2M0OA

The solution structure of human phf1 in complex with h3k36me3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
79
structure length
79
Chain Sequence
b'SRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 1
publication title An H3K36 Methylation-Engaging Tudor Motif of Polycomb-like Proteins Mediates PRC2 Complex Targeting.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 7
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2m0oA00
3C4SA 4UC4A 4BDZA 4BE0A 4A4EA 2X4WA 5KH6A 2RI3A 2R58A 1RI0A 2LCCA 4QVZA 2IG0A 3MEUA 3OYBA 2FHDA 4RG2A 5FROA 3LX7A 4QQ6A 3P8HA 5C0MA 2DIQA 2L3RA 5FRMA 3E9GA 3F70A 5KE3A 2GFAA 3H8ZA 4HCZA 3M9QA 2X4XA 1MHNA 1XNIA 2LTOA 2QQRA 2RHUA 3MEVA 4BD3A 3OYHA 3FEOA 5IAYA 3S3OA 4ZTFA 3QBYA 1WJSA 2EFIA 4E7IA 5KCHA 3MP8A 2MWPA 3PMIA 3OYNA 2QQSA 3Q1JA 2RHZA 2RJCA 3LYIA 2DIGA 4OVAA 3QJ6A 3E9FA 2MWOA 2E6NA 3PFSA 3OYCA 4IUUA 3L2WA 2YRVA 5M9OA 4NS5A 3ME9A 2L8DA 2LRQA 2R5AA 3OMGA 3L2UA 1OI1A 3ASKA 3P8DA 3H6ZA 3S3NA 4IURA 4A4HA 4PL6A 5J26A 3OYKA 2EQKA 5KE2A 4E7JA 4IUQA 4EDUA 3S3MA 4ZTJA 2BUDA 3LGFA 3BDLA 4N4IA 2O4XA 3MP1A 2BKDN 3OY9A 3OB9A 3OYFA 4C5IA 3O8VA 5J39A 2EQJA 3PNWC 2XK0A 3MEWA 3OS1A 2X35A 3META 4LD6A 2RI2A 2RHYA 3MO8A 3OS2A 4IKFA 2CKKA 1KHCA 2M16A 4L59A 3DB4A 1G5VA 3MP6A 4GY5A 3NTIA 4B9XA 3CEYA 2M1HA 2VYTA 3L2QA 4FU6A 3S6WA 4E7LA 4IUTA 4A4FA 2K3XA 2EQUA 2K3YA 1SSFA 3MEAA 5D6WA 2GFUA 1H3ZA 1WGSA 2RJEA 3OYLA 4BE1A 1OZ2A 2EQMA 4QQDA 2JZ2A 4Z02A 4BE2A 3OS0A 3OYEA 5FRNA 2HQEA 3ZEHA 2RHIA 2D9TA 2NLUA 3PMTA 2GF7A 2R57A 2O4XB 5IN1A 4C5HA 2PQWA 2JTFA 4QW2A 3GOXA 5CIUA 3OMCA 3LGLA 3EAEA 4QQGA 5D6XA 3UWNA 4B9WA 4E7KA 2G3RA 1N27A 2RJFA 4Q5WA 1OYXA 4IUVA 4A4GA 3FDRA 4C5EA 3DB3A 4IUPA 2P0KA 3NTHA 3L2VA 2M0OA 2DAQA 2LVMA 4C5GA 4CRIA 4BDYA 1OZ3A 2E5QA 1WJRA 2RJDA 3QIIA 3LH0A 2LDMA 4FL6A 3OYIA 2F5KA 2RI5A 3FC3A 2WACA 4PLIA 4X34A 2X4YA 2XDPA 5KCOA 3L2RA 4N4HA 3UT1A 3OYGA 2R5MA 3OYAA 3OA6A 2HQXA 4N4GA 5C6SA 2BIVA 3OYMA 3OYDA 5D6YA 4II1A 3SD4A 4PLLA 4E7HA 3OYJA 3KUFA 3OQ5A 3NTKA 1WJQA 2EKOA 2RHXA 2RO0A 3LLRA 3L42A 3DLMA 2B8AA 2L89A 3FLGA 4BACA 3QKJA
chains in the Genus database with same CATH superfamily
2LQWA 4UC4A 2BTTA 4OF1A 1UECA 2RI3A 1K9AA 4OGCA 2LCCA 2MPXC 1T3SA 2EYQA 3VS0A 4M78F 2KSSA 2CUBA 4M7DG 1HXDA 1C6VX 2L3RA 3A8OB 2YHTA 2A08A 3H8ZA 1D0YA 1ZUUA 2V8JA 4ZTFA 3FEOA 3FJPA 4XU2A 3QBYA 2LX7A 4PK4A 2PVGB 4AT1B 3VRZA 4L5GA 3V8KA 1FMKA 4RTWA 3LYIA 1Q81C 1S72T 2RQRA 1MV3A 2F5TX 1KC8U 3N5BB 1VQ7T 4NOYA 1BYMA 1YHQT 1PSFA 1QWFA 2OAWA 4M77G 2LNVA 5LJ5j 1NJIC 3WVEB 2EQIA 4J9GA 2EJFA 2EIFA 1G8XA 5GAMf 2Y4XA 3HP9A 3M0QA 1O75A 4PJOE 4AMCA 3HRTA 4DQ2A 1WLPB 5A0GA 1NEBA 2L0AA 1NJIR 1UJYA 3CMET 5GAN4 1KHCA 2GQVA 4BY6B 3A8LB 3REBB 2FPFA 3GP8A 1ZSGA 1Q95G 3CMAT 2K3YA 4CC3A 2JZ2A 4XQ3A 2RK2A 3PMTA 4A53A 2J6KA 5KYUA 1QVGA 1RAAB 2VC8A 2ZPGB 1ARKA 2EGEA 5FU7B 4A4GA 1WNLA 1M90U 2DL8A 3NTHA 2E65A 4C5GA 3G6EA 2E5QA 1E6GA 4M7AD 3CBOA 2HKNA 1GBQA 1QCFA 3FB9A 3I55A 3UF4A 1AZEA 2BIVA 3X20B 2M51A 5I2SA 3H41A 1RADB 3FLGA 2DTOA 2QTVA 3TU4K 1E6HA 2VGNA 1M8VA 2LQKA 2RA2A 1Q82C 2DIQA 2MMPA 3F70A 4OMPA 1Y57A 1VIEA 2KAFA 5GANe 5IAYA 1PKSA 1IHVA 4J9BA 2ROTA 1S72A 4D8KA 3M58A 4F7UG 4KH1B 5KYUB 4MDXA 2MOXA 3EG1A 2QG9B 3LWHA 2EYZA 4C92G 1B07A 3PE0A 5M9OA 2L8DA 3M59A 5GMKm 2OTJT 4DOWA 2X3XD 4IUQA 1VQKT 2BUDA 2IPOB 1WHJA 3U23A 2L2PA 4FIBA 4XAXB 5KYXA 4M7AC 3CMEA 2K3BA 1SF9A 3LH5A 4OB3B 1M1FA 2LX9A 2V8KA 3VS6A 4F04B 1OX9A 3CMAA 1I5LA 3NTIA 3CEYA 4ZGEB 4RUGA 2KDSA 2K3XA 1YCYA 2L3PA 2V8IA 4DBHA 2DVEA 1T3LA 1YI2T 3HL8A 2YLBA 2MCNA 1NLPC 2FPDA 2LQNA 2QA4A 5IN1A 2RF0A 3PVLA 5GMKi 1M1KU 1Q86U 1KD1C 1KHIA 2BE9B 1VQMQ 5LJ5g 3RR6A 2DETA 1UEBA 2JVVA 3HPWA 3UT1A 3QPHA 4RTVA 3OYAA 1VQ8T 2MAMA 1TXQA 4GLKA 2GBQA 2NUPA 4PLLA 3OYJA 1KD1R 2VVKA 1Y7XA 4LD9K 1KC8C 1B7TA 4BE0A 3CCVT 1AWWA 5GAN6 3LW5E 2X3WD 3H9NA 4E7ZA 1NYFA 5FROA 4ORZA 2J05A 3EHQA 3INZA 3C12A 1VQ4T 3VJPA 1KC8R 4M7DC 1MGQA 2EFIA 4E7IA 3G1JA 5GMKj 3FIFA 1FWZA 3SFMA 3G4SA 2QDYB 3I56Q 1X27A 2XG8D 2QQAA 1C0MA 1MMGA 2HKQB 2DRKA 1X6BA 2JUFA 1VQKA 2NWMA 4J9EA 4B6MA 1V76A 2W0ZA 1SSHA 5CKHA 5HKCA 5CK9A 3IQLA 3R6NA 1N8RU 1M90C 2PZ1A 2AKKA 1VQ6T 1QVGS 3M54A 1RLPC 1I81A 2FEIA 5GJWB 1X6OA 4HCCA 1OOTA 2KMTA 3RDVA 1M2OA 1WGSA 4J5YA 4HVWA 4P5NA 1M90R 1YCSB 5GAOm 4E47A 4FM4B 1OV3A 3M55A 1PKTA 3QJYA 1XJWB 2HSEB 3OMCA 2CZ1B 2BZYA 2E12A 3JB9G 1VQOT 2DYIA 2RJDA 1M3AA 4FT4A 5KCOA 3RIRA 1WA7A 3C95A 2KEAA 3OYMA 3JV3A 3SD4A 4E2FB 1G83A 2VKNA 2DVJA 1CKAA 1WHHA 4X9DA 2D6FA 3G71T 5L8RE 1PWTA 3M57A 4RTUA 2QAZA 4AFZC 2JM8A 1YJ9Q 1VQ4A 5J3BA 1M30A 4MMKA 3S3OA 2QQRA 5IHIA 1ABQA 1BIAA 1WJSA 1KG1A 1VQNT 4M7AB 2HZYA 4RTXA 4FSSA 1M4ZA 2ZPFB 3CCRT 2V26A 3CC7Q 5D7UA 4AG1C 3E9FA 2MWOA 2E6NA 1AD5A 5GAN2 3PFSA 2GGRA 1WI7A 3A1PA 2ECZA 4M7DA 3P8DA 3BDUA 4PL6A 4M7DF 3VS4A 1IRXA 1AEYA 2ZCFB 3THKA 3CQTA 2CP2A 2C0TA 1PM3A 1NEGA 2CP6A 5J39A 1VQ6A 2EQJA 3MO8A 4IKFA 4GY5A 3CCUQ 4M77A 1GXIE 4PKCC 2C06A 1YWOA 2AT1B 2HNIA 3QZ9B 1YITT 1UUEA 1SKUB 2F2VA 3V7RA 1CSKA 4M77F 3CC2T 1WQWA 3O5ZA 1WPYA 4M75D 2ATCB 1Q86R 1IXDA 2D9TA 1VQPA 2E10A 4LDYA 5GAMd 1CKBA 3I5RA 2JN0A 2E6ZA 2MI6A 5GANf 1KQSS 5LJ3g 1Z9QA 4M7DB 1TH7A 1WFWA 4A4KA 2R5MA 2QA4Q 1BIBA 1Y07A 3GPLA 2LCLA 1ZSZC 2HBPA 1TUDA 3EGDA 3LLRA 2PVOB 3DLMA 3G71A 2Y4YA 3I35A 4BDZA 4A4EA 2HCKA 1LPLA 3JCMX 2CP3A 4DBQA 4RG2A 4QQ6A 2CSQA 2A37A 3JB9J 4Y91A 1VQNA 2JT4A 3MEVA 1XTDA 4BY6C 3CCRA 1K9MC 3EG2A 2DZCA 2FZKB 3JCMg 3E19A 1N9RA 4O5VA 1GFDA 5I22A 4BI3A 2M02A 1FYNA 4QKUA 1N8RC 4YTLA 2PUOB 3EFRA 2D0NA 3ASKA 2XD0A 4M75C 5KYYB 4KUIA 1R0BG 2EQKA 1BB9A 1YIJT 5GANj 1N8RR 3CCET 2QEXT 2AIRB 2BKDN 4F7UA 3M4YA 2CGHA 1D0XA 2YDLA 2ZAEA 4F7UF 3OBYA 4M4ZA 2KYBA 4C92A 1XOVA 3RKXA 1B34A 1W4SA 2RD1A 4ANJA 4C92F 1UDLA 2J6FA 3CC2A 2ZPEB 3MEAA 4M7AG 3EHRA 2E64A 2JTEA 9ATCB 2YLCA 2VV5A 1O9SA 2DILA 3UWNA 1M3BA 5EC7A 1VQ5T 1N27A 1KQSP 2QQBA 2DKGA 1UFFA 4C5EA 2PNIA 2M0OA 4BDYA 1M8MA 3OYIA 4N0AA 4X34A 4C0FA 3BE3A 2DD5A 2F2WA 4N4HA 3OYGA 5CKEA 4J8OA 3JCMe 4N4GA 5GAN7 2WSFE 2JMCA 4E7HA 1BK2A 3NTKA 1OPLA 2EKOA 1KFZA 2DA9A 2VGMA 4C8QD 2DFUA 2YUPA 3X26B 2R58A 3RBBB 4QVZA 3HKSA 4ZNXA 4WTOB 5GAN5 3LX7A 3P8HA 4XTWA 5FRMA 4XK8E 5KE3A 1B34B 2YXYA 3VYHB 1MHNA 5GANh 1RAFB 1KK7A 1OULA 4M7DE 2P4TA 2YRCA 1RLQC 1U1TA 5CAIA 5FW9A 1UGQB 3Q1JA 1ZA1B 1QLYA 4JDSA 2EGAA 2DMOA 4IUUA 3E2UA 1N5ZA 2DXUA 2CT3A 1NYGA 2DTIA 2RQVA 3X28B 3M4GA 1SRLA 3CCJQ 1MMNA 5CO7A 2LNHB 1UGVA 3TREA 3VS3A 4M77E 3WXMB 5IHNA 5CCAA 1GRIA 4C5IA 1K76A 4M75A 5IXBA 2YUOA 4HCBA 3CC7T 1VQ9A 4B9XA 1AVZC 2EYYA 4JRIA 4KRTA 2VYTA 1ZSZB 2XMFA 3CCMQ 1H641 5D6WA 2DBMA 1X43A 2ZPBB 4FSXA 2NLUA 1VQ5A 2O4XB 3M0TA 3CC4Q 4QW2A 4J6XA 3R6OA 4KBMB 4OMFB 4HKEA 