2M0OA

The solution structure of human phf1 in complex with h3k36me3
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
79
structure length
79
Chain Sequence
SRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 1
publication title An H3K36 Methylation-Engaging Tudor Motif of Polycomb-like Proteins Mediates PRC2 Complex Targeting.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 7
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2m0oA00
3PMTA 4UC4A 4PLLA 3LX7A 3FC3A 3L2UA 3MO8A 2E5QA 3S3OA 3QBYA 2RHYA 2P0KA 3MP8A 4II1A 3C4SA 4IUTA 4X34A 4IURA 2RHXA 2DAQA 2RHIA 5D6WA 5J26A 1G5VA 2K3YA 5FRNA 3L42A 3M9QA 3S6WA 4QQ6A 3OQ5A 2XDPA 3MEWA 2K3XA 4FL6A 4N4GA 3MP1A 3OMCA 3OA6A 2RI5A 4CRIA 3ZEHA 3EAEA 4BACA 2X4WA 4BD3A 2EQKA 2EQMA 3UT1A 3OS0A 2DIQA 2R5MA 3NTHA 3OS1A 3QIIA 1N27A 3F70A 4IUQA 3OYNA 1WJQA 3OYAA 1RI0A 3OYHA 4PL6A 2O4XA 2RJDA 2FHDA 3PNWC 4IUPA 4Z02A 5FROA 5KCOA 2M16A 2O4XB 4A4HA 4GY5A 3MEUA 2QQSA 2BUDA 3OYJA 4Q5WA 2CKKA 2PQWA 3H6ZA 2M0OA 2IG0A 5KCHA 2EQUA 2JZ2A 4RG2A 2JTFA 3L2RA 2GF7A 2HQXA 3DLMA 3KUFA 3FLGA 4FU6A 4L59A 3OYFA 1KHCA 2EFIA 2RHZA 3LH0A 3NTKA 2RJFA 4PLIA 2RI3A 1XNIA 2X4XA 5KE3A 2EQJA 3OYKA 1H3ZA 3META 3OYIA 3PFSA 4QQDA 3MEVA 2DIGA 1OZ3A 4E7HA 2L3RA 2LCCA 4IKFA 4LD6A 3S3MA 5FRMA 5C0MA 3Q1JA 4BDYA 2RI2A 3H8ZA 2RJEA 2BKDN 3O8VA 2HQEA 5KE2A 2WACA 2X4YA 5D6YA 1OYXA 2D9TA 4N4HA 3OYCA 4B9WA 1WJRA 3DB3A 4C5HA 5M9OA 3OYLA 4ZTJA 1MHNA 2YRVA 3L2VA 4HCZA 4IUVA 2BIVA 5IAYA 3OY9A 3CEYA 4A4FA 3FDRA 4QVZA 2L8DA 3LGFA 4C5EA 2XK0A 4B9XA 3ASKA 3OYBA 1WGSA 5CIUA 3GOXA 4OVAA 2E6NA 3LLRA 3SD4A 4BE2A 5C6SA 1OI1A 2NLUA 4E7KA 2LVMA 2X35A 1SSFA 3L2QA 2RHUA 4EDUA 4NS5A 3BDLA 4QQGA 2MWOA 2F5KA 2QQRA 2RJCA 3P8HA 2LTOA 4BDZA 4E7JA 2GFUA 2L89A 3LYIA 3OYDA 2B8AA 2GFAA 4BE1A 3LGLA 5KH6A 2R57A 5IN1A 3PMIA 4C5GA 2R58A 3L2WA 3MP6A 2LRQA 3DB4A 3QKJA 2MWPA 4ZTFA 2M1HA 3NTIA 3S3NA 3MEAA 3E9FA 3ME9A 2RO0A 1WJSA 3QJ6A 3UWNA 2LDMA 4C5IA 4E7IA 1OZ2A 3OS2A 5D6XA 3OYEA 4E7LA 4N4IA 3OYGA 5J39A 4BE0A 3OB9A 4A4GA 3E9GA 3OMGA 2EKOA 2G3RA 3P8DA 4IUUA 2VYTA 2R5AA 4QW2A 3OYMA 4A4EA 3FEOA
chains in the Genus database with same CATH superfamily
3JCMd 2QGFB 5KYUA 3QZ5B 3MO8A 2FL7A 5KYUB 3HPWA 1WPYA 1NG2A 5A0DA 2WSEE 1OU8A 5GMKh 2RH2A 5FU7C 3EAEA 1M8VA 5CAIA 2EQKA 2JT4A 2MIOA 3O5ZA 2B86A 1M1KC 2QQAA 4IUPA 2VASA 2EJ9A 4YTLA 3CCMQ 1T0JA 4QKUA 2LT1A 4WTOB 2KNBB 1EIFA 2E3HA 3NTKA 1YCSB 2DYBA 2QEXA 1PKSA 3OYKA 2LCLA 3OYIA 5DY9A 1QWFA 4RKUE 3JAME 5GAMe 1VQLA 2RI2A 4J8OA 1VQKQ 1I5OB 4C0DB 5LJ5g 2FZKB 2K7AA 1UGRB 4M7DA 4RG8A 4M7DB 2HQHA 3OYLA 1KIKA 1VQ6T 3VS7A 1Q81R 2SRCA 2G6FX 5FW9A 4ELYC 4J9FA 5GANg 3ASKA 4M77E 1YJ9T 2WSCE 4RTVA 3GOXA 1Y57A 1G3YA 4WF2A 3CCEA 2A36A 4M7DG 3CBOA 1WQ7A 2QQBA 2BE7D 5GANd 5IHNA 2IIMA 5HY6A 2FRYA 1KQSS 2K2VA 2ZPHB 1SSHA 4F7UA 2CH4W 3UDCA 4F7UB 1N5ZA 1VQMA 2K79A 4A54A 2A3LA 1NJIC 1CSKA 5LJ3f 4OMNA 3JCMQ 3GNFB 5HKCA 3CCSQ 3C0CA 2J6OA 4KULA 5CQYA 1QMCA 4ZTFA 2JVVA 2GBQA 5A2QE 3G6ET 1VQ9Q 1BIAA 2ESWA 4RCBA 4DA4A 3S3OA 5FWCA 2MPXC 2RHYA 5GMKi 3HFOA 4C92A 3OBWA 3PVLA 2DKGA 3M57A 4EPCA 2K9GA 3CC2A 4PJOA 4PJOB 1YHQA 2BE9B 4LNPA 3OYAA 2CP0A 1YIJA 2L3SA 4K11A 2JS2A 5GANj 1VIEA 2M16A 4A4HA 1MV0B 4RCCA 1S72A 4XTYA 4PJOG 1NE8A 4P5NA 4OMMA 2YRCA 4M75A 4M75B 3PFSA 1EZZB 3TSWA 2QA4A 4E7HA 4IKFA 1UEBA 1ZHIA 2ZPFB 1QWEA 1IGUA 1VQ7T 1YITQ 3E1SA 2JM8A 2K2MA 4R0KA 1G3TA 2Z0WA 3DB3A 1TS9A 1AWWA 3JCMf 3GBQA 1ZA1B 4BI4A 1P92A 2Y4XA 4M77D 4C8QE 3EH2A 3VJPA 2D0NA 1WI7A 1OPLA 5LJ3e 1AOJA 4PJMA 3CMEA 1JJ2A 1A0NB 2VGNA 3UF4A 3M0TA 3CCQA 3CPWA 2R57A 4HCCA 2PVOB 1F1BB 2HNIA 1BI1A 1G8XA 3HRSA 1Q86C 2HDAA 2XDDA 4EIKA 3CXCA 2E65A 4E7ZA 2I2LA 1PC0A 4LXCA 1I5LA 1BB9A 3A8OB 1W2BA 1VYUA 2MMPA 1IXDA 4MDXA 1X2QA 5GAOr 2XICA 1I4K1 3I55Q 1I1JA 3QJYA 4F16A 2E5QA 1Y96A 1Y96B 3L42A 3MKDA 4J83A 1Z9ZA 3E19A 1SKUB 3MHXA 3AT1B 4PKCC 5LJ5f 2V1QA 3PT9A 3CCVQ 3RDVA 1UE9A 1M2OA 3PGGA 4LUDA 2X51A 3CCJA 4Q5WA 2MYSA 4RG2A 3TQ7P 5GANf 1VQOQ 2KT1A 2EYQA 4XU3A 1BI2A 3JCMe 2DTHA 4C92C 3REBB 4LDVA 2DBKA 3N5BB 2JTMA 2M0YA 4ZGDB 4RTTA 2QTXA 1T0HA 2DIGA 2DTOA 2ZGWA 1MMAA 2DXUA 2LC4A 3NPFA 3Q1JA 3RIRA 4Y91A 1UHCA 2X4YA 3TCJA 2D1XA 1M3BA 1I0CA 2EYWA 1Y71A 1JU5C 3VRYA 1U8RA 2EVRA 3I56Q 3KXTA 1UJ0A 1IRXA 3SD4A 1T3SA 3CPWS 2X35A 4M75C 3GNGA 1KFZA 4BI3A 1PD0A 1NBEB 3CCLQ 3V7CA 4IIMA 3RESA 1D0YA 3LGLA 5GAMh 4BUGA 1RI9A 3ZBDA 3MP6A 2ED0A 4HA8A 3VS0A 2YT6A 4L6V5 3QHSA 2KXDA 2LCSA 3CCMT 5CVIA 1FMKA 1WYXA 3UWNA 1IB8A 3VU3C 3JV3A 2CUBA 4JLIA 4M7DE 2RK2A 1MNDA 5LJ5e 2DEUA 3CCRQ 2EYYA 2NUTB 3FB9A 4RTXA 1RABB 4HT8A 4II1A 2DNUA 2LNHB 1VQKT 2H8HA 5CKDA 3RUXA 1Q7YR 1Q82R 1YJWQ 2RQWA 3M55A 1G3SA 2F2WA 3HP9A 4M7AA 3MJXA 3TREA 2FEIA 2O4XA 5AT1B 2O4XB 4GY5A 1YJNA 3CD6A 2BUDA 2JOYA 1BYMA 