K A;  1JVW A;  3RM9 A;  3JYM A;  1HKK A;  4WKF A;  3WL0 A;  1E6Z A;  1QPL A;  1W1T A;  3ARU A;  2G8Z A;  4DIP A;  3UI6 A;  1H0G A;  2PBC A;  3RM4 A;  4Q7N A;  5HW8 A;  5I98 A;  3AS1 A;  3WD1 A;  1SYT A;  2UZ5 A;  4DRN A;  4ODL A;  2K8I A;  3KAH A;  2AWG A;  5HUA A;  5HT1 A;  4N19 A;  3ARO A;  3O5M A;  3NTP A;  1Y0O A;  4O2T A;  3O5O A;  4S3J A;  2OFN A;  1IX5 A;  3UQI A;  1ZBW A;  2LPV A;  1BL4 A;  3IHZ A;  2Q5A A;  3ARP A;  1Q1C A;  3NI6 A;  3IK8 A;  4ODQ A;  2PV2 A;  1J4R A;  1LG1 A;  2MLY A;  4MPK A;  4W5U A;  4IQC A;  4DH0 A;  4DWS B;  3WKZ A;  2DSW A;  1LJY A;  4R5E A;  2DG3 A;  2ESC A;  3AS0 A;  5BXJ A;  5HBF A;  2F2D A;  3KAI A;  1HJW A;  2XP8 A;  1GOI A;  3PRA A;  3WQW A;  4MSP A;  3RFW A;  1SR0 A;  2JZV A;  1NMW A;  1LL6 A;  1PBK A;  4Z2J A;  4IT4 A;  3ALF A;  3LUO A;  4QT2 A;  1ZK6 A;  5HWB A;  3I6C A;  3OA5 A;  1N1A A;  5DF0 A;  1FFQ A;  3W4R A;  4NNR A;  1RD6 A;  4P8U A;  1WNO A;  5HWC A;  5GQB A;  4ODK A;  3ARV A;  3EY6 A;  1ZBV A;  1X6N A;  3O5F A;  4JFL A;  2O92 A;  4HBE A;  3WD3 A;  4MNK A;  1UR8 A;  1R9H A;  1FFR A;  3AS3 A;  1ZB5 A;  4ZPT R;  3FXY A;  2RSE A;  3B9A A;  2ZQS A;  3IKG A;  2ITK A;  2FAP A;  4C02 B;  2M2A A;  4U84 A;  3MDY B;  3CHC A;  4W9P A;  4JYS A;  1VF8 A;  3PRB A;  3PRD A;  1NSG A;  4MAV A;  1HXV A;  1NWS A;  1W1V A;  2DT1 A;  3KZ7 A;  3WH0 A;  4LAX A;  4J4N A;  2WM0 A;  3B8S A;  1J6Y A;  1HKJ A;  3VAW A;  1FKB A;  4JFM A;  1FKF A;  2OLH A;  2VN1 A;  1U79 A;  1H0I A;  4ML4 A;  3KAG A;  4W9Q A;  1F40 A;  2Y78 A;  4ODP A;  3KAD A;  3G6L A;  1CTN A;  4Z2K A;  2XP9 A;  3RME A;  4WKA A;  1P5Q A;  1D7H A;  3H9R B;  4P8W A;  1FKS A;  2A3A A;  2RUC A;  4ODM A;  3JYJ A;  1FKD A;  1OWQ A;  4W9O A;  4U85 A;  3B7X A;  4KQZ A;  4ZS6 A;  4FAP A;  2O9O A;  3UI4 A;  4FN2 A;  1NH6 A;  3GPK A;  1X6L A;  2XPA A;  4TW8 A;  5DIT A;  3FY1 A;  3QOK A;  1GUV A;  2LKN A;  4G50 A;  3CHE A;  5GPR A;  2FDM A;  4DRO A;  3PR9 A;  5HKG A;  2XP5 A;  3ART A;  3ARR A;  3TCZ A;  4LAW A;  4LAV A;  3O5D A;  4Z2H A;  4DRH A;  4DRK A;  4Q22 A;  2WK2 A;  4S3K A;  4XAK A;  3RM8 A;  2XP6 A;  1M5Y A;  3CZ8 A;  1HJX A;  2KR7 A;  1NWU A;  1W1Y A;  1K9T A;  2LJ4 A;  3O5E A;  1LG2 A;  2ZR6 A;  3ARW A;  3AS2 A;  2DSV A;  2MLX A;  1HJV A;  4ZPV R;  1W9U A;  1JNS A;  5DIV A;  3O5I A;  1FKR A;  2A3E A;  1EHN A;  1E15 A;  4ZPW R;  5DO2 A;  1C9H A;  3JXV A;  1W9V A;  3CHD A;  4HAR A;  1FKI A;  3UQB A;  4JFJ A;  1TCO C;  1QZ2 A;  1FKJ A;  3WIJ A;  2ZQT A;  3O5G A;  2DT0 A;  2ZR5 A;  3ARX A;  5DIU A;  4ITZ A;  3ARS A;  1T11 A;  2DSZ A;  4TW7 A;  1D7I A;  1FKL A;  2M08 A;  2IUZ A;  2A3B A;  4ODN A;  5HTG A;  1BKF A;  1UR9 A;  3UF8 A;  2KGJ A;  4TYO A;  1B6C A;  4DWS C;  4AY1 A;  5GPG A;  3O5P A;  1ZL1 A;  1EDQ A;  1FD9 A;  4R0X A;  3WL1 A;  3WD0 A;  1A7X A;  4JFI A;  2QF8 A;  3KAC A;  4WKH A;  1ZBK A;  5B8I C;  5J6E A;  5JH8 A;  2DG9 A;  3O5R A;  2PV1 A;  4DZ2 A;  1D7J A;  1ZBC A;  5HW6 A;  3CH9 A;  1NMV A;  1LQ0 A;  4MNL A;  3KAB A;  3TDB A;  1W9P A;  1XHG A;  1NWR A;  3WD4 A;  4DZ3 A;  4DRP A;  3UQA A;  1OGG A;  1XRV A;  1E9L A;  2DG4 A;  2DSU A;  1D2K A;  5DEZ A;  1Q6U A;  2M1I A;  1E6N A;  4BF8 A;  1ZU8 A;  4DWS D;  4L3N A;  1W26 A;  4QZV B;  3AQU A;  2PV3 A;  2PPN A;  2RUQ A;  1ROU A;  2A3C A;  2KE0 A;  4IPX A;  4L72 B;  4DWS A;  1FJD A;  2PI6 A;  4GIV A;  4WIW A;  4Z2I A;  3OOB A;  1TFV A;  3G6M A;  3O5J A;  1W1P A;  2KO7 A;  4HBO A;  3ALG A;  2G41 A;  2KFW A;  1WAW A;  2XP3 A;  3NRK A;  2WLZ A;  2YBT A;  4DRM A;  1J4I A;  1EIB A;  4ODO A;  4Z2L A;  3KAF A;  2LGO A;  3B9D A;  2ZQV A;  1KT0 A;  1FKH A;  2PPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...