4JJDA 1OYXA 2VASA 4Y28E 1IO6A 4FW2A 4CRIA 2WACA 2QK0A 2HDAA 2RQTA 2VWFA 3CPWA 1Q7YU 1BI0A 4MMLA 1K73U 2KT1A 1VQLT 5GJVB 2RHXA 2LMJA 5HY6A 1QP3A 1TTHB 3TSZA 1YJWT 3C4SA 4LDVA 2JS2A 3FRNA 1W1FA 4M75B 3CCQT 1W70A 5I11A 1RAIB 1M1GA 2EKHA 2DTHA 3JB9F 2A7YA 1XNIA 4LXCA 3EGXA 1YJNQ 3CD6T 4HT9A 2QI2A 3DLLA 5HK3A 1D09B 2CS7A 5EG2A 2D8HA 5GMKl 2XHCA 3QHSA 1K4US 1EZZB 1KQ2A 2ROLA 4J9FA 5GAMj 4CI0C 4F7UE 2LRQA 1WIEA 1QCOA 2M0YA 1YN8A 3PTAA 1ZQ1A 4C92E 4OGEA 1N9SA 3S3MA 4ZTJA 1KSWA 4C0GA 1VQ7A 3I9QA 1Y0MA 3RMQA 3VUBA 1RABB 3J7AF 4OB2B 3PIOA 1YHQA 1G5VA 3L2QA 2AHJB 3HFNA 2QQ9A 2QTXA 4XTUA 3EGXB 1TS9A 2ZGWA 1GBRA 1RAEB 4MZTA 3NHNA 1G3WA 4R55A 4E7KA 2G3RA 5CKDA 3CCST 3SWNC 1VA7A 2BZ8A 1X6GA 2NUZA 3L2VA 2COZA 1VUBA 2LDMA 1MUZA 4JUVA 1HJDA 3QG1A 1RUWA 4BB7A 4KT0E 2C0IA 2AK5A 1YJWA 4XU3A 1OX8A 2EAYA 2L89A 5GAMh 1OU8A 3JB9H 2X4WA 4RKUE 2IG0A 1ZBJA 3CCLT 4FYXB 2YRDA 1NZ9A 3ER0A 4AFSC 3CD6A 1WXUA 1TU0B 2GTJA 3V7CA 5GANd 4ZN1A 5GAN8 2DPPB 2QDLA 4A63B 2DJQA 4WF2A 4KH0B 1JB0E 4Y92A 3NGPA 2RPNA 1X69A 1LCKA 4IIOA 4XU1A 1VOMA 3VS5A 2O2OA 3HTRA 3QWYA 2QXFA 4F16A 2OTLT 1MMDA 1JJ2A 4HXJA 1SG5A 2RQUA 3EGUA 3LGFA 3JB9I 1NLOC 1T0HA 4M78G 1JU5C 3EFSA 1LJOA 1QVFA 4M75G 1NE8A 4CC4B 5IT9E 1WHKA 3OW2A 4LD6A 2RHYA 3M0RA 4PJOD 3JCMf 2OTJA 2EGCA 1AT1B 2GTOA 6AT1B 4A4FA 2P0PA 3SDZA 2EVRA 4JS5A 2JW4A 1WYXA 3CCSA 3P8BB 1QP2A 5D6XA 2JS0A 1VQ9Q 1JRIA 4AFUC 5LJ5e 1QKXA 4RG8A 1JXMA 1UTIA 2DF6A 2YUQA 2ED0A 2FRYA 4ZGDB 1YBYA 1YI2A 4M7AA 3H0IA 5C6SA 3OYDA 1Y71A 4D8DA 2CP5A 4KGZB 4MZMA 3OYYA 2WSEE 3CCMT 2H3EB 4EMHA 3CPFA 4JLIA 2CDTA 4M7AF 2L5QA 2A28A 1WXTA 1M2VA 3CCLA 2O01E 4DBRA 2XU8A 2G6FX 2LJ0A 1I8FA 1KIKA 1VQ8A 1AOJA 2O31A 2JJ9A 2CZ0B 2MWPA 4CC2A 2MIOA 3A8HB 2GQIA 3CCVA 2K4YA 2YSQA 1SPKA 3G6EQ 5A2QE 2J6OA 2XDBA 3I55Q 3SHWA 3VS1A 4IURA 2DERA 3RKYA 5CVIA 1XQHA 1AWJA 5DY9A 4FW1A 2M9UA 2DM1A 3BDLA 3VS2A 1MNDA 3UATA 2MF2A 1TWBA 1EFNA 3OYFA 1K8AU 4TVRA 3SWNB 1RI9A 1YNZA 4FYWB 4OMNA 2CUDA 3PNWC 3MEWA 3JSCA 4C0ZA 1WHLA 1M2VB 1U5SA 2V1QA 2E3HA 3CBMA 4E7LA 1F1BB 1S72Q 4GBQA 2EQMA 1VQ7Q 4J7FA 1GCQC 2COYA 2HQEA 1M27C 2RHIA 2E4HA 2J06A 2PUKB 1YHQQ 1ZA2B 3AHUA 4Q5WA 2HL3A 1QVGP 3FDRA 1WHGA 1UGSB 1Q86C 1M1KC 4C8QG 3JCMV 4E6RA 4LUDA 3X25B 4JRKA 2ENMA 4KUDK 3JCMW 1FX7A 2FVUA 1I5OB 4M78D 5I2MA 1X01A 3RUXA 3OQ5A 4ELYC 3CMEQ 1M1KR 4EPCA 4PFPA 1VQOA 2AKLA 2H3JA 3CMAQ 4QT7A 2ZPIB 1BI2A 1RL2A 2DEUA 1BI1A 5KYYA 2E70A 3JCMc 4J9DA 4LDUA 1QW1A 1NPRA 2RHUA 3QWXX 5KYNA 1KQ1A 1SHGA 4OMLA 2LZ6B 4L6V5 5FU6C 5FLXE 3MP8A 2CT4A 1ZLMA 2X51A 2V1RA 3JAME 1Q81U 1NBEB 4R0KA 4BI4A 4JJNK 2F2XA 1JJ2S 1ZX6A 3RKWA 3VV0A 1Z9ZA 3ME9A 3WVDB 1QVFS 3DKMA 3I5SA 3OW2S 2KT8A 3OYKA 3HRUA 1H3HA 1K1ZA 2VB6A 1X2KA 4E7JA 1EX4A 1D1CA 1VQMT 1NPPA 1V29B 4R56A 4N4IA 2KRSA 2CP0A 1U1SA 3META 2EYXA 3MPUB 4M78C 2DXCA 3MP6A 4HCKA 2YT6A 4IUTA 4VUBA 1SSFA 5GMKe 2RJEA 4Z02A 2JXBA 3OS0A 3OYEA 1RAHB 3G4SQ 2K79A 2IIMA 2OI3A 1SHFA 5CIUA 4M7AE 2ZZDA 3LGLA 2OTJQ 5LJ3e 4OMMA 3QXEB 1VQKQ 3G7ZA 2RI5A 4DOVA 4PLIA 1E7OA 2DL7A 1YITA 1WQ7A 2P4RA 4LUEA 1LOJA 3I56T 3VKIA 3NMZC 1MV0B 3A98A 3GIBA 1IGQA 4XTVA 3GLXA 2KBTA 4J9CA 4J6WA 3VYGA 2DL3A 1Q82U 3OYBA 1G3TA 1MNEA 3M5AA 1YI2Q 3VRYA 4OMOA 4BD3A 3OYHA 3M53A 1RAGB 3H0FA 4FYYB 3REAB 1IGUA 2KXDA 3OYNA 1JJ2P 5CKBA 2DO3A 1PD0A 1FMWA 2YWWA 4OVAA 2LJ3A 1WZOA 4PJJA 3EFOB 3TQ7P 3TSWA 2EWNA 1QVFP 1VQ8Q 2EJ9A 1PCXA 4BI8B 3KBGA 2P0QA 2CH4W 1OI1A 5KYWA 1ZSZA 5FWBA 2DEQA 4DEXA 1BU1A 1K8AR 1VQMA 1D0ZA 4LN2A 1WX6A 7AT1B 2O4XA 3HRSA 2JOYA 2MYSA 3OY9A 2DBKA 1TSFA 4RTZA 5LJ5f 2X9HA 3RMSA 1PNJA 1X75C 1HSQA 4J9IA 1VQ4Q 4D6WA 3GBQA 3JCMJ 2M16A 5ECAA 5I21A 3DB4A 1JBMA 4AFQC 4JLGA 1YIJA 4J7IA 2ED1A 2HD0A 3MHXA 3JCMb 2GFUA 4XU0A 3CCEA 2QEXA 1ZHIA 1OZ2A 1UHFA 4F14A 5FRNA 1YJ9T 4M78A 2JTFA 2E41A 2FYKA 4OP0A 4B9WA 1JEGA 2AZSA 2FZCB 3JRZA 1KD1U 3DB3A 2LVMA 4IIMA 3I56A 4M75F 1X2QA 4A54A 2GNCA 1B3QA 3VUZA 5KYWB 5GAOq 5FU6B 3RESA 5DM7R 2KY9A 5IHKA 4C8QC 2FZGB 3JCMd 4XTZA 2QGFB 2SRCA 3OBWA 4ZGJB 1WJQA 1VQ6Q 2BZXA 3QJ6A 1BCMA 1W2BA 2RK1A 1I4K1 3FJ5A 4K11A 4E7SA 4X9CA 4KULA 1GCPA 1PC0A 2ABLA 1OU9A 1Q81R 1D3BA 4DBFA 1AHJB 1VQPQ 2HSPA 5GANg 4C0DC 3CCUT 2RM4A 2B86A 1VQOQ 1PHTA 3LWIA 4M78B 3OYCA 1M9SA 2YRVA 1K0SA 2RN8A 3ZFJA 3PGGA 2R5AA 1TUCA 4PFZA 5J26A 4PJOG 4RCCA 1YFNA 5KE2A 1WDXA 3BY7A 3G71Q 2E3IA 1I07A 4FYVB 3TCJA 3EG3A 2QYZA 1G2BA 2QA4T 3EG0A 5DLOA 5HK0A 3OS5A 2LQ8A 3EG9A 2CP7A 3J80E 2KQWA 4RMOA 2YUNA 1VQNQ 2K6DA 3PIPA 2A0FB 3CCRQ 1D1AA 4LNPA 1IHWA 1WXBA 2W10A 4CC7A 4JJCA 1H3ZA 1YJ9A 4BE2A 4QQDA 1D3BB 2KI7A 3BFMA 3EH2A 3ZEHA 3CXCA 4OMQA 2GF7A 2HL5C 2EJGA 3UA6A 2PQWA 2O9VA 4ESRA 3QSUA 4O6JA 3CC7A 1ZBXA 5LJ5h 2DL4A 2MK5A 1PRMC 4FL6A 1SEMA 3L2RA 4LDXA 2O88A 1VYVA 1W6XA 4II1A 4LDWA 3D7SB 2RO0A 2NYSA 1Q82R 1YP5A 3A5ZB 5KH6A 4Z8AA 3G4ST 1YITQ 3MEUA 4C8QA 2L3SA 3EG9B 3HSBA 2KVQG 3CC2Q 2GFAA 2FB7A 4HCZA 2KYMA 2VXFA 4C8QF 2LTOA 2JMAA 3CCUA 5HCKA 2QASA 2EW3A 1VQLA 2K5LA 2L3QA 2C0OA 2LJ1A 2RHZA 2HBWA 2RJCA 4M7DD 2KRNA 4QVDA 1QVPA 1YWPA 5CR2A 5GAN3 3CCQA 3L2WA 2SEMA 4BUGA 3L2UA 4DEYA 2HAXA 3S3NA 1EIFA 2IVWA 1WHMA 5GAOn 4PJLA 4ELZC 3RNJA 3UPUA 5LJ3f 2PVDB 3KXTA 3MJXA 3UA7A 2RQWA 5A0DA 5GAOp 2Z0WA 1HK9A 3V8LA 4M77D 5AT1B 2XK0A 1GFCA 3ZL7C 2RI2A 4Z89A 1D1BA 4M78E 4PFOA 2KGTA 2J7IA 1UHCA 2Y90A 4RCBA 3H0HA 4C8QB 2M1HA 4M75E 2RNAA 2I0NA 2NUTA 1U3OA 1R8OB 4ATOA 5FWCA 1QWEA 5LL6S 4EMKC 5A0LA 1KQSA 2LP5A 5KYXB 1TG0A 4F17A 1G3YA 1YIJQ 5GAOl 2E5KA 1W2BS 1WJRA 3NFCA 3CCEQ 2QEXQ 4OB1B 4C0DB 4FT2A 5CKFA 2I2LA 3M0SA 3C94A 2K9GA 2FPEA 4ME7A 1Q7YC 1H92A 1K73C 1UB4A 5CQYA 1AWOA 2KROA 3VU3C 3OSVA 3CCJT 1U06A 2LT1A 2QGGA 3CPWS 1G3SA 2K7AA 5GAMg 2JNGA 4JJBA 2OX7A 2LC4A 5LJ3j 4RTYA 1I0CA 3E9GA 1Q7YR 1UJ0A 1K73R 3E1SA 3M9QA 2X4XA 4JS4A 2NUTB 1K9MU 1QMCA 1VQ5Q 4M77C 2DX1A 2NUPB 2HQHA 1FXXA 3PMIA 2QQSA 3SWNA 4EIKA 5DLQE 1OEBA 2DRMA 4JRQA 3J81E 3CC4T 3OMGA 1J3TA 1TUGB 1AWXA 3AT1B 2E1HA 1A0NB 1AZGB 1VIFA 3C0CA 4EDUA 2JM9A 1VYTA 1T0JA 4PJMA 4GLMA 3MP1A 1NG2A 4C92D 4PJOC 2K5IA 2KRMA 1GL5A 3GNFB 1VQPT 8ATCB 2KXCA 2F1LA 2FO0A 2CREA 3CXCS 2X35A 3OS2A 1C1AA 4L59A 2AZVA 4EMGA 3A8MB 1ACMB 1JQQA 1HD3A 4FU6A 2DXBA 5GMKh 1OQKA 2OTLA 2DJZA 4JZ4A 4BE1A 1R77A 3QZ5B 2CZ6B 1QQJA 4MDWA 4XTYA 4C5HA 2LT4A 5GAMe 1YJNT 1M5Q1 2RJFA 3QDRB 2OAUA 5LJ3h 1W2BP 2DAQA 5LJ5d 2K2MA 1OZ3A 3QIIA 3LH0A 4EMKA 2K5FA 4C8QE 2CZ7B 4PJNA 2CH4A 2DL5A 3CCJA 2DK3A 3CPWP 2B8AA 4BACA 4XTXA 2DXTA 2FRWA 1DJ7B 5IXFA 3MCAB 1ZUYA 3VS7A 5C0MA 3L2ZA 1BKBA 4QVCA 4C92C 3JCMh 3CCMA 2EYWA 5KCHA 2WSCE 2KR3A 3TEEA 1SRMA 2DIGA 1VYUA 3CC4A 2JTMA 3BW1A 4WCIA 1HYOA 4NS5A 3T9NA 3V8JA 1M3CA 2RH2A 2KK4A 1VQLQ 1PSEA 1YJWQ 1K0XA 5GAOr 2XDDA 4EMKB 1FMVA 4V2SA 4PNOA 5AYFA 3GNGA 4N0AC 3L1AA 2BE7D 