3H6ZA 1YP5A 5KCHA 3L2ZA 4KBMB 2JTFA 4RTUA 2P84A 3GF5A 4J9HA 5EC7A 2LP5A 2HSPA 3HTRA 4FM4B 1H3ZA 3R6NA 2XKOC 2QASA 2JS0A 3FIFA 4XTWA 1Y0MA 1Q95G 2WACA 2DRMA 4HXJA 1HJDA 2DBMA 5L8RE 2KE9A 1TH7A 1SF9A 1MHNA 1M9SA 2QEXQ 4PJOE 4JDSA 1VQ9T 2LQ8A 4JS4A 4M77G 3VUBA 4GBQA 2AKKA 2E6NA 2ECZA 2XMFA 1VQNA 2FB7A 2NLUA 4HT9A 2XU8A 2EKHA 2OTJA 2HL5C 4EDUA 2EAYA 4HCKA 1NPPA 2CGHA 2DL5A 5CKEA 1U1SA 2RNAA 1GCQA 2B8AA 1W1FA 1H92A 2KSSA 1QQJA 4FSXA 2LRQA 4AMCA 1PHTA 1UTIA 1IREB 3KFVA 4HVWA 2KQWA 1VOMA 3ME9A 1M90R 1WJSA 2YUOA 5D7UA 4ZGJB 3CCEQ 3JRZA 2HZYA 4XTVA 4M7DD 4A4GA 1OEBA 2L3PA 2VYTA 3WVDB 3OYMA 4A4EA 4FYYB 5LJ3h 4D6WA 2EIFA 5KYXA 1KD1C 5KYXB 2RHXA 2K3YA 4E2FB 1YITT 1M4ZA 1B07A 1WXUA 1OV3A 5FU7B 3JB9I 1OU9A 1VQ5A 4DBFA 1ZSGA 4BD3A 2YDLA 2DIQA 1JJ2P 5FLXE 2E6ZA 3F70A 4WCIA 5L23A 3G7ZA 5GMKl 3CCUA 2O31A 1UGSB 4E6RA 1SEMA 1Q81U 4A53A 1K73U 4XAXB 2HQXA 3CXCP 3LH0A 2RHZA 1W2BP 2VGMA 5KYYA 1K9MU 1PNJA 3META 5KYYB 2OTLA 1X43A 3T9NA 3TU4K 3EHRA 2CT3A 4AG2C 1NM7A 4M7AC 1S72Q 2MI6A 2SEMA 3OSSC 1UGPB 1CKAA 1PD1A 3PIPA 1BI3A 5M9OA 2CP7A 4PJOD 3G4SQ 1VQ4A 2CYZB 2L8DA 2AHJB 3I55T 1VQ8Q 3HL8A 2CZ0B 2GGRA 4XTZA 1XOVA 3JCMJ 3JCMh 2L5QA 3M0UA 2DZCA 1NYFA 2FYKA 2OI3A 3QYHB 4BE1A 1WNLA 2EYZA 4C5GA 4C92F 3CCVT 2EYXA 4M75D 4MZTA 4R55A 2M1HA 1BBZA 1UHFA 2PZ1A 1Y7XA 5DLOA 5DM7R 1VQOT 2ZAEA 2KRSA 5J39A 2EKOA 1SG5A 1UDLA 2RN8A 1YWOA 1K9AA 5D6XA 1GCQC 5FRNA 3EGXA 4QQ6A 4XU0A 4M75F 1UUEA 2GNCA 3JB9D 3MP1A 3OMCA 4CRIA 3X26B 5GAOq 1VQPQ 3I56T 5GAN5 1X6GA 1FYNA 2QAZA 1UJYA 2KRMA 2VUBA 3M4YA 2DVEA 1M1FA 2PQWA 5GAN3 2DRKA 2EQUA 2JTEA 4FT2A 5LJ5h 3KUFA 2YXYA 3CCLT 2O2OA 2AIRB 2QI2A 3QPHA 4JJNK 3VRZA 1EFNA 3JB9F 2ZPEB 3MEVA 4CC2A 5FRMA 1VUBA 2CP5A 2DERA 3H8ZA 3CCJQ 3J80E 1WHKA 2RPNA 1VQ6A 1LPLA 2K5FA 2QTVA 4ME7A 2DLPA 3CCRT 2BZYA 4HCBA 2LX9A 5GAOn 1C1AA 1PM3A 2ROLA 2CP2A 2RQRA 4ANJA 3LW5E 3EH1A 2PVGB 1JB0E 4JJBA 1YJWT 1QP3A 3OYDA 1FX7A 4RTWA 2YUPA 3MCAB 4JRKA 4LD9K 1VA7A 1TTHB 5IH2A 1K73R 3QJ6A 1BCMA 4J9IA 1E7OA 3G6EA 3OYGA 2COYA 3EG1A 1D1CA 3OMGA 2YHTA 2D6FA 1K9MR 2DX1A 2F1LA 3FEOA 2K5LA 1GFDA 4XTXA 3VYGA 3AHUA 3U23A 1QCFA 1JEGA 4QT7A 1MMDA 4KUDK 3A5ZB 1M5Q1 3S6WA 2RMOA 1GCPA 3UPUA 4J7FA 3ZEHA 3SWNC 1G2BA 2X4WA 3OS0A 3EG9A 2QEXT 4JZ4A 3EG9B 2YUQA 1ZUYA 4N0AC 3OYHA 4F7UG 2ZPIB 2RK1A 2FG0A 1RUWA 2F69A 2K5IA 2KI7A 3GIBA 3RBBB 1MGQA 1DJ7B 3ER0A 1YFNA 1KC8U 2QK0A 4C92B 2JMAA 1RAGB 1WA7A 5KE3A 2P0PA 5CO7A 1X75C 4TVRA 1YJNQ 3CD6Q 4FSSA 4DBHA 2AT1B 3BDUA 5IXFA 3CCET 2VV5A 4M78C 1OPKA 2QQ9A 1SRMA 1JXMA 4C92G 4R56A 4CC7A 3H0FA 1V29B 1X6BA 2P0QA 4M7AD 2Y4YA 4PNOA 1IO6A 2K6DA 1Y07A 4C0ZA 1IZ6A 3GP8A 4M4ZA 3VKIA 2HMAA 2PUOB 4LE9A 4MZMA 3VS4A 2LTOA 3QWYA 3WXMB 4J9BA 3P8BB 3PMIA 1R8OB 2DZ9A 1Q7YU 1Q82U 2FPFA 4M75G 4RTYA 3NHNA 4DEXA 2D0QB 2DD5A 4RMOA 3EFOA 3D7SB 3X20B 3QG1A 3EFOB 4M7AF 2OTJQ 2F5TX 2PU9B 1WIEA 4N4IA 1UGQB 2FZCB 2M51A 2JW4A 1X01A 2RA2A 3FC3A 1OX8A 2J7IA 1E6GA 1WHMA 1QVFA 2RHIA 1RADB 1S72T 4F17A 4XK8E 2ZZDA 2CS7A 3JB9G 3G4ST 2DA9A 1VQ8T 2FRWA 3UA7A 4J9EA 1I81A 1H641 1WX6A 1OOTA 1WHGA 1BI0A 3A8MB 3M5AA 2JXBA 3WVEB 3G1JA 3VUZA 3L2RA 4AFSC 2ZPBB 4PK4A 3X24B 2VXFA 4EMKA 2F2XA 1AT1B 2RF0A 2HSEB 1RACB 4EMKB 5IHIA 1Z9QA 2LT4A 2BKDN 2KR3A 1YWPA 1Q81C 5D6YA 3CC7T 2BTTA 2AZSA 4OB2B 1R0BG 4B9WA 2DEQA 3CC4T 4ZNXA 1M90U 2KRNA 4HCZA 2E70A 5DLQE 1NEBA 3M53A 3FDRA 3OW2A 2V8IA 1PCXA 1K4US 4OVAA 3LLRA 5C6SA 4E7KA 4NL3A 2RHUA 4F14A 1M1KU 3RKYA 4ZN1A 4E7JA 2OAUA 1VQPT 2ED1A 3LYIA 1KQSP 3EG2A 1J3TA 2DFUA 8AT1B 4QVCA 2YWWA 2LQKA 2GTOA 3ZFJA 2LQWA 2RO0A 3RR6A 1VIFA 4E7IA 1JJ2S 1KC8R 2DETA 3SFMA 2KVQG 4XU1A 1AWXA 3GPLA 1VQKA 3RMSA 1TOVA 4IUTA 3IQLA 3EHQA 5J26A 1QP2A 4IURA 3CXCS 4RTZA 3CMAA 2FPEA 4RUGA 1R0CB 3MEWA 1W2BS 1ZUUA 2M02A 4OGCA 4BB7A 2EQMA 1AVZC 4IUQA 1B3QA 4J6XA 1N9SA 3H0IA 1K8AC 4OMLA 2NYSA 2XIDA 3I5SA 3QSUA 1N8RR 3EGDA 1M3AA 3EGDB 2IPOB 2DPPB 1S1NA 4L59A 2GCXA 1KHCA 3RERA 2E5KA 4PLIA 2HKQB 1NJIU 3KBGA 5GANe 2RI3A 2RM4A 4PFPA 3H9NA 2M9UA 1KJWA 4Z89A 2L3RA 4LDXA 3S3MA 4M7AB 5GAOm 3G71A 1QKWA 2LNVA 4F7UE 4AFUC 3GLXA 4AFZC 3OYCA 2L0AA 3X28B 2NUPA 2L3QA 2NUPB 1ZA2B 2VKNA 1ABOA 1I07A 2E4HA 3DKMA 2A28A 1WHJA 4M7AG 4B9XA 9ATCB 5I21A 2LJ1A 3OYBA 3PVQA 4OB1B 5IT9E 2DXTA 3TVTA 4EMKC 4NS5A 5CCAA 4PFZA 1BIBA 2QXFA 2RJCA 2DK3A 1RAEB 2GFAA 5KH6A 4OB3B 3CCST 4OMFB 1ZQ1A 4C92E 5GAMd 1OX9A 2ATCB 2CUDA 1UGVA 4OMPA 3VS3A 4DBRA 1WDXA 3NTIA 1LNXA 3L1AA 3EFSA 1C6VX 3OYEA 1VQLQ 4M78F 1NYGA 2DVJA 4VUBA 3H0HA 3QXEB 4IUUA 4QW2A 3P8DA 3QDFA 4CC4B 1VYTA 1M2VA 2E10A 1M2VB 3J81E 1YI2A 4PLLA 3LX7A 1ZBXA 2VC8A 1YJNT 3CD6T 3A8GB 1QVGA 4A4KA 4M75E 3OA6A 2E1HA 3R6OA 4MZPA 3J7AF 3UT1A 3VV0A 2O9VA 1WJQA 5GAN2 2J06A 1TU0B 5FWBA 5FROA 1K76A 4Z02A 4Z8AA 3MEUA 1BK2A 5A0LA 1VQMQ 5GAMj 1M1KR 2CZ7B 3FJ5A 