2D8JA 3CCQQ 2XI9A 4J6YA 1BBZA 3OB9A 3NPFA 3PT9A 3CXCP 3O8VA 1Y96A 4HVUA 3OS1A 3CD6Q 2CKKA 4LE9A 2LCSA 2EBPA 4NL2A 4RTTA 2XKOC 1NJIU 1OPKA 4PJOA 4AG2C 3OYLA 3QDFA 3JCMQ 4PJOF 4HA8A 1YJNA 3UDCA 3GOXA 2XIDA 2A36A 2PTKA 4FCYA 3EAEA 3URGA 3QYGB 4J9HA 3M0PA 2ZPHB 1BCOA 2P0KA 2FG0A 1JO8A 4DA4A 2EPDA 1MMAA 2F69A 1RACB 3FC3A 2F5KA 3QUIA 2X4YA 2XDPA 4M77B 3OA6A 2HQXA 2DE0X 2FL7A 3KFVA 5CQXA 5D6YA 3TVTA 4KGVB 2GCXA 3QYHB 3KUFA 2HMAA 2DNUA 3JB9D 1H8KA 1JXOA 2D1XA 2K57A 3OSSC 3QKJA 2OJ2A 3M0UA 3EFOA 1RI0A 4Z88A 1Y96B 3CBPA 3ULRB 1IB8A 2P84A 1S1NA 2FHDA 2PU9B 1PG5B 1K9MR 3HFOA 5FU7C 3SB2A 1GCQA 3SEMA 1LVKA 2XICA 4PJOB 3CCSQ 1TOVA 2K2VA 1ZUKA 3EGDB 1IZ6A 2KE9A 1NM7A 1V1CA 2ESWA 1I1JA 2HEQA 3JCMP 2KNBB 4JZ3A 2DD4A 1ABOA 4HT8A 2RMOA 4ZN3A 2DZ9A 3H6ZA 4A4HA 1VQ9T 3M56A 1QCNA 4MZPA 2COWA 3MKDA 3HHTB 2VUBA 4OB0B 1N6AA 4JPBW 1UGRB 1UG1A 4X1VA 3ZBDA 3CCLQ 1K8AC 3EH1A 4JRPA 3RERA 1BI3A 2CSIA 4HVVA 3OW2P 1U8RA 2DYBA 3GF5A 3S6WA 2H8HA 2EQUA 1IREB 4KGXB 1UGPB 3V7SA 1R0CB 3CCVQ 1PD1A 2R57A 2VXEA 4F7UB 5L23A 1KJWA 4QQGA 2D0QB 4IUVA 3PVQA 5LJ3d 4IUPA 2RB6A 4C92B 2OTLQ 2CYZB 3X24B 2A3LA 2X4JA 3G6ET 8AT1B 1QKWA 4NL3A 1PRLC 5IH2A 3A8GB 3I55T 3QO3A 2DLPA 1UE9A 2O9SA 1P92A 3L42A 4J83A 1LNXA
chains in the Genus database with same CATH topology
2Y4YA 4UC4A 4OF1A 4BDZA 2L5QA 4A4EA 5KH6A 2RI3A 4OGCA 2LCCA 3CCLA 2EYQA 3G4ST 2O01E 3JCMX 4M78F 2KSSA 2XU8A 3MEUA 4C8QA 4M7DG 4RG2A 4QQ6A 3HSBA 1HXDA 2KVQG 2L3RA 3A8OB 3JB9J 1I8FA 2GFAA 2FB7A 2YHTA 3H8ZA 4HCZA 2VXFA 4Y91A 4C8QF 1VQ8A 2LTOA 2V8JA 4ZTFA 1VQNA 3MEVA 1XTDA 3CCUA 3FEOA 4BY6C 3FJPA 4XU2A 3QBYA 2PVGB 1VQLA 3CCRA 1K9MC 2K5LA 4L5GA 3V8KA 2CZ0B 2DZCA 2MWPA 3JCMg 3E19A 3A8HB 1N9RA 4O5VA 2RHZA 2RJCA 3LYIA 4BI3A 3CCVA 1S72T 2K4YA 4QVDA 5CR2A 1QVPA 5GAN3 2F5TX 1KC8U 3N5BB 3CCQA 1VQ7T 4NOYA 5A2QE 1N8RC 4YTLA 3L2WA 2PUOB 1BYMA 4BUGA 2XDBA 3EFRA 1YHQT 3L2UA 1PSFA 3ASKA 2XD0A 4M75C 2HAXA 4M77G 1EIFA 2IVWA 2LNVA 4KUIA 5LJ5j 3S3NA 4IURA 3WVEB 1NJIC 5GAOn 2EQKA 3RKYA 2EJFA 2EIFA 5CVIA 5GAMf 1XQHA 2Y4XA 1YIJT 5GANj 5DY9A 3HP9A 4ELZC 2M9UA 3CCET 2QEXT 3UPUA 3BDLA 5LJ3f 2PVDB 1O75A 3KXTA 2BKDN 4PJOE 2MF2A 3HRTA 4F7UA 3OYFA 1K8AU 4TVRA 3SWNB 5A0DA 4DQ2A 5A0GA 3M4YA 5GAOp 1HK9A 2CGHA 3V8LA 4M77D 3PNWC 2XK0A 3MEWA 3JSCA 3OBYA 4F7UF 3CMET 4C92A 2RI2A 4C0ZA 4M78E 5GAN4 1KHCA 2GQVA 4BY6B 3A8LB 1XOVA 3RKXA 1B34A 4C8QB 2Y90A 4RCBA 1W4SA 3GP8A 2RD1A 2M1HA 4M75E 4C92F 3CBMA 4E7LA 3CMAT 3CC2A 2K3YA 1R8OB 4ATOA 2ZPEB 3MEAA 4M7AG 2EQMA 2JZ2A 2E64A 4J7FA 4XQ3A 2RK2A 2HQEA 5LL6S 2RHIA 3PMTA 4A53A 4EMKC 5A0LA 1KQSA 2PUKB 1QVGA 1Q81C 2VC8A 2YLCA 2VV5A 1O9SA 3UWNA 3AHUA 2ZPGB 1VQ5T 1N27A 4Q5WA 2QQBA 5FU7B 2DKGA 1WNLA 3FDRA 4A4GA 1M90U 1M1KC 1G3YA 1UGSB 4C5EA 1Q86C 4C8QG 3NTHA 2E65A 2M0OA 3JCMV 4C5GA 5GAOl 3G6EA 4BDYA 3X25B 2E5QA 4M7AD 1W2BS 1WJRA 3CBOA 3OYIA 4JRKA 3NFCA 4N0AA 4X34A 4C0FA 4OB1B 4C0DB 2DD5A 4KUDK 4FT2A 4N4HA 3FB9A 3OYGA 3I55A 5CKEA 4J8OA 5CKFA 3JCMW 1FX7A 2FVUA 2I2LA 4M78D 3JCMe 3C94A 4N4GA 5I2MA 2BIVA 3X20B 5GAN7 2WSFE 1X01A 4ME7A 4E7HA 1Q7YC 3RUXA 5I2SA 3OQ5A 1UB4A 3NTKA 2EKOA 5CQYA 4ELYC 1K73C 3FLGA 3VU3C 2VGMA 4C8QD 3OSVA 2DTOA 2LT1A 3CCJT 4EPCA 3TU4K 3X26B 3CPWS 1VQOA 1G3SA 2R58A 2VGNA 2H3JA 4QVZA 3HKSA 5GAMg 1M8VA 2JNGA 2ZPIB 2LQKA 1BI2A 1RL2A 2LC4A 2RA2A 1Q82C 5GAN5 3LX7A 3P8HA 5LJ3j 1BI1A 2DIQA 4XTWA 2E70A 3JCMc 5FRMA 3E9GA 2MMPA 3F70A 4XK8E 5KE3A 1B34B 3E1SA 3VYHB 3M9QA 2X4XA 4LDUA 1QW1A 1MHNA 1VIEA 2KAFA 1NPRA 2RHUA 5GANh 5GANe 5IAYA 4JS4A 1KQ1A 4M7DE 2P4TA 1K9MU 1VQ6A 4L6V5 1U1TA 5FU6C 3MP8A 4M77C 5FLXE 1S72A 3PMIA 5CAIA 1FXXA 2QQSA 3JAME 3M58A 3SWNA 4F7UG 1UGQB 3Q1JA 1Q81U 5DLQE 4BI4A 4JJNK 4MDXA 4JDSA 1JJ2S 3LWHA 3RKWA 3VV0A 4JRQA 4IUUA 3J81E 4C92G 5M9OA 3ME9A 2DXUA 2L8DA 2DTIA 3CC4T 3X28B 3OMGA 3WVDB 3M4GA 1QVFS 3DKMA 3M59A 5GMKm 2OTJT 3OW2S 2E1HA 3OYKA 3HRUA 1VIFA 5CO7A 4DOWA 4E7JA 4IUQA 4EDUA 3TREA 1VQMT 1VQKT 2BUDA 4M77E 1NPPA 1V29B 3WXMB 4R56A 4N4IA 3MP1A 4FIBA 4C92D 5CCAA 2K5IA 4PJOC 4XAXB 4M7AC 4C5IA 3GNFB 1VQPT 3CMEA 4M75A 4OB3B 1M1FA 3CXCS 2X35A 1U1SA 2LX9A 3META 2V8KA 4HCBA 4M78C 3OS2A 3CC7T 2DXCA 4L59A 4EMGA 3A8MB 3MP6A 3CMAA 1I5LA 3NTIA 1VQ9A 4B9XA 3CEYA 4JRIA 2VYTA 4FU6A 1H641 4ZGEB 2DXBA 4IUTA 5GMKh 2KDSA 2K3XA 1YCYA 2V8IA 1SSFA 4VUBA 2DJZA 5GMKe 2OTLA 5D6WA 4M7AF 2RJEA 4BE1A 3QZ5B 2DVEA 4Z02A 3OS0A 3OYEA 1YI2T 3HL8A 2CZ6B 2YLBA 2ZPBB 4FSXA 2QA4A 2NLUA 1VQ5A 4MDWA 2O4XB 4XTYA 5IN1A 4QW2A 2LT4A 4J6XA 4C5HA 3R6OA 5CIUA 2ZZDA 3LGLA 5GAMe 1YJNT 4M7AE 4KBMB 4OMFB 4HKEA 1M5Q1 5GMKi 2RJFA 3QDRB 1OYXA 2OAUA 5LJ3h 4Y28E 1Q86U 1M1KU 5LJ3e 1KD1C 1KHIA 4CRIA 2DAQA 5LJ5d 1OZ3A 3QXEB 3QIIA 3LH0A 5LJ5g 3G7ZA 2RI5A 4DOVA 2WACA 4PLIA 1YITA 1WQ7A 1UEBA 1LOJA 4EMKA 2JVVA 3I56T 3HPWA 3UT1A 3VKIA 2K5FA 3QPHA 3OYAA 4C8QE 1VQ8T 2CZ7B 2MAMA 3GIBA 3CPWA 4GLKA 4XTVA 3GLXA 1Q7YU 1BI0A 4MMLA 4PLLA 3OYJA 3CCJA 1K73U 1VQLT 2DK3A 2RHXA 1Y7XA 2B8AA 4BACA 5HY6A 1QP3A 1YJWT 4XTXA 4LD9K 3C4SA 2DXTA 4LDVA 4BE0A 1KC8C 1DJ7B 3CCVT 3MCAB 3FRNA 4J6WA 4M75B 5GAN6 3CCQT 3LW5E 3VYGA 1Q82U 3OYBA 5FROA 1G3TA 3L2ZA 5C0MA 1BKBA 1M1GA 3M5AA 4QVCA 2DTHA 3JB9F 2A7YA 3INZA 3C12A 4C92C 1XNIA 4BD3A 3OYHA 3M53A 1VQ4T 3VJPA 3CD6T 3JCMh 4HT9A 1MGQA 2QI2A 3CCMA 3DLLA 4M7DC 2EFIA 5HK3A 5KCHA 4E7IA 2WSCE 5GMKj 2CS7A 3OYNA 5EG2A 3TEEA 5GMKl 2XHCA 2DO3A 3FIFA 5CKBA 3QHSA 1FWZA 2DIGA 4OVAA 3SFMA 3G4SA 2QDYB 1KQ2A 3CC4A 2JTMA 2EWNA 3BW1A 5GAMj 4CI0C 2XG8D 2EJ9A 4NS5A 2QQAA 3T9NA 3V8JA 4BI8B 4F7UE 2LRQA 2RH2A 3KBGA 2P0QA 2KK4A 1OI1A 2DEQA 3PTAA 1PSEA 1ZQ1A 4C92E 4OGEA 2JUFA 1VQMA 1VQKA 1N9SA 5GAOr 2XDDA 4EMKB 4V2SA 4PNOA 5AYFA 3GNGA 4N0AC 3L1AA 3S3MA 4ZTJA 2XI9A 4J6YA 2O4XA 3HRSA 5CKHA 2JOYA 3OY9A 3OB9A 3PT9A 5HKCA 4C0GA 5LJ5f 1VQ7A 3O8VA 3RMQA 3VUBA 5CK9A 3J7AF 1Y96A 3RMSA 4OB2B 1X75C 3PIOA 1N8RU 1YHQA 3OS1A 1M90C 1VQ6T 4D6WA 3JCMJ 1QVGS 2CKKA 2M16A 3M54A 5I21A 1I81A 3DB4A 1G5VA 1JBMA 4NL2A 4JLGA 3L2QA 4M7DD 2XKOC 2AHJB 1YIJA 4J7IA 1NJIU 4PJOA 1X6OA 3HFNA 4HCCA 2HD0A 3MHXA 2KMTA 2QQ9A 3JCMb 2GFUA 4XU0A 2QTXA 1WGSA 4J5YA 4XTUA 1ZHIA 1OZ2A 3OYLA 2QEXA 3CCEA 5FRNA 3JCMQ 4P5NA 4PJOF 5GAOm 4HA8A 4E47A 2ZGWA 1YJ9T 1YJNA 3UDCA 4FM4B 4M78A 3GOXA 3M55A 2XIDA 2JTFA 3QJYA 2E41A 4MZTA 2FYKA 2CZ1B 3OMCA 1G3WA 3EAEA 4OP0A 4R55A 3URGA 4B9WA 2G3RA 4E7KA 5CKDA 2E12A 3QYGB 3CCST 3JRZA 3JB9G 1KD1U 3SWNC 1VQOT 2ZPHB 3DB3A 2P0KA 3L2VA 2LVMA 4DA4A 3I56A 4M75F 2F69A 2RJDA 3FC3A 1VUBA 2LDMA 4FT4A 2F5KA 4JUVA 3QUIA 4A54A 3VUZA 2X4YA 2XDPA 5KCOA 5GAOq 5FU6B 4M77B 3RESA 3RIRA 5DM7R 2KY9A 3QG1A 3OA6A 3C95A 4BB7A 2HQXA 4C8QC 4KT0E 2FL7A 3JCMd 3OYMA 4XTZA 5CQXA 5D6YA 3SD4A 1YJWA 4XU3A 2GCXA 3OBWA 3KUFA 3QYHB 4ZGJB 1WJQA 3JB9D 2EAYA 2L89A 3QJ6A 2K57A 3OSSC 3QKJA 4X9DA 5GAMh 1W2BA 3JB9H 2X4WA 2D6FA 2RK1A 3G71T 1RI0A 1Y96B 3CBPA 2IG0A 1I4K1 3M57A 4RKUE 5L8RE 2FHDA 2PU9B 4X9CA 4KULA 3HFOA 3CCLT 5FU7C 3SB2A 1NZ9A 1VQ4A 5J3BA 3ER0A 3CD6A 4MMKA 3S3OA 2QQRA 3V7CA 5GANd 2XICA 1BIAA 1D3BA 4ZN1A 5GAN8 1AHJB 1WJSA 2DPPB 5GANg 1VQNT 4C0DC 4M7AB 4PJOB 1KG1A 3CCUT 2RM4A 2K2VA 1M4ZA 2ZPFB 3CCRT 1IZ6A 3LWIA 3E9FA 4M78B 2MWOA 4WF2A 2E6NA 1JB0E 5GAN2 3PFSA 3OYCA 3JCMP 1M9SA 2YRVA 2DD4A 3ZFJA 3PGGA 2R5AA 4ZN3A 4HT8A 4M7DA 3P8DA 4XU1A 2DZ9A 3H6ZA 3BDUA 4A4HA 3M56A 1VQ9T 4PL6A 4MZPA 5J26A 4PJOG 4M7DF 4RCCA 5KE2A 2QXFA 3BY7A 3HHTB 2VUBA 4OB0B 2OTLT 1N6AA 1JJ2A 2ZCFB 3TCJA 3LGFA 3JB9I 1UGRB 4M78G 3ZBDA 2QA4T 1K8AC 5J39A 3EFSA 5DLOA 1LJOA 5HK0A 1QVFA 2EQJA 1NE8A 3OS5A 4M75G 4JRPA 5IT9E 2LQ8A 3OW2A 4LD6A 2RHYA 3MO8A 2KQWA 4RMOA 3J80E 4IKFA 3RERA 4PJOD 3JCMf 1BI3A 2OTJA 4GY5A 3PIPA 4M77A 1GXIE 1U8RA 4PKCC 3GF5A 3S6WA 2C06A 4A4FA 2P0PA 2EQUA 2HNIA 3QZ9B 1YITT 1IREB 1H3ZA 1YJ9A 3V7RA 4BE2A 4QQDA 1D3BB 1UGPB 4M77F 3SDZA 3V7SA 1WQWA 3BFMA 1WPYA 4M75D 3CC2T 4JS5A 3ZEHA 3CXCA 2D9TA 1VQPA 2GF7A 2EJGA 2R57A 3CCSA 2PQWA 2VXEA 3P8BB 3QSUA 2E10A 4LDYA 4F7UB 5GAMd 1QP2A 4QQGA 2D0QB 5D6XA 2JN0A 4O6JA 2E6ZA 4IUVA 1JRIA 2MI6A 3CC7A 1ZBXA 5LJ3d 5GANf 4IUPA 5LJ5h 2RB6A 4C92B 5LJ5e 1KQSS 5LJ3g 2CYZB 3X24B 4FL6A 2A3LA 4M7DB 1TH7A 2X4JA 4RG8A 3G6ET 3L2RA 4A4KA 4LDXA 4NL3A 2R5MA 4ZGDB 1BIBA 1Y07A 1YBYA 1YI2A 4M7AA 5C6SA 3A8GB 3OYDA 2LCLA 3GPLA 4II1A 3I55T 3QO3A 2HBPA 4LDWA 1Y71A 3CCMT 3OYYA 4MZMA 2WSEE 2PVOB 2RO0A 1P92A 3L42A 3CPFA 3DLMA 3LLRA 4J83A 1LNXA 4JLIA 4EMHA 3G71A 3A5ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C4S A;  4UC4 A;  4BDZ A;  4BE0 A;  4A4E A;  2X4W A;  5KH6 A;  2RI3 A;  2R58 A;  1RI0 A;  2LCC A;  4QVZ A;  2IG0 A;  3MEU A;  3OYB A;  2FHD A;  4RG2 A;  5FRO A;  3LX7 A;  4QQ6 A;  3P8H A;  5C0M A;  2DIQ A;  2L3R A;  5FRM A;  3E9G A;  3F70 A;  5KE3 A;  2GFA A;  3H8Z A;  4HCZ A;  3M9Q A;  2X4X A;  1MHN A;  1XNI A;  2LTO A;  2QQR A;  2RHU A;  3MEV A;  4BD3 A;  3OYH A;  3FEO A;  5IAY A;  3S3O A;  4ZTF A;  3QBY A;  1WJS A;  2EFI A;  4E7I A;  5KCH A;  3MP8 A;  2MWP A;  3PMI A;  3OYN A;  2QQS A;  3Q1J A;  2RHZ A;  2RJC A;  3LYI A;  2DIG A;  4OVA A;  3QJ6 A;  3E9F A;  2MWO A;  2E6N A;  3PFS A;  3OYC A;  4IUU A;  3L2W A;  2YRV A;  5M9O A;  4NS5 A;  3ME9 A;  2L8D A;  2LRQ A;  2R5A A;  3OMG A;  3L2U A;  1OI1 A;  3ASK A;  3P8D A;  3H6Z A;  3S3N A;  4IUR A;  4A4H A;  4PL6 A;  5J26 A;  3OYK A;  2EQK A;  5KE2 A;  4E7J A;  4IUQ A;  4EDU A;  3S3M A;  4ZTJ A;  2BUD A;  3LGF A;  3BDL A;  4N4I A;  2O4X A;  3MP1 A;  2BKD N;  3OY9 A;  3OB9 A;  3OYF A;  4C5I A;  3O8V A;  5J39 A;  2EQJ A;  3PNW C;  2XK0 A;  3MEW A;  3OS1 A;  2X35 A;  3MET A;  4LD6 A;  2RI2 A;  2RHY A;  3MO8 A;  3OS2 A;  4IKF A;  2CKK A;  1KHC A;  2M16 A;  4L59 A;  3DB4 A;  1G5V A;  3MP6 A;  4GY5 A;  3NTI A;  4B9X A;  3CEY A;  2M1H A;  2VYT A;  3L2Q A;  4FU6 A;  3S6W A;  4E7L A;  4IUT A;  4A4F A;  2K3X A;  2EQU A;  2K3Y A;  1SSF A;  3MEA A;  5D6W A;  2GFU A;  1H3Z A;  1WGS A;  2RJE A;  3OYL A;  4BE1 A;  1OZ2 A;  2EQM A;  4QQD A;  2JZ2 A;  4Z02 A;  4BE2 A;  3OS0 A;  3OYE A;  5FRN A;  2HQE A;  3ZEH A;  2RHI A;  2D9T A;  2NLU A;  3PMT A;  2GF7 A;  2R57 A;  2O4X B;  5IN1 A;  4C5H A;  2PQW A;  2JTF A;  4QW2 A;  3GOX A;  5CIU A;  3OMC A;  3LGL A;  3EAE A;  4QQG A;  5D6X A;  3UWN A;  4B9W A;  4E7K A;  2G3R A;  1N27 A;  2RJF A;  4Q5W A;  1OYX A;  4IUV A;  4A4G A;  3FDR A;  4C5E A;  3DB3 A;  4IUP A;  2P0K A;  3NTH A;  3L2V A;  2M0O A;  2DAQ A;  2LVM A;  4C5G A;  4CRI A;  4BDY A;  1OZ3 A;  2E5Q A;  1WJR A;  2RJD A;  3QII A;  3LH0 A;  2LDM A;  4FL6 A;  3OYI A;  2F5K A;  2RI5 A;  3FC3 A;  2WAC A;  4PLI A;  4X34 A;  2X4Y A;  2XDP A;  5KCO A;  3L2R A;  4N4H A;  3UT1 A;  3OYG A;  2R5M A;  3OYA A;  3OA6 A;  2HQX A;  4N4G A;  5C6S A;  2BIV A;  3OYM A;  3OYD A;  5D6Y A;  4II1 A;  3SD4 A;  4PLL A;  4E7H A;  3OYJ A;  3KUF A;  3OQ5 A;  3NTK A;  1WJQ A;  2EKO A;  2RHX A;  2RO0 A;  3LLR A;  3L42 A;  3DLM A;  2B8A A;  2L89 A;  3FLG A;  4BAC A;  3QKJ A; 
#chains in the Genus database with same CATH topology
 2LQW A;  4UC4 A;  2BTT A;  4OF1 A;  1UEC A;  2RI3 A;  1K9A A;  4OGC A;  2LCC A;  2MPX C;  1T3S A;  2EYQ A;  3VS0 A;  4M78 F;  2KSS A;  2CUB A;  4M7D G;  1HXD A;  1C6V X;  2L3R A;  3A8O B;  2YHT A;  2A08 A;  3H8Z A;  1D0Y A;  1ZUU A;  2V8J A;  4ZTF A;  3FEO A;  3FJP A;  4XU2 A;  3QBY A;  2LX7 A;  4PK4 A;  2PVG B;  4AT1 B;  3VRZ A;  4L5G A;  3V8K A;  1FMK A;  4RTW A;  3LYI A;  1Q81 C;  1S72 T;  2RQR A;  1MV3 A;  2F5T X;  1KC8 U;  3N5B B;  1VQ7 T;  4NOY A;  1BYM A;  1YHQ T;  1PSF A;  1QWF A;  2OAW A;  4M77 G;  2LNV A;  5LJ5 j;  1NJI C;  3WVE B;  2EQI A;  4J9G A;  2EJF A;  2EIF A;  1G8X A;  5GAM f;  2Y4X A;  3HP9 A;  3M0Q A;  1O75 A;  4PJO E;  4AMC A;  3HRT A;  4DQ2 A;  1WLP B;  5A0G A;  1NEB A;  2L0A A;  1NJI R;  1UJY A;  3CME T;  5GAN 4;  1KHC A;  2GQV A;  4BY6 B;  3A8L B;  3REB B;  2FPF A;  3GP8 A;  1ZSG A;  1Q95 G;  3CMA T;  2K3Y A;  4CC3 A;  2JZ2 A;  4XQ3 A;  2RK2 A;  3PMT A;  4A53 A;  2J6K A;  5KYU A;  1QVG A;  1RAA B;  2VC8 A;  2ZPG B;  1ARK A;  2EGE A;  5FU7 B;  4A4G A;  1WNL A;  1M90 U;  2DL8 A;  3NTH A;  2E65 A;  4C5G A;  3G6E A;  2E5Q A;  1E6G A;  4M7A D;  3CBO A;  2HKN A;  1GBQ A;  1QCF A;  3FB9 A;  3I55 A;  3UF4 A;  1AZE A;  2BIV A;  3X20 B;  2M51 A;  5I2S A;  3H41 A;  1RAD B;  3FLG A;  2DTO A;  2QTV A;  3TU4 K;  1E6H A;  2VGN A;  1M8V A;  2LQK A;  2RA2 A;  1Q82 C;  2DIQ A;  2MMP A;  3F70 A;  4OMP A;  1Y57 A;  1VIE A;  2KAF A;  5GAN e;  5IAY A;  1PKS A;  1IHV A;  4J9B A;  2ROT A;  1S72 A;  4D8K A;  3M58 A;  4F7U G;  4KH1 B;  5KYU B;  4MDX A;  2MOX A;  3EG1 A;  2QG9 B;  3LWH A;  2EYZ A;  4C92 G;  1B07 A;  3PE0 A;  5M9O A;  2L8D A;  3M59 A;  5GMK m;  2OTJ T;  4DOW A;  2X3X D;  4IUQ A;  1VQK T;  2BUD A;  2IPO B;  1WHJ A;  3U23 A;  2L2P A;  4FIB A;  4XAX B;  5KYX A;  4M7A C;  3CME A;  2K3B A;  1SF9 A;  3LH5 A;  4OB3 B;  1M1F A;  2LX9 A;  2V8K A;  3VS6 A;  4F04 B;  1OX9 A;  3CMA A;  1I5L A;  3NTI A;  3CEY A;  4ZGE B;  4RUG A;  2KDS A;  2K3X A;  1YCY A;  2L3P A;  2V8I A;  4DBH A;  2DVE A;  1T3L A;  1YI2 T;  3HL8 A;  2YLB A;  2MCN A;  1NLP C;  2FPD A;  2LQN A;  2QA4 A;  5IN1 A;  2RF0 A;  3PVL A;  5GMK i;  1M1K U;  1Q86 U;  1KD1 C;  1KHI A;  2BE9 B;  1VQM Q;  5LJ5 g;  3RR6 A;  2DET A;  1UEB A;  2JVV A;  3HPW A;  3UT1 A;  3QPH A;  4RTV A;  3OYA A;  1VQ8 T;  2MAM A;  1TXQ A;  4GLK A;  2GBQ A;  2NUP A;  4PLL A;  3OYJ A;  1KD1 R;  2VVK A;  1Y7X A;  4LD9 K;  1KC8 C;  1B7T A;  4BE0 A;  3CCV T;  1AWW A;  5GAN 6;  3LW5 E;  2X3W