2KROA 2D8JA 4OGEA 2E3IA 1Q86U 1RAFB 1T3LA 2CSQA 3RNJA 4OP0A 4OB0B 1OZ3A 2LCCA 1TUGB 1O9SA 1NLOC 4OF1A 2OTJT 1QVFP 2DL7A 1JBMA 2DTIA 1TWBA 4ZTJA 5IAYA 1W4SA 3QDRB 1K0XA 2PTKA 4A4FA 3CC2Q 2JUFA 1M30A 1YHQQ 1YIJQ 1AZEA 2LVMA 4GLMA 1VYVA 5GAN6 4F04B 3REAB 3C12A 2FPDA 3CQTA 2DXBA 3CCVA 3QUIA 2V8JA 4C92D 4KH1B 3UA6A 2KBTA 2VB6A 4CC3A 3S3NA 2DM1A 4C8QA 2DF6A 2QA4Q 5LJ3g 4AFQC 3VS5A 3E2UA 1MNEA 1NJIR 3V7RA 1RAAB 4LDUA 2R5AA 5GAN8 2HD0A 1QLYA 4Z88A 3SHWA 2C06A 3BFMA 4UC4A 4ZN3A 3JCMc 3ULRB 3LWIA 1B34A 4O6JA 5LJ3d 1Q7YC 3M0RA 1Q82C 1B34B 2EJGA 2P0KA 3SEMA 3OW2P 2ENMA 1GL5A 2WSFE 3SWNA 2XDPA 3SWNB 4BACA 3M58A 1WHHA 1AEYA 4N0AA 3CMEQ 1M27C 3CCQQ 4DQ2A 2AK5A 1H8KA 3CCLA 4MMLA 1UECA 1FXXA 3UATA 1RL2A 1EX4A 5I2MA 3FLGA 4FU6A 3OYFA 2D8HA 2RB6A 3EGXB 2RQTA 4PJJA 2A37A 3TSZA 1QCOA 3VYHB 1BKBA 4XQ3A 4D8DA 3M0SA 4M78A 1RAHB 3O8VA 2JJ9A 4M78B 2DYIA 2H3JA 1LJOA 4J7IA 4AG1C 2EGCA 4OMOA 5LJ3j 5CR2A 1X6OA 2MK5A 3CBMA 4KGVB 1KQSA 2BIVA 1JRIA 2RD1A 4MMKA 1RAIB 4J9DA 4KGZB 4M78G 4FT4A 1OI1A 2V26A 1YJWA 1JQQA 2LZ6B 2XHCA 3A98A 4XU2A 1RLPC 5GANh 2V1RA 4DOWA 3RKXA 2HL3A 3BE3A 5GJVB 2H3EB 5IN1A 1M90C 4NOYA 4ELZC 2NWMA 1YJ9A 5GAN7 1U5SA 2JM9A 2IVWA 2DO3A 2LDMA 3JCMP 4M7AE 3I5RA 1Q86R 3E9GA 3PIOA 1YN8A 1D1AA 2HBPA 3HFNA 1MMNA 3C4SA 2CREA 2DAQA 4FCYA 1R77A 1AZGB 2HAXA 4O5VA 3OQ5A 3INZA 4JZ3A 1TG0A 1YNZA 3C95A 4C8QC 3QZ9B 2V8KA 1ZUKA 1LOJA 2FHDA 1SHGA 3CMAQ 2JZ2A 3V7SA 1HXDA 4BY6C 3JCMV 5LJ5d 2EQIA 2EFIA 1IHVA 3A8HB 3JCMW 1RLQC 2LX7A 1UB4A 1C0MA 1WFWA 1VQLT 2W10A 5J3BA 4NL2A 4X1VA 1ZSZA 1QVGP 4J6YA 3M56A 5GJWB 1ZSZB 1KD1U 3EG3A 2E12A 2EJFA 3NFCA 1D3BA 4QVZA 4C5EA 1D3BB 4J9GA 3URGA 1I8FA 2A08A 1VQ7A 3G71Q 1O75A 1N9RA 2KGTA 4XTUA 2J6KA 4QQGA 3SDZA 2P4TA 2PUKB 3HHTB 3SB2A 2EW3A 1G83A 2JMCA 4FYVB 5LJ5j 2KAFA 4V2SA 4L5GA 5IHKA 3MEAA 2JN0A 1VQMT 5GMKj 2E64A 2C0TA 4IIOA 1U1TA 3OB9A 1N8RU 2Y90A 4J5YA 1D0ZA 3THKA 2KK4A 4EMHA 1K8AR 1PRMC 3MP8A 4ORZA 2VXEA 2OJ2A 1TUCA 1XJWB 1B7TA 2CZ6B 2O9SA 1CKBA 1AHJB 4LDYA 3G4SA 5IXBA 1U3OA 1WQWA 4N4GA 1VQNQ 2HBWA 2RI5A 4B6MA 1VQ8A 4KUIA 3OYNA 2R5MA 3NTHA 2COZA 4KT0E 3JSCA 3CC2T 1YI2Q 2DL4A 1YHQT 2RJDA 3PNWC 1YIJT 2QQSA 2X3XD 2K3BA 2PVDB 2IG0A 1WLPB 2EWNA 5CQXA 2KXCA 3DLMA 4J9CA 2JNGA 2HEQA 2X4XA 1XNIA 3MPUB 4Y28E 2EQJA 2FZGB 1W6XA 1MUZA 1FMVA 2LJ0A 2P4RA 4EMGA 2W0ZA 3CC7A 4JRPA 3CC4A 4C0DC 2RQVA 3CBPA 2QA4T 2KT8A 3V8JA 2D9TA 4M7DC 2A0FB 1QVPA 2MF2A 2YUNA 2F2VA 3CEYA 1VQ5Q 4JPBW 2HCKA 2X4JA 4M77F 2DJQA 2QDLA 1VQPA 1OQKA 2YLCA 1BCOA 3CCUQ 2KYMA 5I22A 3JB9H 3VS6A 2QYZA 5I11A 2MWOA 3NGPA 3P8HA 4BDZA 2C0IA 5ECAA 3CMET 1K73C 1KG1A 3CCQT 1KHIA 1KK7A 2MWPA 1E6HA 1ZSZC 2C0OA 4JLGA 4FW2A 3M0PA 1PG5B 2LQNA 1K9MC 1WHLA 2OTLQ 1JXOA 4M78E 4HVUA 1M1GA 3X25B 2OAWA 2DL8A 5I2SA 1H3HA 2DILA 1ABQA 3PE0A 1VQ4Q 3QBYA 4X34A 3JCMX 3CCMA 2RQUA 4BI8B 1WXTA 4FL6A 4JS5A 2K3XA 2CDTA 1KD1R 2CZ1B 4PJOC 3I9QA 1N27A 1GBQA 1WXBA 2J05A 1PWTA 1QW1A 2QG9B 2XI9A 1M8MA 1TSFA 5KCOA 1QVFS 2ROTA 1AWOA 1ACMB 2LMJA 2DE0X 4LN2A 4C8QD 4GLKA 3CCJT 2RJFA 2DXCA 2K57A 4D8KA 2XD0A 5C0MA 2VWFA 1MV3A 2RJEA 1GRIA 2GTJA 2HQEA 2COWA 2CSIA 2KEAA 3EFRA 1TUDA 4N4HA 1SHFA 4JRQA 1WJRA 4C5HA 1AD5A 5GMKm 4C8QF 3LGFA 2XK0A 2MCNA 3LH5A 5CIUA 4BE2A 3M0QA 1PSFA 4JJCA 5FU6B 3BDLA 2NUTA 3CCSA 2QGGA 1HYOA 1IHWA 3CPFA 3I35A 3OSVA 1JO8A 1YCYA 1ZLMA 2BZXA 2K4YA 2BZ8A 5GMKe 1VQ9A 3M54A 3OBYA 3OW2S 1GFCA 4PJNA 3H41A 2CH4A 1HSQA 4JJDA 3CMAT 4M78D 4PJLA 4C5IA 1OZ2A 4A63B 4JRIA 1D0XA 5GAMg 2G3RA 3JB9J 3VS2A 2A7YA 2EGAA 1VQ6Q 3PMTA 2KYBA 2EPDA 2J6FA 2FVUA 3L2UA 5HK3A 2EGEA 2HKNA 1NEGA 1YJ9Q 1G3WA 1N6AA 4CI0C 3M9QA 1HD3A 2PNIA 2DL3A 2YRDA 2L2PA 3OS1A 4M77A 4M77B 3QYGB 1PSEA 5KYWA 3JCMb 2CKKA 1YITA 2M0OA 3G71T 5KYWB 2GQVA 3FRNA 2GF7A 1UG1A 2XG8D 1GBRA 3EGUA 5CKBA 4Y92A 4OMQA 3G6EQ 2ZPGB 3TEEA 4KH0B 4QQDA 3A1PA 3RMQA 4LUEA 1W70A 2OX7A 3HKSA 1NZ9A 4C0GA 4FYWB 3L2VA 4IUVA 2MOXA 3OY9A 1ARKA 2VVKA 2NUZA 4DOVA 5A0GA 2ABLA 1ZX6A 2DJZA 3C94A 3QWXX 1D09B 1SSFA 1XQHA 1VQNT 2F5KA 2XDBA 1NLPC 1QKXA 3HRTA 2L89A 4FIBA 4C0FA 2EBPA 4KRTA 3I55A 2YSQA 4J6WA 1YI2T 3DB4A 3QKJA 2KMTA 4ESRA 1KC8C 5CKHA 2GQIA 3NMZC 3V8KA 3E9FA 1K0SA 1VQ7Q 1FWZA 3OS2A 3VS1A 3CPWP 4BE0A 4MDWA 4M7DF 3RKWA 5FU6C 4LDWA 4PFOA 2LJ3A 4AT1B 1BU1A 1LCKA 4DBQA 4HKEA 7AT1B 1M3CA 1SPKA 5D6WA 1G5VA 2KY9A 3BW1A 1X2KA 5GAN4 2KDSA 4E7SA 1KQ2A 1KQ1A 1VQOA 1NPRA 1PRLC 5GAOl 2DMOA 1HK9A 5LL6S 4X9DA 3M4GA 1AWJA 3QIIA 4C8QB 1N8RC 3QO3A 1VQ5T 1RI0A 1X27A 1OULA 4PL6A 4F7UF 3L2QA 4E47A 3ZL7C 3OYJA 3FJPA 1QVGS 1X69A 3DLLA 3OS5A 4BY6B 3CCUT 1KSWA 4JUVA 2CP3A 4C8QG 1LVKA 3HSBA 2X9HA 2FO0A 2QDYB 1WZOA 2O01E 3I56A 5HK0A 1UFFA 3OYYA 1GXIE 5KYNA 1TXQA 1K1ZA 1D1BA 4LD6A 2ZCFB 4BDYA 2CP6A 1V76A 2MAMA 3M59A 3A8LB 4HVVA 4M77C 5CKFA 2OTLT 5KE2A 5GAOp 3PTAA 1OYXA 3V8LA 3BY7A 3EG0A 1QCNA 1YBYA 2YRVA 6AT1B 4PJOF 1PKTA 5EG2A 1VQ4T 1WGSA 5GAMf 3CC7Q 8ATCB 4FW1A 4X9CA 3CC4Q 4KGXB 3HRUA 5AYFA 2I0NA 1K8AU 2O88A 2QQRA 2AKLA 2YLBA 2GFUA 2DD4A 3CCRA 4DEYA 2R58A 3L2WA 4FYXB 1ZBJA 5HCKA 1SRLA 1FMWA 2E41A 3JCMg 1MMGA 1IGQA 2X3WD 1V1CA 4E7LA 1U06A 4ATOA 2AZVA 3LWHA 4ZGEB 5CK9A 2CT4A 1XTDA 4QVDA