D;  3H9N A;  4E7Z A;  1NYF A;  5FRO A;  4ORZ A;  2J05 A;  3EHQ A;  3INZ A;  3C12 A;  1VQ4 T;  3VJP A;  1KC8 R;  4M7D C;  1MGQ A;  2EFI A;  4E7I A;  3G1J A;  5GMK j;  3FIF A;  1FWZ A;  3SFM A;  3G4S A;  2QDY B;  3I56 Q;  1X27 A;  2XG8 D;  2QQA A;  1C0M A;  1MMG A;  2HKQ B;  2DRK A;  1X6B A;  2JUF A;  1VQK A;  2NWM A;  4J9E A;  4B6M A;  1V76 A;  2W0Z A;  1SSH A;  5CKH A;  5HKC A;  5CK9 A;  3IQL A;  3R6N A;  1N8R U;  1M90 C;  2PZ1 A;  2AKK A;  1VQ6 T;  1QVG S;  3M54 A;  1RLP C;  1I81 A;  2FEI A;  5GJW B;  1X6O A;  4HCC A;  1OOT A;  2KMT A;  3RDV A;  1M2O A;  1WGS A;  4J5Y A;  4HVW A;  4P5N A;  1M90 R;  1YCS B;  5GAO m;  4E47 A;  4FM4 B;  1OV3 A;  3M55 A;  1PKT A;  3QJY A;  1XJW B;  2HSE B;  3OMC A;  2CZ1 B;  2BZY A;  2E12 A;  3JB9 G;  1VQO T;  2DYI A;  2RJD A;  1M3A A;  4FT4 A;  5KCO A;  3RIR A;  1WA7 A;  3C95 A;  2KEA A;  3OYM A;  3JV3 A;  3SD4 A;  4E2F B;  1G83 A;  2VKN A;  2DVJ A;  1CKA A;  1WHH A;  4X9D A;  2D6F A;  3G71 T;  5L8R E;  1PWT A;  3M57 A;  4RTU A;  2QAZ A;  4AFZ C;  2JM8 A;  1YJ9 Q;  1VQ4 A;  5J3B A;  1M30 A;  4MMK A;  3S3O A;  2QQR A;  5IHI A;  1ABQ A;  1BIA A;  1WJS A;  1KG1 A;  1VQN T;  4M7A B;  2HZY A;  4RTX A;  4FSS A;  1M4Z A;  2ZPF B;  3CCR T;  2V26 A;  3CC7 Q;  5D7U A;  4AG1 C;  3E9F A;  2MWO A;  2E6N A;  1AD5 A;  5GAN 2;  3PFS A;  2GGR A;  1WI7 A;  3A1P A;  2ECZ A;  4M7D A;  3P8D A;  3BDU A;  4PL6 A;  4M7D F;  3VS4 A;  1IRX A;  1AEY A;  2ZCF B;  3THK A;  3CQT A;  2CP2 A;  2C0T A;  1PM3 A;  1NEG A;  2CP6 A;  5J39 A;  1VQ6 A;  2EQJ A;  3MO8 A;  4IKF A;  4GY5 A;  3CCU Q;  4M77 A;  1GXI E;  4PKC C;  2C06 A;  1YWO A;  2AT1 B;  2HNI A;  3QZ9 B;  1YIT T;  1UUE A;  1SKU B;  2F2V A;  3V7R A;  1CSK A;  4M77 F;  3CC2 T;  1WQW A;  3O5Z A;  1WPY A;  4M75 D;  2ATC B;  1Q86 R;  1IXD A;  2D9T A;  1VQP A;  2E10 A;  4LDY A;  5GAM d;  1CKB A;  3I5R A;  2JN0 A;  2E6Z A;  2MI6 A;  5GAN f;  1KQS S;  5LJ3 g;  1Z9Q A;  4M7D B;  1TH7 A;  1WFW A;  4A4K A;  2R5M A;  2QA4 Q;  1BIB A;  1Y07 A;  3GPL A;  2LCL A;  1ZSZ C;  2HBP A;  1TUD A;  3EGD A;  3LLR A;  2PVO B;  3DLM A;  3G71 A;  2Y4Y A;  3I35 A;  4BDZ A;  4A4E A;  2HCK A;  1LPL A;  3JCM X;  2CP3 A;  4DBQ A;  4RG2 A;  4QQ6 A;  2CSQ A;  2A37 A;  3JB9 J;  4Y91 A;  1VQN A;  2JT4 A;  3MEV A;  1XTD A;  4BY6 C;  3CCR A;  1K9M C;  3EG2 A;  2DZC A;  2FZK B;  3JCM g;  3E19 A;  1N9R A;  4O5V A;  1GFD A;  5I22 A;  4BI3 A;  2M02 A;  1FYN A;  4QKU A;  1N8R C;  4YTL A;  2PUO B;  3EFR A;  2D0N A;  3ASK A;  2XD0 A;  4M75 C;  5KYY B;  4KUI A;  1R0B G;  2EQK A;  1BB9 A;  1YIJ T;  5GAN j;  1N8R R;  3CCE T;  2QEX T;  2AIR B;  2BKD N;  4F7U A;  3M4Y A;  2CGH A;  1D0X A;  2YDL A;  2ZAE A;  4F7U F;  3OBY A;  4M4Z A;  2KYB A;  4C92 A;  1XOV A;  3RKX A;  1B34 A;  1W4S A;  2RD1 A;  4ANJ A;  4C92 F;  1UDL A;  2J6F A;  3CC2 A;  2ZPE B;  3MEA A;  4M7A G;  3EHR A;  2E64 A;  2JTE A;  9ATC B;  2YLC A;  2VV5 A;  1O9S A;  2DIL A;  3UWN A;  1M3B A;  5EC7 A;  1VQ5 T;  1N27 A;  1KQS P;  2QQB A;  2DKG A;  1UFF A;  4C5E A;  2PNI A;  2M0O A;  4BDY A;  1M8M A;  3OYI A;  4N0A A;  4X34 A;  4C0F A;  3BE3 A;  2DD5 A;  2F2W A;  4N4H A;  3OYG A;  5CKE A;  4J8O A;  3JCM e;  4N4G A;  5GAN 7;  2WSF E;  2JMC A;  4E7H A;  1BK2 A;  3NTK A;  1OPL A;  2EKO A;  1KFZ A;  2DA9 A;  2VGM A;  4C8Q D;  2DFU A;  2YUP A;  3X26 B;  2R58 A;  3RBB B;  4QVZ A;  3HKS A;  4ZNX A;  4WTO B;  5GAN 5;  3LX7 A;  3P8H A;  4XTW A;  5FRM A;  4XK8 E;  5KE3 A;  1B34 B;  2YXY A;  3VYH B;  1MHN A;  5GAN h;  1RAF B;  1KK7 A;  1OUL A;  4M7D E;  2P4T A;  2YRC A;  1RLQ C;  1U1T A;  5CAI A;  5FW9 A;  1UGQ B;  3Q1J A;  1ZA1 B;  1QLY A;  4JDS A;  2EGA A;  2DMO A;  4IUU A;  3E2U A;  1N5Z A;  2DXU A;  2CT3 A;  1NYG A;  2DTI A;  2RQV A;  3X28 B;  3M4G A;  1SRL A;  3CCJ Q;  1MMN A;  5CO7 A;  2LNH B;  1UGV A;  3TRE A;  3VS3 A;  4M77 E;  3WXM B;  5IHN A;  5CCA A;  1GRI A;  4C5I A;  1K76 A;  4M75 A;  5IXB A;  2YUO A;  4HCB A;  3CC7 T;  1VQ9 A;  4B9X A;  1AVZ C;  2EYY A;  4JRI A;  4KRT A;  2VYT A;  1ZSZ B;  2XMF A;  3CCM Q;  1H64 1;  5D6W A;  2DBM A;  1X43 A;  2ZPB B;  4FSX A;  2NLU A;  1VQ5 A;  2O4X B;  3M0T A;  3CC4 Q;  4QW2 A;  4J6X A;  3R6O A;  4KBM B;  4OMF B;  4HKE A;  4JJD A;  1OYX A;  2VAS A;  4Y28 E;  1IO6 A;  4FW2 A;  4CRI A;  2WAC A;  2QK0 A;  2HDA A;  2RQT A;  2VWF A;  3CPW A;  1Q7Y U;  1BI0 A;  4MML A;  1K73 U;  2KT1 A;  1VQL T;  5GJV B;  2RHX A;  2LMJ A;  5HY6 A;  1QP3 A;  1TTH B;  3TSZ A;  1YJW T;  3C4S A;  4LDV A;  2JS2 A;  3FRN A;  1W1F A;  4M75 B;  3CCQ T;  1W70 A;  5I11 A;  1RAI B;  1M1G A;  2EKH A;  2DTH A;  3JB9 F;  2A7Y A;  1XNI A;  4LXC A;  3EGX A;  1YJN Q;  3CD6 T;  4HT9 A;  2QI2 A;  3DLL A;  5HK3 A;  1D09 B;  2CS7 A;  5EG2 A;  2D8H A;  5GMK l;  2XHC A;  3QHS A;  1K4U S;  1EZZ B;  1KQ2 A;  2ROL A;  4J9F A;  5GAM j;  4CI0 C;  4F7U E;  2LRQ A;  1WIE A;  1QCO A;  2M0Y A;  1YN8 A;  3PTA A;  1ZQ1 A;  4C92 E;  4OGE A;  1N9S A;  3S3M A;  4ZTJ A;  1KSW A;  4C0G A;  1VQ7 A;  3I9Q A;  1Y0M A;  3RMQ A;  3VUB A;  1RAB B;  3J7A F;  4OB2 B;  3PIO A;  1YHQ A;  1G5V A;  3L2Q A;  2AHJ B;  3HFN A;  2QQ9 A;  2QTX A;  4XTU A;  3EGX B;  1TS9 A;  2ZGW A;  1GBR A;  1RAE B;  4MZT A;  3NHN A;  1G3W A;  4R55 A;  4E7K A;  2G3R A;  5CKD A;  3CCS T;  3SWN C;  1VA7 A;  2BZ8 A;  1X6G A;  2NUZ A;  3L2V A;  2COZ A;  1VUB A;  2LDM A;  1MUZ A;  4JUV A;  1HJD A;  3QG1 A;  1RUW A;  4BB7 A;  4KT0 E;  2C0I A;  2AK5 A;  1YJW A;  4XU3 A;  1OX8 A;  2EAY A;  2L89 A;  5GAM h;  1OU8 A;  3JB9 H;  2X4W A;  4RKU E;  2IG0 A;  1ZBJ A;  3CCL T;  4FYX B;  2YRD A;  1NZ9 A;  3ER0 A;  4AFS C;  3CD6 A;  1WXU A;  1TU0 B;  2GTJ A;  3V7C A;  5GAN d;  4ZN1 A;  5GAN 8;  2DPP B;  2QDL A;  4A63 B;  2DJQ A;  4WF2 A;  4KH0 B;  1JB0 E;  4Y92 A;  3NGP A;  2RPN A;  1X69 A;  1LCK A;  4IIO A;  4XU1 A;  1VOM A;  3VS5 A;  2O2O A;  3HTR A;  3QWY A;  2QXF A;  4F16 A;  2OTL T;  1MMD A;  1JJ2 A;  4HXJ A;  1SG5 A;  2RQU A;  3EGU A;  3LGF A;  3JB9 I;  1NLO C;  1T0H A;  4M78 G;  1JU5 C;  3EFS A;  1LJO A;  1QVF A;  4M75 G;  1NE8 A;  4CC4 B;  5IT9 E;  1WHK A;  3OW2 A;  4LD6 A;  2RHY A;  3M0R A;  4PJO D;  3JCM f;  2OTJ A;  2EGC A;  1AT1 B;  2GTO A;  6AT1 B;  4A4F A;  2P0P A;  3SDZ A;  2EVR A;  4JS5 A;  2JW4 A;  1WYX A;  3CCS A;  3P8B B;  1QP2 A;  5D6X A;  2JS0 A;  1VQ9 Q;  1JRI A;  4AFU C;  5LJ5 e;  1QKX A;  4RG8 A;  1JXM A;  1UTI A;  2DF6 A;  2YUQ A;  2ED0 A;  2FRY A;  4ZGD B;  1YBY A;  1YI2 A;  4M7A A;  3H0I A;  5C6S A;  3OYD A;  1Y71 A;  4D8D A;  2CP5 A;  4KGZ B;  4MZM A;  3OYY A;  2WSE E;  3CCM T;  2H3E B;  4EMH A;  3CPF A;  4JLI A;  2CDT A;  4M7A F;  2L5Q A;  2A28 A;  1WXT A;  1M2V A;  3CCL A;  2O01 E;  4DBR A;  2XU8 A;  2G6F X;  2LJ0 A;  1I8F A;  1KIK A;  1VQ8 A;  1AOJ A;  2O31 A;  2JJ9 A;  2CZ0 B;  2MWP A;  4CC2 A;  2MIO A;  3A8H B;  2GQI A;  3CCV A;  2K4Y A;  2YSQ A;  1SPK A;  3G6E Q;  5A2Q E;  2J6O A;  2XDB A;  3I55 Q;  3SHW A;  3VS1 A;  4IUR A;  2DER A;  3RKY A;  5CVI A;  1XQH A;  1AWJ A;  5DY9 A;  4FW1 A;  2M9U A;  2DM1 A;  3BDL A;  3VS2 A;  1MND A;  3UAT A;  2MF2 A;  1TWB A;  1EFN A;  3OYF A;  1K8A U;  4TVR A;  3SWN B;  1RI9 A;  1YNZ A;  4FYW B;  4OMN A;  2CUD A;  3PNW C;  3MEW A;  3JSC A;  4C0Z A;  1WHL A;  1M2V B;  1U5S A;  2V1Q A;  2E3H A;  3CBM A;  4E7L A;  1F1B B;  1S72 Q;  4GBQ A;  2EQM A;  1VQ7 Q;  4J7F A;  1GCQ C;  2COY A;  2HQE A;  1M27 C;  2RHI A;  2E4H A;  2J06 A;  2PUK B;  1YHQ Q;  1ZA2 B;  3AHU A;  4Q5W A;  2HL3 A;  1QVG P;  3FDR A;  1WHG A;  1UGS B;  1Q86 C;  1M1K C;  4C8Q G;  3JCM V;  4E6R A;  4LUD A;  3X25 B;  4JRK A;  2ENM A;  4KUD K;  3JCM W;  1FX7 A;  2FVU A;  1I5O B;  4M78 D;  5I2M A;  1X01 A;  3RUX A;  3OQ5 A;  4ELY C;  3CME Q;  1M1K R;  4EPC A;  4PFP A;  1VQO A;  2AKL A;  2H3J A;  3CMA Q;  4QT7 A;  2ZPI B;  1BI2 A;  1RL2 A;  2DEU A;  1BI1 A;  5KYY A;  2E70 A;  3JCM c;  4J9D A;  4LDU A;  1QW1 A;  1NPR A;  2RHU A;  3QWX X;  5KYN A;  1KQ1 A;  1SHG A;  4OML A;  2LZ6 B;  4L6V 5;  5FU6 C;  5FLX E;  3MP8 A;  2CT4 A;  1ZLM A;  2X51 A;  2V1R A;  3JAM E;  1Q81 U;  1NBE B;  4R0K A;  4BI4 A;  4JJN K;  2F2X A;  1JJ2 S;  1ZX6 A;  3RKW A;  3VV0 A;  1Z9Z A;  3ME9 A;  3WVD B;  1QVF S;  3DKM A;  3I5S A;  3OW2 S;  2KT8 A;  3OYK A;  3HRU A;  1H3H A;  1K1Z A;  2VB6 A;  1X2K A;  4E7J A;  1EX4 A;  1D1C A;  1VQM T;  1NPP A;  1V29 B;  4R56 A;  4N4I A;  2KRS A;  2CP0 A;  1U1S A;  3MET A;  2EYX A;  3MPU B;  4M78 C;  2DXC A;  3MP6 A;  4HCK A;  2YT6 A;  4IUT A;  4VUB A;  1SSF A;  5GMK e;  2RJE A;  4Z02 A;  2JXB A;  3OS0 A;  3OYE A;  1RAH B;  3G4S Q;  2K79 A;  2IIM A;  2OI3 A;  1SHF A;  5CIU A;  4M7A E;  2ZZD A;  3LGL A;  2OTJ Q;  5LJ3 e;  4OMM A;  3QXE B;  1VQK Q;  3G7Z A;  2RI5 A;  4DOV A;  4PLI A;  1E7O A;  2DL7 A;  1YIT A;  1WQ7 A;  2P4R A;  4LUE A;  1LOJ A;  3I56 T;  3VKI A;  3NMZ C;  1MV0 B;  3A98 A;  3GIB A;  1IGQ A;  4XTV A;  3GLX A;  2KBT A;  4J9C A;  4J6W A;  3VYG A;  2DL3 A;  1Q82 U;  3OYB A;  1G3T A;  1MNE A;  3M5A A;  1YI2 Q;  3VRY A;  4OMO A;  4BD3 A;  3OYH A;  3M53 A;  1RAG B;  3H0F A;  4FYY B;  3REA B;  1IGU A;  2KXD A;  3OYN A;  1JJ2 P;  5CKB A;  2DO3 A;  1PD0 A;  1FMW A;  2YWW A;  4OVA A;  2LJ3 A;  1WZO A;  4PJJ A;  3EFO B;  3TQ7 P;  3TSW A;  2EWN A;  1QVF P;  1VQ8 Q;  2EJ9 A;  1PCX A;  4BI8 B;  3KBG A;  2P0Q A;  2CH4 W;  1OI1 A;  5KYW A;  1ZSZ A;  5FWB A;  2DEQ A;  4DEX A;  1BU1 A;  1K8A R;  1VQM A;  1D0Z A;  4LN2 A;  1WX6 A;  7AT1 B;  2O4X A;  3HRS A;  2JOY A;  2MYS A;  3OY9 A;  2DBK A;  1TSF A;  4RTZ A;  5LJ5 f;  2X9H A;  3RMS A;  1PNJ A;  1X75 C;  1HSQ A;  4J9I A;  1VQ4 Q;  4D6W A;  3GBQ A;  3JCM J;  2M16 A;  5ECA A;  5I21 A;  3DB4 A;  1JBM A;  4AFQ C;  4JLG A;  1YIJ A;  4J7I A;  2ED1 A;  2HD0 A;  3MHX A;  3JCM b;  2GFU A;  4XU0 A;  3CCE A;  2QEX A;  1ZHI A;  1OZ2 A;  1UHF A;  4F14 A;  5FRN A;  1YJ9 T;  4M78 A;  2JTF A;  2E41 A;  2FYK A;  4OP0 A;  4B9W A;  1JEG A;  2AZS A;  2FZC B;  3JRZ A;  1KD1 U;  3DB3 A;  2LVM A;  4IIM A;  3I56 A;  4M75 F;  1X2Q A;  4A54 A;  2GNC A;  1B3Q A;  3VUZ A;  5KYW B;  5GAO q;  5FU6 B;  3RES A;  5DM7 R;  2KY9 A;  5IHK A;  4C8Q C;  2FZG B;  3JCM d;  4XTZ A;  2QGF B;  2SRC A;  3OBW A;  4ZGJ B;  1WJQ A;  1VQ6 Q;  2BZX A;  3QJ6 A;  1BCM A;  1W2B A;  2RK1 A;  1I4K 1;  3FJ5 A;  4K11 A;  4E7S A;  4X9C A;  4KUL A;  1GCP A;  1PC0 A;  2ABL A;  1OU9 A;  1Q81 R;  1D3B A;  4DBF A;  1AHJ B;  1VQP Q;  2HSP A;  5GAN g;  4C0D C;  3CCU T;  2RM4 A;  2B86 A;  1VQO Q;  1PHT A;  3LWI A;  4M78 B;  3OYC A;  1M9S A;  2YRV A;  1K0S A;  2RN8 A;  3ZFJ A;  3PGG A;  2R5A A;  1TUC A;  4PFZ A;  5J26 A;  4PJO G;  4RCC A;  1YFN A;  5KE2 A;  1WDX A;  3BY7 A;  3G71 Q;  2E3I A;  1I07 A;  4FYV B;  3TCJ A;  3EG3 A;  2QYZ A;  1G2B A;  2QA4 T;  3EG0 A;  5DLO A;  5HK0 A;  3OS5 A;  2LQ8 A;  3EG9 A;  2CP7 A;  3J80 E;  2KQW A;  4RMO A;  2YUN A;  1VQN Q;  2K6D A;  3PIP A;  2A0F B;  3CCR Q;  1D1A A;  4LNP A;  1IHW A;  1WXB A;  2W10 A;  4CC7 A;  4JJC A;  1H3Z A;  1YJ9 A;  4BE2 A;  4QQD A;  1D3B B;  2KI7 A;  3BFM A;  3EH2 A;  3ZEH A;  3CXC A;  4OMQ A;  2GF7 A;  2HL5 C;  2EJG A;  3UA6 A;  2PQW A;  2O9V A;  4ESR A;  3QSU A;  4O6J A;  3CC7 A;  1ZBX A;  5LJ5 h;  2DL4 A;  2MK5 A;  1PRM C;  4FL6 A;  1SEM A;  3L2R A;  4LDX A;  2O88 A;  1VYV A;  1W6X A;  4II1 A;  4LDW A;  3D7S B;  2RO0 A;  2NYS A;  1Q82 R;  1YP5 A;  3A5Z B;  5KH6 A;  4Z8A A;  3G4S T;  1YIT Q;  3MEU A;  4C8Q A;  2L3S A;  3EG9 B;  3HSB A;  2KVQ G;  3CC2 Q;  2GFA A;  2FB7 A;  4HCZ A;  2KYM A;  2VXF A;  4C8Q F;  2LTO A;  2JMA A;  3CCU A;  5HCK A;  2QAS A;  2EW3 A;  1VQL A;  2K5L A;  2L3Q A;  2C0O A;  2LJ1 A;  2RHZ A;  2HBW A;  2RJC A;  4M7D D;  2KRN A;  4QVD A;  1QVP A;  1YWP A;  5CR2 A;  5GAN 3;  3CCQ A;  3L2W A;  2SEM A;  4BUG A;  3L2U A;  4DEY A;  2HAX A;  3S3N A;  1EIF A;  2IVW A;  1WHM A;  5GAO n;  4PJL A;  4ELZ C;  3RNJ A;  3UPU A;  5LJ3 f;  2PVD B;  3KXT A;  3MJX A;  3UA7 A;  2RQW A;  5A0D A;  5GAO p;  2Z0W A;  1HK9 A;  3V8L A;  4M77 D;  5AT1 B;  2XK0 A;  1GFC A;  3ZL7 C;  2RI2 A;  4Z89 A;  1D1B A;  4M78 E;  4PFO A;  2KGT A;  2J7I A;  1UHC A;  2Y90 A;  4RCB A;  3H0H A;  4C8Q B;  2M1H A;  4M75 E;  2RNA A;  2I0N A;  2NUT A;  1U3O A;  1R8O B;  4ATO A;  5FWC A;  1QWE A;  5LL6 S;  4EMK C;  5A0L A;  1KQS A;  2LP5 A;  5KYX B;  1TG0 A;  4F17 A;  1G3Y A;  1YIJ Q;  5GAO l;  2E5K A;  1W2B S;  1WJR A;  3NFC A;  3CCE Q;  2QEX Q;  4OB1 B;  4C0D B;  4FT2 A;  5CKF A;  2I2L A;  3M0S A;  3C94 A;  2K9G A;  2FPE A;  4ME7 A;  1Q7Y C;  1H92 A;  1K73 C;  1UB4 A;  5CQY A;  1AWO A;  2KRO A;  3VU3 C;  3OSV A;  3CCJ T;  1U06 A;  2LT1 A;  2QGG A;  3CPW S;  1G3S A;  2K7A A;  5GAM g;  2JNG A;  4JJB A;  2OX7 A;  2LC4 A;  5LJ3 j;  4RTY A;  1I0C A;  3E9G A;  1Q7Y R;  1UJ0 A;  1K73 R;  3E1S A;  3M9Q A;  2X4X A;  4JS4 A;  2NUT B;  1K9M U;  1QMC A;  1VQ5 Q;  4M77 C;  2DX1 A;  2NUP B;  2HQH A;  1FXX A;  3PMI A;  2QQS A;  3SWN A;  4EIK A;  5DLQ E;  1OEB A;  2DRM A;  4JRQ A;  3J81 E;  3CC4 T;  3OMG A;  1J3T A;  1TUG B;  1AWX A;  3AT1 B;  2E1H A;  1A0N B;  1AZG B;  1VIF A;  3C0C A;  4EDU A;  2JM9 A;  1VYT A;  1T0J A;  4PJM A;  4GLM A;  3MP1 A;  1NG2 A;  4C92 D;  4PJO C;  2K5I A;  2KRM A;  1GL5 A;  3GNF B;  1VQP T;  8ATC B;  2KXC A;  2F1L A;  2FO0 A;  2CRE A;  3CXC S;  2X35 A;  3OS2 A;  1C1A A;  4L59 A;  2AZV A;  4EMG A;  3A8M