chains in the Genus database with same CATH topology
3JCMd 3GPLA 2KK4A 1VQKA 3RMSA 5LJ3h 4D6WA 2EIFA 3QZ5B 3MO8A 2FL7A 4EMHA 1KD1C 3HPWA 3MP8A 1WPYA 4IUTA 2VXEA 5J26A 1QP2A 2RHXA 4IURA 2CZ6B 3CXCS 5A0DA 2K3YA 1AHJB 2WSEE 1M4ZA 3CMAA 1YITT 4LDYA 3G4SA 1WQWA 5FU7B 3MEWA 4N4GA 5GMKh 3JB9I 2RH2A 5FU7C 1W2BS 2RI5A 3EAEA 1VQ5A 5CAIA 1M8VA 1VQ8A 4OGCA 4BD3A 2EQKA 4BB7A 2EQMA 4KUIA 3OYNA 2DIQA 2R5MA 3NTHA 5FLXE 2E6ZA 3F70A 4IUQA 4KT0E 3JSCA 4J6XA 3CC2T 1N9SA 1K8AC 1M1KC 1YHQT 2QQAA 2RJDA 3G7ZA 3PNWC 4IUPA 5GMKl 3CCUA 1YIJT 2XIDA 2EJ9A 2QQSA 4YTLA 1UGSB 2PVDB 1Q81U 3QSUA 4A53A 2IG0A 2EWNA 5CQXA 1K73U 2LT1A 4XAXB 2HQXA 3DLMA 2DPPB 2JNGA 1EIFA 4L59A 2GCXA 1KHCA 3LH0A 2RHZA 3RERA 3NTKA 4PLIA 1NJIU 3KBGA 5GANe 2RI3A 1XNIA 2RM4A 2VGMA 2X4XA 4Y28E 2QEXA 2EQJA 1K9MU 3OYKA 3META 2LCLA 3OYIA 5DY9A 2OTLA 2M9UA 3T9NA 3TU4K 4EMGA 4RKUE 2L3RA 3JAME 5GAMe 3CC7A 4JRPA 3S3MA 1VQLA 4LDXA 2RI2A 4J8OA 4M7AB 4C0DB 5GAOm 4M7AC 3G71A 4C0DC 5LJ5g 3CC4A 3CBPA 2LNVA 2MI6A 3OSSC 4F7UE 1UGRB 2QA4T 4M7DA 1UGPB 3V8JA 2D9TA 3PIPA 3GLXA 4RG8A 3OYCA 4M7DB 4M7DC 1BI3A 1QVPA 2MF2A 3X28B 5M9OA 3OYLA 4PJOD 1VQ4A 1VQ6T 3CEYA 2CYZB 4ELYC 2L8DA 2AHJB 3DKMA 3I55T 5GANg 4M7AG 2X4JA 4B9XA 3HL8A 3ASKA 4M77F 4M77E 1YJ9T 2WSCE 2CZ0B 5I21A 3OYBA 3GOXA 1G3YA 4XTZA 4OB1B 5IT9E 4WF2A 2DXTA 1XOVA 1VQPA 3CCEA 4M7DG 3CBOA 2YLCA 1WQ7A 2QQBA 4EMKC 3JCMJ 4NS5A 3JCMh 5CCAA 3JB9H 1BIBA 2QXFA 2L5QA 2MWOA 2DZCA 2RJCA 3P8HA 5GANd 2FYKA 4BDZA 3QYHB 2DK3A 5HY6A 4BE1A 2GFAA 1KQSS 5KH6A 3CMET 1WNLA 2K2VA 2ZPHB 4OB3B 4C5GA 4F7UA 3CCST 1K73C 1KG1A 3UDCA 4OMFB 1ZQ1A 4C92F 4C92E 4F7UB 5GAMd 3CCQT 3CCVT 1KHIA 4M75D 4MZTA 2MWPA 4R55A 1VQMA 2M1HA 4A54A 4JLGA 2A3LA 1NJIC 3NTIA 1LNXA 3L1AA 1K9MC 1Y7XA 3EFSA 5LJ3f 5DLOA 5DM7R 3JCMQ 3OYEA 3GNFB 4M78F 4M78E 5HKCA 1VQOT 4KULA 5J39A 5CQYA 1M1GA 4VUBA 3X25B 3QXEB 4IUUA 2EKOA 4QW2A 3P8DA 4ZTFA 5I2SA 2JVVA 5A2QE 2E10A 3G6ET 1BIAA 4RCBA 3J81E 1YI2A 4PLLA 3LX7A 4DA4A 1ZBXA 3S3OA 3QBYA 2RHYA 5D6XA 2VC8A 4X34A 5GMKi 3JCMX 3CCMA 1YJNT 3CD6T 3HFOA 5FRNA 3A8GB 4BI8B 1QVGA 4C92A 3OBWA 4QQ6A 4XU0A 4A4KA 2DKGA 4M75F 4M75E 3M57A 4EPCA 4FL6A 3OA6A 2K3XA 2E1HA 4JS5A 3MP1A 3OMCA 3JB9D 3CC2A 4CRIA 3X26B 4PJOA 5GAOq 2CZ1B 4PJOB 3R6OA 4MZPA 1YHQA 3UT1A 3VV0A 3I56T 3OYAA 3J7AF 4PJOC 1N27A 1YIJA 1WJQA 5GAN2 5GAN5 1QW1A 2XI9A 2VUBA 5FROA 3M4YA 2DVEA 1VIEA 4Z02A 5KCOA 2M16A 4A4HA 5GANj 1QVFS 3MEUA 1M1FA 4RCCA 2PQWA 5GAN3 1S72A 4XTYA 2EQUA 5A0LA 4FT2A 5GAMj 4PJOG 5LJ5h 3KUFA 2CZ7B 4C8QD 1NE8A 4GLKA 4P5NA 3CCJT 3CCLT 4OGEA 2RJFA 1Q86U 2QI2A 3QPHA 4JJNK 2DXCA 2K57A 4M75A 4M75B 3JB9F 3PFSA 2ZPEB 4OP0A 3MEVA 4OB0B 2QA4A 1OZ3A 4E7HA 2LCCA 4IKFA 1UEBA 1O9SA 1VUBA 1ZHIA 5C0MA 5FRMA 2ZPFB 2XD0A 3H8ZA 2RJEA 3J80E 1VQ7T 4OF1A 2HQEA 3E1SA 2OTJT 1VQ6A 3EFRA 4N4HA 1JBMA 1G3TA 2K5FA 4JRQA 1WJRA 3DB3A 4C5HA 4ME7A 2DTIA 4ZTJA 5IAYA 1W4SA 3JCMf 4BI4A 3QDRB 3CCRT 1P92A 5GMKm 4HCBA 4A4FA 2Y4XA 4M77D 4C8QF 3LGFA 2LX9A 4C8QE 2XK0A 2JUFA 5GAOn 3VJPA 4BE2A 5CIUA 1PSFA 3LW5E 2LVMA 5LJ3e 2PVGB 5GAN6 5FU6B 3CMEA 3BDLA 1JJ2A 3CCSA 1JB0E 2VGNA 3C12A 3CCQA 3CPFA 3CPWA 2DXBA 3CCVA 1YJWT 1QP3A 3OSVA 3QUIA 2V8JA 1YCYA 3OYDA 1FX7A 4C92D 2R57A 4HCCA 2PVOB 2K4YA 5GMKe 1VQ9A 3M54A 2HNIA 1BI1A 3OBYA 3OW2S 3MCAB 4JRKA 3HRSA 1Q86C 2XDDA 4LD9K 3CXCA 2E65A 2I2LA 3S3NA 3CMAT 3QJ6A 4M78D 4C5IA 4C8QA 1I5LA 1OZ2A 3G6EA 3A8OB 5LJ3g 1W2BA 3OYGA 4JRIA 2MMPA 3V7RA 3OMGA 2G3RA 2YHTA 5GAMg 4LDUA 3JB9J 2R5AA 2D6FA 5GAN8 2A7YA 2HD0A 5GAOr 2XICA 2C06A 3FEOA 4MDXA 2K5LA 3PMTA 4XTXA 1I4K1 3BFMA 4UC4A 3VYGA 3AHUA 4ZN3A 2FVUA 3QJYA 3JCMc 3L2UA 3LWIA 1B34A 4O6JA 5LJ3d 2E5QA 5HK3A 1Q7YC 1Q82C 1B34B 2EJGA 2P0KA 4KUDK 1Y96A 1G3WA 1N6AA 4CI0C 1Y96B 3A5ZB 1M5Q1 3L42A 3M9QA 3S6WA 4J83A 2WSFE 3SWNA 2XDPA 3E19A 3UPUA 3MHXA 3SWNB 4J7FA 3ZEHA 4BACA 3SWNC 2X4WA 3M58A 3OS0A 4PKCC 3OS1A 4N0AA 4M77A 5LJ5f 2QEXT 3PT9A 4M77B 4N0AC 3OYHA 4F7UG 3QYGB 2ZPIB 3PGGA 1PSEA 2RK1A 4DQ2A 3CCJA 4Q5WA 2CKKA 2F69A 2K5IA 2M0OA 4J5YA 1FXXA 4MMLA 3JCMb 2GQVA 3G71T 3GIBA 3FRNA 4RG2A 1MGQA 1RL2A 2GF7A 5GANf 1DJ7B 5I2MA 3FLGA 2XG8D 4FU6A 3ER0A 2EYQA 5CKBA 4XU3A 3OYFA 1KC8U 1BI2A 2RB6A 4C92B 3JCMe 1YITA 2DTHA 4C92C 5KE3A 2ZPGB 3TEEA 4LDVA 2P0PA 2JTMA 3N5BB 5CO7A 4QQDA 3VYHB 4ZGDB 2QTXA 1BKBA 1X75C 2DIGA 2DTOA 2ZGWA 2LC4A 2DXUA 4XQ3A 4TVRA 3Q1JA 3RMQA 4M78A 3O8VA 3BDUA 4M78B 3RIRA 2VV5A 2H3JA 3TCJA 2X4YA 1LJOA 4M78C 4Y91A 