B;  1ACM B;  1JQQ A;  1HD3 A;  4FU6 A;  2DXB A;  5GMK h;  1OQK A;  2OTL A;  2DJZ A;  4JZ4 A;  4BE1 A;  1R77 A;  3QZ5 B;  2CZ6 B;  1QQJ A;  4MDW A;  4XTY A;  4C5H A;  2LT4 A;  5GAM e;  1YJN T;  1M5Q 1;  2RJF A;  3QDR B;  2OAU A;  5LJ3 h;  1W2B P;  2DAQ A;  5LJ5 d;  2K2M A;  1OZ3 A;  3QII A;  3LH0 A;  4EMK A;  2K5F A;  4C8Q E;  2CZ7 B;  4PJN A;  2CH4 A;  2DL5 A;  3CCJ A;  2DK3 A;  3CPW P;  2B8A A;  4BAC A;  4XTX A;  2DXT A;  2FRW A;  1DJ7 B;  5IXF A;  3MCA B;  1ZUY A;  3VS7 A;  5C0M A;  3L2Z A;  1BKB A;  4QVC A;  4C92 C;  3JCM h;  3CCM A;  2EYW A;  5KCH A;  2WSC E;  2KR3 A;  3TEE A;  1SRM A;  2DIG A;  1VYU A;  3CC4 A;  2JTM A;  3BW1 A;  4WCI A;  1HYO A;  4NS5 A;  3T9N A;  3V8J A;  1M3C A;  2RH2 A;  2KK4 A;  1VQL Q;  1PSE A;  1YJW Q;  1K0X A;  5GAO r;  2XDD A;  4EMK B;  1FMV A;  4V2S A;  4PNO A;  5AYF A;  3GNG A;  4N0A C;  3L1A A;  2BE7 D;  2D8J A;  3CCQ Q;  2XI9 A;  4J6Y A;  1BBZ A;  3OB9 A;  3NPF A;  3PT9 A;  3CXC P;  3O8V A;  1Y96 A;  4HVU A;  3OS1 A;  3CD6 Q;  2CKK A;  4LE9 A;  2LCS A;  2EBP A;  4NL2 A;  4RTT A;  2XKO C;  1NJI U;  1OPK A;  4PJO A;  4AG2 C;  3OYL A;  3QDF A;  3JCM Q;  4PJO F;  4HA8 A;  1YJN A;  3UDC A;  3GOX A;  2XID A;  2A36 A;  2PTK A;  4FCY A;  3EAE A;  3URG A;  3QYG B;  4J9H A;  3M0P A;  2ZPH B;  1BCO A;  2P0K A;  2FG0 A;  1JO8 A;  4DA4 A;  2EPD A;  1MMA A;  2F69 A;  1RAC B;  3FC3 A;  2F5K A;  3QUI A;  2X4Y A;  2XDP A;  4M77 B;  3OA6 A;  2HQX A;  2DE0 X;  2FL7 A;  3KFV A;  5CQX A;  5D6Y A;  3TVT A;  4KGV B;  2GCX A;  3QYH B;  3KUF A;  2HMA A;  2DNU A;  3JB9 D;  1H8K A;  1JXO A;  2D1X A;  2K57 A;  3OSS C;  3QKJ A;  2OJ2 A;  3M0U A;  3EFO A;  1RI0 A;  4Z88 A;  1Y96 B;  3CBP A;  3ULR B;  1IB8 A;  2P84 A;  1S1N A;  2FHD A;  2PU9 B;  1PG5 B;  1K9M R;  3HFO A;  5FU7 C;  3SB2 A;  1GCQ A;  3SEM A;  1LVK A;  2XIC A;  4PJO B;  3CCS Q;  1TOV A;  2K2V A;  1ZUK A;  3EGD B;  1IZ6 A;  2KE9 A;  1NM7 A;  1V1C A;  2ESW A;  1I1J A;  2HEQ A;  3JCM P;  2KNB B;  4JZ3 A;  2DD4 A;  1ABO A;  4HT8 A;  2RMO A;  4ZN3 A;  2DZ9 A;  3H6Z A;  4A4H A;  1VQ9 T;  3M56 A;  1QCN A;  4MZP A;  2COW A;  3MKD A;  3HHT B;  2VUB A;  4OB0 B;  1N6A A;  4JPB W;  1UGR B;  1UG1 A;  4X1V A;  3ZBD A;  3CCL Q;  1K8A C;  3EH1 A;  4JRP A;  3RER A;  1BI3 A;  2CSI A;  4HVV A;  3OW2 P;  1U8R A;  2DYB A;  3GF5 A;  3S6W A;  2H8H A;  2EQU A;  1IRE B;  4KGX B;  1UGP B;  3V7S A;  1R0C B;  3CCV Q;  1PD1 A;  2R57 A;  2VXE A;  4F7U B;  5L23 A;  1KJW A;  4QQG A;  2D0Q B;  4IUV A;  3PVQ A;  5LJ3 d;  4IUP A;  2RB6 A;  4C92 B;  2OTL Q;  2CYZ B;  3X24 B;  2A3L A;  2X4J A;  3G6E T;  8AT1 B;  1QKW A;  4NL3 A;  1PRL C;  5IH2 A;  3A8G B;  3I55 T;  3QO3 A;  2DLP A;  1UE9 A;  2O9S A;  1P92 A;  3L42 A;  4J83 A;  1LNX A; 
#chains in the Genus database with same CATH homology
 2Y4Y A;  4UC4 A;  4OF1 A;  4BDZ A;  2L5Q A;  4A4E A;  5KH6 A;  2RI3 A;  4OGC A;  2LCC A;  3CCL A;  2EYQ A;  3G4S T;  2O01 E;  3JCM X;  4M78 F;  2KSS A;  2XU8 A;  3MEU A;  4C8Q A;  4M7D G;  4RG2 A;  4QQ6 A;  3HSB A;  1HXD A;  2KVQ G;  2L3R A;  3A8O B;  3JB9 J;  1I8F A;  2GFA A;  2FB7 A;  2YHT A;  3H8Z A;  4HCZ A;  2VXF A;  4Y91 A;  4C8Q F;  1VQ8 A;  2LTO A;  2V8J A;  4ZTF A;  1VQN A;  3MEV A;  1XTD A;  3CCU A;  3FEO A;  4BY6 C;  3FJP A;  4XU2 A;  3QBY A;  2PVG B;  1VQL A;  3CCR A;  1K9M C;  2K5L A;  4L5G A;  3V8K A;  2CZ0 B;  2DZC A;  2MWP A;  3JCM g;  3E19 A;  3A8H B;  1N9R A;  4O5V A;  2RHZ A;  2RJC A;  3LYI A;  4BI3 A;  3CCV A;  1S72 T;  2K4Y A;  4QVD A;  5CR2 A;  1QVP A;  5GAN 3;  2F5T X;  1KC8 U;  3N5B B;  3CCQ A;  1VQ7 T;  4NOY A;  5A2Q E;  1N8R C;  4YTL A;  3L2W A;  2PUO B;  1BYM A;  4BUG A;  2XDB A;  3EFR A;  1YHQ T;  3L2U A;  1PSF A;  3ASK A;  2XD0 A;  4M75 C;  2HAX A;  4M77 G;  1EIF A;  2IVW A;  2LNV A;  4KUI A;  5LJ5 j;  3S3N A;  4IUR A;  3WVE B;  1NJI C;  5GAO n;  2EQK A;  3RKY A;  2EJF A;  2EIF A;  5CVI A;  5GAM f;  1XQH A;  2Y4X A;  1YIJ T;  5GAN j;  5DY9 A;  3HP9 A;  4ELZ C;  2M9U A;  3CCE T;  2QEX T;  3UPU A;  3BDL A;  5LJ3 f;  2PVD B;  1O75 A;  3KXT A;  2BKD N;  4PJO E;  2MF2 A;  3HRT A;  4F7U A;  3OYF A;  1K8A U;  4TVR A;  3SWN B;  5A0D A;  4DQ2 A;  5A0G A;  3M4Y A;  5GAO p;  1HK9 A;  2CGH A;  3V8L A;  4M77 D;  3PNW C;  2XK0 A;  3MEW A;  3JSC A;  3OBY A;  4F7U F;  3CME T;  4C92 A;  2RI2 A;  4C0Z A;  4M78 E;  5GAN 4;  1KHC A;  2GQV A;  4BY6 B;  3A8L B;  1XOV A;  3RKX A;  1B34 A;  4C8Q B;  2Y90 A;  4RCB A;  1W4S A;  3GP8 A;  2RD1 A;  2M1H A;  4M75 E;  4C92 F;  3CBM A;  4E7L A;  3CMA T;  3CC2 A;  2K3Y A;  1R8O B;  4ATO A;  2ZPE B;  3MEA A;  4M7A G;  2EQM A;  2JZ2 A;  2E64 A;  4J7F A;  4XQ3 A;  2RK2 A;  2HQE A;  5LL6 S;  2RHI A;  3PMT A;  4A53 A;  4EMK C;  5A0L A;  1KQS A;  2PUK B;  1QVG A;  1Q81 C;  2VC8 A;  2YLC A;  2VV5 A;  1O9S A;  3UWN A;  3AHU A;  2ZPG B;  1VQ5 T;  1N27 A;  4Q5W A;  2QQB A;  5FU7 B;  2DKG A;  1WNL A;  3FDR A;  4A4G A;  1M90 U;  1M1K C;  1G3Y A;  1UGS B;  4C5E A;  1Q86 C;  4C8Q G;  3NTH A;  2E65 A;  2M0O A;  3JCM V;  4C5G A;  5GAO l;  3G6E A;  4BDY A;  3X25 B;  2E5Q A;  4M7A D;  1W2B S;  1WJR A;  3CBO A;  3OYI A;  4JRK A;  3NFC A;  4N0A A;  4X34 A;  4C0F A;  4OB1 B;  4C0D B;  2DD5 A;  4KUD K;  4FT2 A;  4N4H A;  3FB9 A;  3OYG A;  3I55 A;  5CKE A;  4J8O A;  5CKF A;  3JCM W;  1FX7 A;  2FVU A;  2I2L A;  4M78 D;  3JCM e;  3C94 A;  4N4G A;  5I2M A;  2BIV A;  3X20 B;  5GAN 7;  2WSF E;  1X01 A;  4ME7 A;  4E7H A;  1Q7Y C;  3RUX A;  5I2S A;  3OQ5 A;  1UB4 A;  3NTK A;  2EKO A;  5CQY A;  4ELY C;  1K73 C;  3FLG A;  3VU3 C;  2VGM A;  4C8Q D;  3OSV A;  2DTO A;  2LT1 A;  3CCJ T;  4EPC A;  3TU4 K;  3X26 B;  3CPW S;  1VQO A;  1G3S A;  2R58 A;  2VGN A;  2H3J A;  4QVZ A;  3HKS A;  5GAM g;  1M8V A;  2JNG A;  2ZPI B;  2LQK A;  1BI2 A;  1RL2 A;  2LC4 A;  2RA2 A;  1Q82 C;  5GAN 5;  3LX7 A;  3P8H A;  5LJ3 j;  1BI1 A;  2DIQ A;  4XTW A;  2E70 A;  3JCM c;  5FRM A;  3E9G A;  2MMP A;  3F70 A;  4XK8 E;  5KE3 A;  1B34 B;  3E1S A;  3VYH B;  3M9Q A;  2X4X A;  4LDU A;  1QW1 A;  1MHN A;  1VIE A;  2KAF A;  1NPR A;  2RHU A;  5GAN h;  5GAN e;  5IAY A;  4JS4 A;  1KQ1 A;  4M7D E;  2P4T A;  1K9M U;  1VQ6 A;  4L6V 5;  1U1T A;  5FU6 C;  3MP8 A;  4M77 C;  5FLX E;  1S72 A;  3PMI A;  5CAI A;  1FXX A;  2QQS A;  3JAM E;  3M58 A;  3SWN A;  4F7U G;  1UGQ B;  3Q1J A;  1Q81 U;  5DLQ E;  4BI4 A;  4JJN K;  4MDX A;  4JDS A;  1JJ2 S;  3LWH A;  3RKW A;  3VV0 A;  4JRQ A;  4IUU A;  3J81 E;  4C92 G;  5M9O A;  3ME9 A;  2DXU A;  2L8D A;  2DTI A;  3CC4 T;  3X28 B;  3OMG A;  3WVD B;  3M4G A;  1QVF S;  3DKM A;  3M59 A;  5GMK m;  2OTJ T;  3OW2 S;  2E1H A;  3OYK A;  3HRU A;  1VIF A;  5CO7 A;  4DOW A;  4E7J A;  4IUQ A;  4EDU A;  3TRE A;  1VQM T;  1VQK T;  2BUD A;  4M77 E;  1NPP A;  1V29 B;  3WXM B;  4R56 A;  4N4I A;  3MP1 A;  4FIB A;  4C92 D;  5CCA A;  2K5I A;  4PJO C;  4XAX B;  4M7A C;  4C5I A;  3GNF B;  1VQP T;  3CME A;  4M75 A;  4OB3 B;  1M1F A;  3CXC S;  2X35 A;  1U1S A;  2LX9 A;  3MET A;  2V8K A;  4HCB A;  4M78 C;  3OS2 A;  3CC7 T;  2DXC A;  4L59 A;  4EMG A;  3A8M B;  3MP6 A;  3CMA A;  1I5L A;  3NTI A;  1VQ9 A;  4B9X A;  3CEY A;  4JRI A;  2VYT A;  4FU6 A;  1H64 1;  4ZGE B;  2DXB A;  4IUT A;  5GMK h;  2KDS A;  2K3X A;  1YCY A;  2V8I A;  1SSF A;  4VUB A;  2DJZ A;  5GMK e;  2OTL A;  5D6W A;  4M7A F;  2RJE A;  4BE1 A;  3QZ5 B;  2DVE A;  4Z02 A;  3OS0 A;  3OYE A;  1YI2 T;  3HL8 A;  2CZ6 B;  2YLB A;  2ZPB B;  4FSX A;  2QA4 A;  2NLU A;  1VQ5 A;  4MDW A;  2O4X B;  4XTY A;  5IN1 A;  4QW2 A;  2LT4 A;  4J6X A;  4C5H A;  3R6O A;  5CIU A;  2ZZD A;  3LGL A;  5GAM e;  1YJN T;  4M7A E;  4KBM B;  4OMF B;  4HKE A;  1M5Q 1;  5GMK i;  2RJF A;  3QDR B;  1OYX A;  2OAU A;  5LJ3 h;  4Y28 E;  1Q86 U;  1M1K U;  5LJ3 e;  1KD1 C;  1KHI A;  4CRI A;  2DAQ A;  5LJ5 d;  1OZ3 A;  3QXE B;  3QII A;  3LH0 A;  5LJ5 g;  3G7Z A;  2RI5 A;  4DOV A;  2WAC A;  4PLI A;  1YIT A;  1WQ7 A;  1UEB A;  1LOJ A;  4EMK A;  2JVV A;  3I56 T;  3HPW A;  3UT1 A;  3VKI A;  2K5F A;  3QPH A;  3OYA A;  4C8Q E;  1VQ8 T;  2CZ7 B;  2MAM A;  3GIB A;  3CPW A;  4GLK A;  4XTV A;  3GLX A;  1Q7Y U;  1BI0 A;  4MML A;  4PLL A;  3OYJ A;  3CCJ A;  1K73 U;  1VQL T;  2DK3 A;  2RHX A;  1Y7X A;  2B8A A;  4BAC A;  5HY6 A;  1QP3 A;  1YJW T;  4XTX A;  4LD9 K;  3C4S A;  2DXT A;  4LDV A;  4BE0 A;  1KC8 C;  1DJ7 B;  3CCV T;  3MCA B;  3FRN A;  4J6W A;  4M75 B;  5GAN 6;  3CCQ T;  3LW5 E;  3VYG A;  1Q82 U;  3OYB A;  5FRO A;  1G3T A;  3L2Z A;  5C0M A;  1BKB A;  1M1G A;  3M5A A;  4QVC A;  2DTH A;  3JB9 F;  2A7Y A;  3INZ A;  3C12 A;  4C92 C;  1XNI A;  4BD3 A;  3OYH A;  3M53 A;  1VQ4 T;  3VJP A;  3CD6 T;  3JCM h;  4HT9 A;  1MGQ A;  2QI2 A;  3CCM A;  3DLL A;  4M7D C;  2EFI A;  5HK3 A;  5KCH A;  4E7I A;  2WSC E;  5GMK j;  2CS7 A;  3OYN A;  5EG2 A;  3TEE A;  5GMK l;  2XHC A;  2DO3 A;  3FIF A;  5CKB A;  3QHS A;  1FWZ A;  2DIG A;  4OVA A;  3SFM A;  3G4S A;  2QDY B;  1KQ2 A;  3CC4 A;  2JTM A;  2EWN A;  3BW1 A;  5GAM j;  4CI0 C;  2XG8 D;  2EJ9 A;  4NS5 A;  2QQA A;  3T9N A;  3V8J A;  4BI8 B;  4F7U E;  2LRQ A;  2RH2 A;  3KBG A;  2P0Q A;  2KK4 A;  1OI1 A;  2DEQ A;  3PTA A;  1PSE A;  1ZQ1 A;  4C92 E;  4OGE A;  2JUF A;  1VQM A;  1VQK A;  1N9S A;  5GAO r;  2XDD A;  4EMK B;  4V2S A;  4PNO A;  5AYF A;  3GNG A;  4N0A C;  3L1A A;  3S3M A;  4ZTJ A;  2XI9 A;  4J6Y A;  2O4X A;  3HRS A;  5CKH A;  2JOY A;  3OY9 A;  3OB9 A;  3PT9 A;  5HKC A;  4C0G A;  5LJ5 f;  1VQ7 A;  3O8V A;  3RMQ A;  3VUB A;  5CK9 A;  3J7A F;  1Y96 A;  3RMS A;  4OB2 B;  1X75 C;  3PIO A;  1N8R U;  1YHQ A;  3OS1 A;  1M90 C;  1VQ6 T;  4D6W A;  3JCM J;  1QVG S;  2CKK A;  2M16 A;  3M54 A;  5I21 A;  1I81 A;  3DB4 A;  1G5V A;  1JBM A;  4NL2 A;  4JLG A;  3L2Q A;  4M7D D;  2XKO C;  2AHJ B;  1YIJ A;  4J7I A;  1NJI U;  4PJO A;  1X6O A;  3HFN A;  4HCC A;  2HD0 A;  3MHX A;  2KMT A;  2QQ9 A;  3JCM b;  2GFU A;  4XU0 A;  2QTX A;  1WGS A;  4J5Y A;  4XTU A;  1ZHI A;  1OZ2 A;  3OYL A;  2QEX A;  3CCE A;  5FRN A;  3JCM Q;  4P5N A;  4PJO F;  5GAO m;  4HA8 A;  4E47 A;  2ZGW A;  1YJ9 T;  1YJN A;  3UDC A;  4FM4 B;  4M78 A;  3GOX A;  3M55 A;  2XID A;  2JTF A;  3QJY A;  2E41 A;  4MZT A;  2FYK A;  2CZ1 B;  3OMC A;  1G3W A;  3EAE A;  4OP0 A;  4R55 A;  3URG A;  4B9W A;  2G3R A;  4E7K A;  5CKD A;  2E12 A;  3QYG B;  3CCS T;  3JRZ A;  3JB9 G;  1KD1 U;  3SWN C;  1VQO T;  2ZPH B;  3DB3 A;  2P0K A;  3L2V A;  2LVM A;  4DA4 A;  3I56 A;  4M75 F;  2F69 A;  2RJD A;  3FC3 A;  1VUB A;  2LDM A;  4FT4 A;  2F5K A;  4JUV A;  3QUI A;  4A54 A;  3VUZ A;  2X4Y A;  2XDP A;  5KCO A;  5GAO q;  5FU6 B;  4M77 B;  3RES A;  3RIR A;  5DM7 R;  2KY9 A;  3QG1 A;  3OA6 A;  3C95 A;  4BB7 A;  2HQX A;  4C8Q C;  4KT0 E;  2FL7 A;  3JCM d;  3OYM A;  4XTZ A;  5CQX A;  5D6Y A;  3SD4 A;  1YJW A;  4XU3 A;  2GCX A;  3OBW A;  3KUF A;  3QYH B;  4ZGJ B;  1WJQ A;  3JB9 D;  2EAY A;  2L89 A;  3QJ6 A;  2K57 A;  3OSS C;  3QKJ A;  4X9D A;  5GAM h;  1W2B A;  3JB9 H;  2X4W A;  2D6F A;  2RK1 A;  3G71 T;  1RI0 A;  1Y96 B;  3CBP A;  2IG0 A;  1I4K 1;  3M57 A;  4RKU E;  5L8R E;  2FHD A;  2PU9 B;  4X9C A;  4KUL A;  3HFO A;  3CCL T;  5FU7 C;  3SB2 A;  1NZ9 A;  1VQ4 A;  5J3B A;  3ER0 A;  3CD6 A;  4MMK A;  3S3O A;  2QQR A;  3V7C A;  5GAN d;  2XIC A;  1BIA A;  1D3B A;  4ZN1 A;  5GAN 8;  1AHJ B;  1WJS A;  2DPP B;  5GAN g;  1VQN T;  4C0D C;  4M7A B;  4PJO B;  1KG1 A;  3CCU T;  2RM4 A;  2K2V A;  1M4Z A;  2ZPF B;  3CCR T;  1IZ6 A;  3LWI A;  3E9F A;  4M78 B;  2MWO A;  4WF2 A;  2E6N A;  1JB0 E;  5GAN 2;  3PFS A;  3OYC A;  3JCM P;  1M9S A;  2YRV A;  2DD4 A;  3ZFJ A;  3PGG A;  2R5A A;  4ZN3 A;  4HT8 A;  4M7D A;  3P8D A;  4XU1 A;  2DZ9 A;  3H6Z A;  3BDU A;  4A4H A;  3M56 A;  1VQ9 T;  4PL6 A;  4MZP A;  5J26 A;  4PJO G;  4M7D F;  4RCC A;  5KE2 A;  2QXF A;  3BY7 A;  3HHT B;  2VUB A;  4OB0 B;  2OTL T;  1N6A A;  1JJ2 A;  2ZCF B;  3TCJ A;  3LGF A;  3JB9 I;  1UGR B;  4M78 G;  3ZBD A;  2QA4 T;  1K8A C;  5J39 A;  3EFS A;  5DLO A;  1LJO A;  5HK0 A;  1QVF A;  2EQJ A;  1NE8 A;  3OS5 A;  4M75 G;  4JRP A;  5IT9 E;  2LQ8 A;  3OW2 A;  4LD6 A;  2RHY A;  3MO8 A;  2KQW A;  4RMO A;  3J80 E;  4IKF A;  3RER A;  4PJO D;  3JCM f;  1BI3 A;  2OTJ A;  4GY5 A;  3PIP A;  4M77 A;  1GXI E;  1U8R A;  4PKC C;  3GF5 A;  3S6W A;  2C06 A;  4A4F A;  2P0P A;  2EQU A;  2HNI A;  3QZ9 B;  1YIT T;  1IRE B;  1H3Z A;  1YJ9 A;  3V7R A;  4BE2 A;  4QQD A;  1D3B B;  1UGP B;  4M77 F;  3SDZ A;  3V7S A;  1WQW A;  3BFM A;  1WPY A;  4M75 D;  3CC2 T;  4JS5 A;  3ZEH A;  3CXC A;  2D9T A;  1VQP A;  2GF7 A;  2EJG A;  2R57 A;  3CCS A;  2PQW A;  2VXE A;  3P8B B;  3QSU A;  2E10 A;  4LDY A;  4F7U B;  5GAM d;  1QP2 A;  4QQG A;  2D0Q B;  5D6X A;  2JN0 A;  4O6J A;  2E6Z A;  4IUV A;  1JRI A;  2MI6 A;  3CC7 A;  1ZBX A;  5LJ3 d;  5GAN f;  4IUP A;  5LJ5 h;  2RB6 A;  4C92 B;  5LJ5 e;  1KQS S;  5LJ3 g;  2CYZ B;  3X24 B;  4FL6 A;  2A3L A;  4M7D B;  1TH7 A;  2X4J A;  4RG8 A;  3G6E T;  3L2R A;  4A4K A;  4LDX A;  4NL3 A;  2R5M A;  4ZGD B;  1BIB A;  1Y07 A;  1YBY A;  1YI2 A;  4M7A A;  5C6S A;  3A8G B;  3OYD A;  2LCL A;  3GPL A;  4II1 A;  3I55 T;  3QO3 A;  2HBP A;  4LDW A;  1Y71 A;  3CCM T;  3OYY A;  4MZM A;  2WSE E;  2PVO B;  2RO0 A;  1P92 A;  3L42 A;  3CPF A;  3DLM A;  3LLR A;  4J83 A;  1LNX A;  4JLI A;  4EMH A;  3G71 A;  3A5Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...