3CCET 4J7IA 3HKSA 2QQ9A 4C92G 1NZ9A 4R56A 4C0GA 5LJ3j 5CR2A 1Y71A 1X6OA 1U8RA 3CBMA 3L2VA 4IUVA 1V29B 2BIVA 3OY9A 1KQSA 1JRIA 2RD1A 2P0QA 4M7AD 2Y4YA 4MMKA 4PNOA 3KXTA 4DOVA 1Y07A 4M78G 5A0GA 3SD4A 4FT4A 4C0ZA 1OI1A 3CPWS 2DJZA 1IZ6A 2X35A 2XHCA 1SSFA 3C94A 3GNGA 1XQHA 4M75C 3GP8A 4XU2A 3VKIA 4BI3A 5GANh 4DOWA 1VQNT 2PUOB 2F5KA 4MZMA 3RKXA 2XDBA 3CCLA 2LTOA 3WXMB 3HRTA 2L89A 4FIBA 3RESA 3V7CA 4C0FA 3LGLA 5IN1A 5GAMh 3P8BB 3PMIA 1M90C 4BUGA 1R8OB 3ZBDA 3MP6A 3I55A 4HA8A 2DZ9A 4J6WA 1YI2T 4NOYA 1Q7YU 4ELZC 3DB4A 3QKJA 4L6V5 1Q82U 2KMTA 4M75G 3QHSA 1KC8C 1YJ9A 5CKHA 2D0QB 2DD5A 3CCMT 5GAN7 3V8KA 5CVIA 3E9FA 4RMOA 2IVWA 3UWNA 3X20B 2DO3A 2LDMA 3QG1A 1FWZA 2F5TX 2PU9B 3JCMP 4M7AE 3OS2A 4M7AF 3VU3C 4N4IA 1UGQB 4BE0A 4MDWA 3E9GA 4JLIA 4M7DF 4M7DE 3PIOA 2RK2A 3RKWA 5LJ5e 5FU6C 4LDWA 1X01A 2HBPA 2RA2A 3FC3A 3FB9A 3HFNA 4HT8A 4HKEA 4II1A 3C4SA 1QVFA 2DAQA 2RHIA 5D6WA 1VQKT 1G5VA 2KY9A 3BW1A 5CKDA 1S72T 2HAXA 5GAN4 2KDSA 4O5VA 3OQ5A 1KQ2A 3RUXA 1KQ1A 4XK8E 1VQOA 1NPRA 3INZA 2ZZDA 5GAOl 1HK9A 2CS7A 3JB9G 5LL6S 4X9DA 3M4GA 3G4ST 3M55A 1G3SA 3C95A 3QIIA 3HP9A 4C8QB 1N8RC 4M7AA 4C8QC 3QZ9B 3QO3A 2V8KA 3TREA 1VQ5T 1RI0A 1VQ8T 1LOJA 4PL6A 2O4XA 4F7UF 2FHDA 3L2QA 4E47A 2O4XB 4GY5A 1YJNA 3CD6A 2BUDA 1I81A 1YJWA 1H641 2JOYA 3FJPA 3OYJA 1BYMA 1BI0A 3A8MB 3H6ZA 3M5AA 5KCHA 3OS5A 3WVEB 4BY6B 3DLLA 3L2ZA 2JZ2A 4KBMB 3V7SA 1HXDA 4JUVA 2JTFA 3VUZA 4BY6C 3JCMV 3L2RA 3CCUT 5LJ5d 4C8QG 3GF5A 3HSBA 2EFIA 2QDYB 2O01E 3I56A 2ZPBB 5HK0A 3X24B 3A8HB 3OYYA 1GXIE 3JCMW 2VXFA 4FM4B 4EMKA 1H3ZA 2XKOC 1QVGS 4EMKB 3FIFA 4XTWA 4LD6A 2ZCFB 1UB4A 2LT4A 4BDYA 5CKFA 2MAMA 3M59A 2BKDN 3A8LB 4M77C 2OTLT 5KE2A 1Q81C 2WACA 5D6YA 5GAOp 3PTAA 1VQLT 3CC7T 1OYXA 5J3BA 3BY7A 3V8LA 4NL2A 5L8RE 4OB2B 4B9WA 2DEQA 1TH7A 4J6YA 3M56A 3CC4T 1KD1U 1M90U 2E12A 1MHNA 1YBYA 2YRVA 1M9SA 2EJFA 4HCZA 2E70A 4PJOF 3NFCA 4PJOE 4JDSA 5DLQE 1VQ9T 1D3BA 3M53A 2LQ8A 3FDRA 4QVZA 4C5EA 4JS4A 1D3BB 3URGA 3OW2A 4M77G 2V8IA 1I8FA 5EG2A 1VQ4T 3VUBA 1WGSA 5GAMf 4OVAA 2E6NA 3LLRA 1VQNA 5C6SA 2FB7A 2NLUA 4E7KA 1VQ7A 4HT9A 4X9CA 1O75A 1N9RA 2XU8A 3HRUA 2RHUA 5AYFA 4NL3A 2OTJA 4EDUA 2EAYA 4XTUA 1NPPA 4QQGA 2CGHA 1K8AU 5CKEA 2QQRA 1U1SA 3RKYA 4ZN1A 4E7JA 1M1KU 3SDZA 2OAUA 1VQPT 2YLBA 2GFUA 2P4TA 3LYIA 2DD4A 2B8AA 2PUKB 3HHTB 3CCRA 2R58A 2KSSA 4FSXA 3SB2A 3L2WA 2LRQA 4QVCA 2LQKA 5LJ5j 1IREB 2KAFA 3ZFJA 4V2SA 2KQWA 4L5GA 3MEAA 3ME9A 2E41A 2RO0A 3JCMg 1WJSA 2JN0A 4ZGJB 1VQMT 1VIFA 5GMKj 4E7IA 4QVDA 4E7LA 1JJ2S 4ATOA 3JRZA 2E64A 4XTVA 4M7DD 1U1TA 3LWHA 3OB9A 4A4GA 4ZGEB 5CK9A 3SFMA 2VYTA 1N8RU 3WVDB 2KVQG 1XTDA 2Y90A 4XU1A 4A4EA 3OYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMT A;  4UC4 A;  4PLL A;  3LX7 A;  3FC3 A;  3L2U A;  3MO8 A;  2E5Q A;  3S3O A;  3QBY A;  2RHY A;  2P0K A;  3MP8 A;  4II1 A;  3C4S A;  4IUT A;  4X34 A;  4IUR A;  2RHX A;  2DAQ A;  2RHI A;  5D6W A;  5J26 A;  1G5V A;  2K3Y A;  5FRN A;  3L42 A;  3M9Q A;  3S6W A;  4QQ6 A;  3OQ5 A;  2XDP A;  3MEW A;  2K3X A;  4FL6 A;  4N4G A;  3MP1 A;  3OMC A;  3OA6 A;  2RI5 A;  4CRI A;  3ZEH A;  3EAE A;  4BAC A;  2X4W A;  4BD3 A;  2EQK A;  2EQM A;  3UT1 A;  3OS0 A;  2DIQ A;  2R5M A;  3NTH A;  3OS1 A;  3QII A;  1N27 A;  3F70 A;  4IUQ A;  3OYN A;  1WJQ A;  3OYA A;  1RI0 A;  3OYH A;  4PL6 A;  2O4X A;  2RJD A;  2FHD A;  3PNW C;  4IUP A;  4Z02 A;  5FRO A;  5KCO A;  2M16 A;  2O4X B;  4A4H A;  4GY5 A;  3MEU A;  2QQS A;  2BUD A;  3OYJ A;  4Q5W A;  2CKK A;  2PQW A;  3H6Z A;  2M0O A;  2IG0 A;  5KCH A;  2EQU A;  2JZ2 A;  4RG2 A;  2JTF A;  3L2R A;  2GF7 A;  2HQX A;  3DLM A;  3KUF A;  3FLG A;  4FU6 A;  4L59 A;  3OYF A;  1KHC A;  2EFI A;  2RHZ A;  3LH0 A;  3NTK A;  2RJF A;  4PLI A;  2RI3 A;  1XNI A;  2X4X A;  5KE3 A;  2EQJ A;  3OYK A;  1H3Z A;  3MET A;  3OYI A;  3PFS A;  4QQD A;  3MEV A;  2DIG A;  1OZ3 A;  4E7H A;  2L3R A;  2LCC A;  4IKF A;  4LD6 A;  3S3M A;  5FRM A;  5C0M A;  3Q1J A;  4BDY A;  2RI2 A;  3H8Z A;  2RJE A;  2BKD N;  3O8V A;  2HQE A;  5KE2 A;  2WAC A;  2X4Y A;  5D6Y A;  1OYX A;  2D9T A;  4N4H A;  3OYC A;  4B9W A;  1WJR A;  3DB3 A;  4C5H A;  5M9O A;  3OYL A;  4ZTJ A;  1MHN A;  2YRV A;  3L2V A;  4HCZ A;  4IUV A;  2BIV A;  5IAY A;  3OY9 A;  3CEY A;  4A4F A;  3FDR A;  4QVZ A;  2L8D A;  3LGF A;  4C5E A;  2XK0 A;  4B9X A;  3ASK A;  3OYB A;  1WGS A;  5CIU A;  3GOX A;  4OVA A;  2E6N A;  3LLR A;  3SD4 A;  4BE2 A;  5C6S A;  1OI1 A;  2NLU A;  4E7K A;  2LVM A;  2X35 A;  1SSF A;  3L2Q A;  2RHU A;  4EDU A;  4NS5 A;  3BDL A;  4QQG A;  2MWO A;  2F5K A;  2QQR A;  2RJC A;  3P8H A;  2LTO A;  4BDZ A;  4E7J A;  2GFU A;  2L89 A;  3LYI A;  3OYD A;  2B8A A;  2GFA A;  4BE1 A;  3LGL A;  5KH6 A;  2R57 A;  5IN1 A;  3PMI A;  4C5G A;  2R58 A;  3L2W A;  3MP6 A;  2LRQ A;  3DB4 A;  3QKJ A;  2MWP A;  4ZTF A;  2M1H A;  3NTI A;  3S3N A;  3MEA A;  3E9F A;  3ME9 A;  2RO0 A;  1WJS A;  3QJ6 A;  3UWN A;  2LDM A;  4C5I A;  4E7I A;  1OZ2 A;  3OS2 A;  5D6X A;  3OYE A;  4E7L A;  4N4I A;  3OYG A;  5J39 A;  4BE0 A;  3OB9 A;  4A4G A;  3E9G A;  3OMG A;  2EKO A;  2G3R A;  3P8D A;  4IUU A;  2VYT A;  2R5A A;  4QW2 A;  3OYM A;  4A4E A;  3FEO A; 
#chains in the Genus database with same CATH topology
 3JCM d;  2QGF B;  5KYU A;  3QZ5 B;  3MO8 A;  2FL7 A;  5KYU B;  3HPW A;  1WPY A;  1NG2 A;  5A0D A;  2WSE E;  1OU8 A;  5GMK h;  2RH2 A;  5FU7 C;  3EAE A;  1M8V A;  5CAI A;  2EQK A;  2JT4 A;  2MIO A;  3O5Z A;  2B86 A;  1M1K C;  2QQA A;  4IUP A;  2VAS A;  2EJ9 A;  4YTL A;  3CCM Q;  1T0J A;  4QKU A;  2LT1 A;  4WTO B;  2KNB B;  1EIF A;  2E3H A;  3NTK A;  1YCS B;  2DYB A;  2QEX A;  1PKS A;  3OYK A;  2LCL A;  3OYI A;  5DY9 A;  1QWF A;  4RKU E;  3JAM E;  5GAM e;  1VQL A;  2RI2 A;  4J8O A;  1VQK Q;  1I5O B;  4C0D B;  5LJ5 g;  2FZK B;  2K7A A;  1UGR B;  4M7D A;  4RG8 A;  4M7D B;  2HQH A;  3OYL A;  1KIK A;  1VQ6 T;  3VS7 A;  1Q81 R;  2SRC A;  2G6F X;  5FW9 A;  4ELY C;  4J9F A;  5GAN g;  3ASK A;  4M77 E;  1YJ9 T;  2WSC E;  4RTV A;  3GOX A;  1Y57 A;  1G3Y A;  4WF2 A;  3CCE A;  2A36 A;  4M7D G;  3CBO A;  1WQ7 A;  2QQB A;  2BE7 D;  5GAN d;  5IHN A;  2IIM A;  5HY6 A;  2FRY A;  1KQS S;  2K2V A;  2ZPH B;  1SSH A;  4F7U A;  2CH4 W;  3UDC A;  4F7U B;  1N5Z A;  1VQM A;  2K79 A;  4A54 A;  2A3L A;  1NJI C;  1CSK A;  5LJ3 f;  4OMN A;  3JCM Q;  3GNF B;  5HKC A;  3CCS Q;  3C0C A;  2J6O A;  4KUL A;  5CQY A;  1QMC A;  4ZTF A;  2JVV A;  2GBQ A;  5A2Q E;  3G6E T;  1VQ9 Q;  1BIA A;  2ESW A;  4RCB A;  4DA4 A;  3S3O A;  5FWC A;  2MPX C;  2RHY A;  5GMK i;  3HFO A;  4C92 A;  3OBW A;  3PVL A;  2DKG A;  3M57 A;  4EPC A;  2K9G A;  3CC2 A;  4PJO A;  4PJO B;  1YHQ A;  2BE9 B;  4LNP A;  3OYA A;  2CP0 A;  1YIJ A;  2L3S A;  4K11 A;  2JS2 A;  5GAN j;  1VIE A;  2M16 A;  4A4H A;  1MV0 B;  4RCC A;  1S72 A;  4XTY A;  4PJO G;  1NE8 A;  4P5N A;  4OMM A;  2YRC A;  4M75 A;  4M75 B;  3PFS A;  1EZZ B;  3TSW A;  2QA4 A;  4E7H A;  4IKF A;  1UEB A;  1ZHI A;  2ZPF B;  1QWE A;  1IGU A;  1VQ7 T;  1YIT Q;  3E1S A;  2JM8 A;  2K2M A;  4R0K A;  1G3T A;  2Z0W A;  3DB3 A;  1TS9 A;  1AWW A;  3JCM f;  3GBQ A;  1ZA1 B;  4BI4 A;  1P92 A;  2Y4X A;  4M77 D;  4C8Q E;  3EH2 A;  3VJP A;  2D0N A;  1WI7 A;  1OPL A;  5LJ3 e;  1AOJ A;  4PJM A;  3CME A;  1JJ2 A;  1A0N B;  2VGN A;  3UF4 A;  3M0T A;  3CCQ A;  3CPW A;  2R57 A;  4HCC A;  2PVO B;  1F1B B;  2HNI A;  1BI1 A;  1G8X A;  3HRS A;  1Q86 C;  2HDA A;  2XDD A;  4EIK A;  3CXC A;  2E65 A;  4E7Z A;  2I2L A;  1PC0 A;  4LXC A;  1I5L A;  1BB9 A;  3A8O B;  1W2B A;  1VYU A;  2MMP A;  1IXD A;  4MDX A;  1X2Q A;  5GAO r;  2XIC A;  1I4K 1;  3I55 Q;  1I1J A;  3QJY A;  4F16 A;  2E5Q A;  1Y96 A;  1Y96 B;  3L42 A;  3MKD A;  4J83 A;  1Z9Z A;  3E19 A;  1SKU B;  3MHX A;  3AT1 B;  4PKC C;  5LJ5 f;  2V1Q A;  3PT9 A;  3CCV Q;  3RDV A;  1UE9 A;  1M2O A;  3PGG A;  4LUD A;  2X51 A;  3CCJ A;  4Q5W A;  2MYS A;  4RG2 A;  3TQ7 P;  5GAN f;  1VQO Q;  2KT1 A;  2EYQ A;  4XU3 A;  1BI2 A;  3JCM e;  2DTH A;  4C92 C;  3REB B;  4LDV A;  2DBK A;  3N5B B;  2JTM A;  2M0Y A;  4ZGD B;  4RTT A;  2QTX A;  1T0H A;  2DIG A;  2DTO A;  2ZGW A;  1MMA A;  2DXU A;  2LC4 A;  3NPF A;  3Q1J A;  3RIR A;  4Y91 A;  1UHC A;  2X4Y A;  3TCJ A;  2D1X A;  1M3B A;  1I0C A;  2EYW A;  1Y71 A;  1JU5 C;  3VRY A;  1U8R A;  2EVR A;  3I56 Q;  3KXT A;  1UJ0 A;  1IRX A;  3SD4 A;  1T3S A;  3CPW S;  2X35 A;  4M75 C;  3GNG A;  1KFZ A;  4BI3 A;  1PD0 A;  1NBE B;  3CCL Q;  3V7C A;  4IIM A;  3RES A;  1D0Y A;  3LGL A;  5GAM h;  4BUG A;  1RI9 A;  3ZBD A;  3MP6 A;  2ED0 A;  4HA8 A;  3VS0 A;  2YT6 A;  4L6V 5;  3QHS A;  2KXD A;  2LCS A;  3CCM T;  5CVI A;  1FMK A;  1WYX A;  3UWN A;  1IB8 A;  3VU3 C;  3JV3 A;  2CUB A;  4JLI A;  4M7D E;  2RK2 A;  1MND A;  5LJ5 e;  2DEU A;  3CCR Q;  2EYY A;  2NUT B;  3FB9 A;  4RTX A;  1RAB B;  4HT8 A;  4II1 A;  2DNU A;  2LNH B;  1VQK T;  2H8H A;  5CKD A;  3RUX A;  1Q7Y R;  1Q82 R;  1YJW Q;  2RQW A;  3M55 A;  1G3S A;  2F2W A;  3HP9 A;  4M7A A;  3MJX A;  3TRE A;  2FEI A;  2O4X A;  5AT1 B;  2O4X B;  4GY5 A;  1YJN A;  3CD6 A;  2BUD A;  2JOY A;  1BYM A;  3H6Z A;  1YP5 A;  5KCH A;  3L2Z A;  4KBM B;  2JTF A;  4RTU A;  2P84 A;  3GF5 A;  4J9H A;  5EC7 A;  2LP5 A;  2HSP A;  3HTR A;  4FM4 B;  1H3Z A;  3R6N A;  2XKO C;  2QAS A;  2JS0 A;  3FIF A;  4XTW A;  1Y0M A;  1Q95 G;  2WAC A;  2DRM A;  4HXJ A;  1HJD A;  2DBM A;  5L8R E;  2KE9 A;  1TH7 A;  1SF9 A;  1MHN A;  1M9S A;  2QEX Q;  4PJO E;  4JDS A;  1VQ9 T;  2LQ8 A;  4JS4 A;  4M77 G;  3VUB A;  4GBQ A;  2AKK A;  2E6N A;  2ECZ A;  2XMF A;  1VQN A;  2FB7 A;  2NLU A;  4HT9 A;  2XU8 A;  2EKH A;  2OTJ A;  2HL5 C;  4EDU A;  2EAY A;  4HCK A;  1NPP A;  2CGH A;  2DL5 A;  5CKE A;  1U1S A;  2RNA A;  1GCQ A;  2B8A A;  1W1F A;  1H92 A;  2KSS A;  1QQJ A;  4FSX A;  2LRQ A;  4AMC A;  1PHT A;  1UTI A;  1IRE B;  3KFV A;  4HVW A;  2KQW A;  1VOM A;  3ME9 A;  1M90 R;  1WJS A;  2YUO A;  5D7U A;  4ZGJ B;  3CCE Q;  3JRZ A;  2HZY A;  4XTV A;  4M7D D;  4A4G A;  1OEB A;  2L3P A;  2VYT A;  3WVD B;  3OYM A;  4A4E A;  4FYY B;  5LJ3 h;  4D6W A;  2EIF A;  5KYX A;  1KD1 C;  5KYX B;  2RHX A;  2K3Y A;  4E2F B;  1YIT T;  1M4Z A;  1B07 A;  1WXU A;  1OV3 A;  5FU7 B;  3JB9 I;  1OU9 A;  1VQ5 A;  4DBF A;  1ZSG A;  4BD3 A;  2YDL A;  2DIQ A;  1JJ2 P;  5FLX E;  2E6Z A;  3F70 A;  4WCI A;  5L23 A;  3G7Z A;  5GMK l;  3CCU A;  2O31 A;  1UGS B;  4E6R A;  1SEM A;  1Q81 U;  4A53 A;  1K73 U;  4XAX B;  2HQX A;  3CXC P;  3LH0 A;  2RHZ A;  1W2B P;  2VGM A;  5KYY A;  1K9M U;  1PNJ A;  3MET A;  5KYY B;  2OTL A;  1X43 A;  3T9N A;  3TU4 K;  3EHR A;  2CT3 A;  4AG2 C;  1NM7 A;  4M7A C;  1S72 Q;  2MI6 A;  2SEM A;  3OSS C;  1UGP B;  1CKA A;  1PD1 A;  3PIP A;  1BI3 A;  5M9O A;  2CP7 A;  4PJO D;  3G4S Q;  1VQ4 A;  2CYZ B;  2L8D A;  2AHJ B;  3I55 T;  1VQ8 Q;  3HL8 A;  2CZ0 B;  2GGR A;  4XTZ A;  1XOV A;  3JCM J;  3JCM h;  2L5Q A;  3M0U A;  2DZC A;  1NYF A;  2FYK A;  2OI3 A;  3QYH B;  4BE1 A;  1WNL A;  2EYZ A;  4C5G A;  4C92 F;  3CCV T;  2EYX A;  4M75 D;  4MZT A;  4R55 A;  2M1H A;  1BBZ A;  1UHF A;  2PZ1 A;  1Y7X A;  5DLO A;  5DM7 R;  1VQO T;  2ZAE A;  2KRS A;  5J39 A;  2EKO A;  1SG5 A;  1UDL A;  2RN8 A;  1YWO A;  1K9A A;  5D6X A;  1GCQ C;  5FRN A;  3EGX A;  4QQ6 A;  4XU0 A;  4M75 F;  1UUE A;  2GNC A;  3JB9 D;  3MP1 A;  3OMC A;  4CRI A;  3X26 B;  5GAO q;  1VQP Q;  3I56 T;  5GAN 5;  1X6G A;  1FYN A;  2QAZ A;  1UJY A;  2KRM A;  2VUB A;  3M4Y A;  2DVE A;  1M1F A;  2PQW A;  5GAN 3;  2DRK A;  2EQU A;  2JTE A;  4FT2 A;  5LJ5 h;  3KUF A;  2YXY A;  3CCL T;  2O2O A;  2AIR B;  2QI2 A;  3QPH A;  4JJN K;  3VRZ A;  1EFN A;  3JB9 F;  2ZPE B;  3MEV A;  4CC2 A;  5FRM A;  1VUB A;  2CP5 A;  2DER A;  3H8Z A;  3CCJ Q;  3J80 E;  1WHK A;  2RPN A;  1VQ6 A;  1LPL A;  2K5F A;  2QTV A;  4ME7 A;  2DLP A;  3CCR T;  2BZY A;  4HCB A;  2LX9 A;  5GAO n;  1C1A A;  1PM3 A;  2ROL A;  2CP2 A;  2RQR A;  4ANJ A;  3LW5 E;  3EH1 A;  2PVG B;  1JB0 E;  4JJB A;  1YJW T;  1QP3 A;  3OYD A;  1FX7 A;  4RTW A;  2YUP A;  3MCA B;  4JRK A;  4LD9 K;  1VA7 A;  1TTH B;  5IH2 A;  1K73 R;  3QJ6 A;  1BCM A;  4J9I A;  1E7O A;  3G6E A;  3OYG A;  2COY A;  3EG1 A;  1D1C A;  3OMG A;  2YHT A;  2D6F A;  1K9M R;  2DX1 A;  2F1L A;  3FEO A;  2K5L A;  1GFD A;  4XTX A;  3VYG A;  3AHU A;  3U23 A;  1QCF A;  1JEG A;  4QT7 A;  1MMD A;  4KUD K;  3A5Z B;  1M5Q 1;  3S6W A;  2RMO A;  1GCP A;  3UPU A;  4J7F A;  3ZEH A;  3SWN C;  1G2B A;  2X4W A;  3OS0 A;  3EG9 A;  2QEX T;  4JZ4 A;  3EG9 B;  2YUQ A;  1ZUY A;  4N0A C;  3OYH A;  4F7U G;  2ZPI B;  2RK1 A;  2FG0 A;  1RUW A;  2F69 A;  2K5I A;  2KI7 A;  3GIB A;  3RBB B;  1MGQ A;  1DJ7 B;  3ER0 A;  1YFN A;  1KC8 U;  2QK0 A;  4C92 B;  2JMA A;  1RAG B;  1WA7 A;  5KE3 A;  2P0P A;  5CO7 A;  1X75 C;  4TVR A;  1YJN Q;  3CD6 Q;  4FSS A;  4DBH A;  2AT1 B;  3BDU A;  5IXF A;  3CCE T;  2VV5 A;  4M78 C;  1OPK A;  2QQ9 A;  1SRM A;  1JXM A;  4C92 G;  4R56 A;  4CC7 A;  3H0F A;  1V29 B;  1X6B A;  2P0Q A;  4M7A D;  2Y4Y A;  4PNO A;  1IO6 A;  2K6D A;  1Y07 A;  4C0Z A;  1IZ6 A;  3GP8 A;  4M4Z A;  3VKI A;  2HMA A;  2PUO B;  4LE9 A;  4MZM A;  3VS4 A;  2LTO A;  3QWY A;  3WXM B;  4J9B A;  3P8B B;  3PMI A;  1R8O B;  2DZ9 A;  1Q7Y U;  1Q82 U;  2FPF A;  4M75 G;  4RTY A;  3NHN A;  4DEX A;  2D0Q B;  2DD5 A;  4RMO A;  3EFO A;  3D7S B;  3X20 B;  3QG1 A;  3EFO B;  4M7A F;  2OTJ Q;  2F5T X;  2PU9 B;  1WIE A;  4N4I A;  1UGQ B;  2FZC B;  2M51 A;  2JW4 A;  1X01 A;  2RA2 A;  3FC3 A;  1OX8 A;  2J7I A;  1E6G A;  1WHM A;  1QVF A;  2RHI A;  1RAD B;  1S72 T;  4F17 A;  4XK8 E;  2ZZD A;  2CS7 A;  3JB9 G;  3G4S T;  2DA9 A;  1VQ8 T;  2FRW A;  3UA7 A;  4J9E A;  1I81 A;  1H64 1;  1WX6 A;  1OOT A;  1WHG A;  1BI0 A;  3A8M B;  3M5A A;  2JXB A;  3WVE B;  3G1J A;  3VUZ A;  3L2R A;  4AFS C;  2ZPB B;  4PK4 A;  3X24 B;  2VXF A;  4EMK A;  2F2X A;  1AT1 B;  2RF0 A;  2HSE B;  1RAC B;  4EMK B;  5IHI A;  1Z9Q A;  2LT4 A;  2BKD N;  2KR3 A;  1YWP A;  1Q81 C;  5D6Y A;  3CC7 T;  2BTT A;  2AZS A;  4OB2 B;  1R0B G;  4B9W A;  2DEQ A;  3CC4 T;  4ZNX A;  1M90 U;  2KRN A;  4HCZ A;  2E70 A;  5DLQ E;  1NEB A;  3M53 A;  3FDR A;  3OW2 A;  2V8I A;  1PCX A;  1K4U S;  4OVA A;  3LLR A;  5C6S A;  4E7K A;  4NL3 A;  2RHU A;  4F14 A;  1M1K U;  3RKY A;  4ZN1 A;  4E7J A;  2OAU A;  1VQP T;  2ED1 A;  3LYI A;  1KQS P;  3EG2 A;  1J3T A;  2DFU A;  8AT1 B;  4QVC A;  2YWW A;  2LQK A;  2GTO A;  3ZFJ A;  2LQW A;  2RO0 A;  3RR6 A;  1VIF A;  4E7I A;  1JJ2 S;  1KC8 R;  2DET A;  3SFM A;  2KVQ G;  4XU1 A;  1AWX A;  3GPL A;  1VQK A;  3RMS A;  1TOV A;  4IUT A;  3IQL A;  3EHQ A;  5J26 A;  1QP2 A;  4IUR A;  3CXC S;  4RTZ A;  3CMA A;  2FPE A;  4RUG A;  1R0C B;  3MEW A;  1W2B S;  1ZUU A;  2M02 A;  4OGC A;  4BB7 A;  2EQM A;  1AVZ C;  4IUQ A;  1B3Q A;  4J6X A;  1N9S A;  3H0I A;  1K8A C;  4OML A;  2NYS A;  2XID A;  3I5S A;  3QSU A;  1N8R R;  3EGD A;  1M3A A;  3EGD B;  2IPO B;  2DPP B;  1S1N A;  4L59 A;  2GCX A;  1KHC A;  3RER A;  2E5K A;  4PLI A;  2HKQ B;  1NJI U;  3KBG A;  5GAN e;  2RI3 A;  2RM4 A;  4PFP A;  3H9N A;  2M9U A;  1KJW A;  4Z89 A;  2L3R A;  4LDX A;  3S3M A;  4M7A B;  5GAO m;  3G71 A;  1QKW A;  2LNV A;  4F7U E;  4AFU C;  3GLX A;  4AFZ C;  3OYC A;  2L0A A;  3X28 B;  2NUP A;  2L3Q A;  2NUP B;  1ZA2 B;  2VKN A;  1ABO A;  1I07 A;  2E4H A;  3DKM A;  2A28 A;  1WHJ A;  4M7A G;  4B9X A;  9ATC B;  5I21 A;  2LJ1 A;  3OYB A;  3PVQ A;  4OB1 B;  5IT9 E;  2DXT A;  3TVT A;  4EMK C;  4NS5 A;  5CCA A;  4PFZ A;  1BIB A;  2QXF A;  2RJC A;  2DK3 A;  1RAE B;  2GFA A;  5KH6 A;  4OB3 B;  3CCS T;  4OMF B;  1ZQ1 A;  4C92 E;  5GAM d;  1OX9 A;  2ATC B;  2CUD A;  1UGV A;  4OMP A;  3VS3 A;  4DBR A;  1WDX A;  3NTI A;  1LNX A;  3L1A A;  3EFS A;  1C6V X;  3OYE A;  1VQL Q;  4M78 F;  1NYG A;  2DVJ A;  4VUB A;  3H0H A;  3QXE B;  4IUU A;  4QW2 A;  3P8D A;  3QDF A;  4CC4 B;  1VYT A;  1M2V A;  2E10 A;  1M2V B;  3J81 E;  1YI2 A;  4PLL A;  3LX7 A;  1ZBX A;  2VC8 A;  1YJN T;  3CD6 T;  3A8G B;  1QVG A;  4A4K A;  4M75 E;  3OA6 A;  2E1H A;  3R6O A;  4MZP A;  3J7A F;  3UT1 A;  3VV0 A;  2O9V A;  1WJQ A;  5GAN 2;  2J06 A;  1TU0 B;  5FWB A;  5FRO A;  1K76 A;  4Z02 A;  4Z8A A;  3MEU A;  1BK2 A;  5A0L A;  1VQM Q;  5GAM j;  1M1K R;  2CZ7 B;  3FJ5 A;  2KRO A;  2D8J A;  4OGE A;  2E3I A;  1Q86 U;  1RAF B;  1T3L A;  2CSQ A;  3RNJ A;  4OP0 A;  4OB0 B;  1OZ3 A;  2LCC A;  1TUG B;  1O9S A;  1NLO C;  4OF1 A;  2OTJ T;  1QVF P;  2DL7 A;  1JBM A;  2DTI A;  1TWB A;  4ZTJ A;  5IAY A;  1W4S A;  3QDR B;  1K0X A;  2PTK A;  4A4F A;  3CC2 Q;  2JUF A;  1M30 A;  1YHQ Q;  1YIJ Q;  1AZE A;  2LVM A;  4GLM A;  1VYV A;  5GAN 6;  4F04 B;  3REA B;  3C12 A;  2FPD A;  3CQT A;  2DXB A;  3CCV A;  3QUI A;  2V8J A;  4C92 D;  4KH1 B;  3UA6 A;  2KBT A;  2VB6 A;  4CC3 A;  3S3N A;  2DM1 A;  4C8Q A;  2DF6 A;  2QA4 Q;  5LJ3 g;  4AFQ C;  3VS5 A;  3E2U A;  1MNE A;  1NJI R;  3V7R A;  1RAA B;  4LDU A;  2R5A A;  5GAN 8;  2HD0 A;  1QLY A;  4Z88 A;  3SHW A;  2C06 A;  3BFM A;  4UC4 A;  4ZN3 A;  3JCM c;  3ULR B;  3LWI A;  1B34 A;  4O6J A;  5LJ3 d;  1Q7Y C;  3M0R A;  1Q82 C;  1B34 B;  2EJG A;  2P0K A;  3SEM A;  3OW2 P;  2ENM A;  1GL5 A;  2WSF E;  3SWN A;  2XDP A;  3SWN B;  4BAC A;  3M58 A;  1WHH A;  1AEY A;  4N0A A;  3CME Q;  1M27 C;  3CCQ Q;  4DQ2 A;  2AK5 A;  1H8K A;  3CCL A;  4MML A;  1UEC A;  1FXX A;  3UAT A;  1RL2 A;  1EX4 A;  5I2M A;  3FLG A;  4FU6 A;  3OYF A;  2D8H A;  2RB6 A;  3EGX B;  2RQT A;  4PJJ A;  2A37 A;  3TSZ A;  1QCO A;  3VYH B;  1BKB A;  4XQ3 A;  4D8D A;  3M0S A;  4M78 A;  1RAH B;  3O8V A;  2JJ9 A;  4M78 B;  2DYI A;  2H3J A;  1LJO A;  4J7I A;  4AG1 C;  2EGC A;  4OMO A;  5LJ3 j;  5CR2 A;  1X6O A;  2MK5 A;  3CBM A;  4KGV B;  1KQS A;  2BIV A;  1JRI A;  2RD1 A;  4MMK A;  1RAI B;  4J9D A;  4KGZ B;  4M78 G;  4FT4 A;  1OI1 A;  2V26 A;  1YJW A;  1JQQ A;  2LZ6 B;  2XHC A;  3A98 A;  4XU2 A;  1RLP C;  5GAN h;  2V1R A;  4DOW A;  3RKX A;  2HL3 A;  3BE3 A;  5GJV B;  2H3E B;  5IN1 A;  1M90 C;  4NOY A;  4ELZ C;  2NWM A;  1YJ9 A;  5GAN 7;  1U5S A;  2JM9 A;  2IVW A;  2DO3 A;  2LDM A;  3JCM P;  4M7A E;  3I5R A;  1Q86 R;  3E9G A;  3PIO A;  1YN8 A;  1D1A A;  2HBP A;  3HFN A;  1MMN A;  3C4S A;  2CRE A;  2DAQ A;  4FCY A;  1R77 A;  1AZG B;  2HAX A;  4O5V A;  3OQ5 A;  3INZ A;  4JZ3 A;  1TG0 A;  1YNZ A;  3C95 A;  4C8Q C;  3QZ9 B;  2V8K A;  1ZUK A;  1LOJ A;  2FHD A;  1SHG A;  3CMA Q;  2JZ2 A;  3V7S A;  1HXD A;  4BY6 C;  3JCM V;  5LJ5 d;  2EQI A;  2EFI A;  1IHV A;  3A8H B;  3JCM W;  1RLQ C;  2LX7 A;  1UB4 A;  1C0M A;  1WFW A;  1VQL T;  2W10 A;  5J3B A;  4NL2 A;  4X1V A;  1ZSZ A;  1QVG P;  4J6Y A;  3M56 A;  5GJW B;  1ZSZ B;  1KD1 U;  3EG3 A;  2E12 A;  2EJF A;  3NFC A;  1D3B A;  4QVZ A;  4C5E A;  1D3B B;  4J9G A;  3URG A;  1I8F A;  2A08 A;  1VQ7 A;  3G71 Q;  1O75 A;  1N9R A;  2KGT A;  4XTU A;  2J6K A;  4QQG A;  3SDZ A;  2P4T A;  2PUK B;  3HHT B;  3SB2 A;  2EW3 A;  1G83 A;  2JMC A;  4FYV B;  5LJ5 j;  2KAF A;  4V2S A;  4L5G A;  5IHK A;  3MEA A;  2JN0 A;  1VQM T;  5GMK j;  2E64 A;  2C0T A;  4IIO A;  1U1T A;  3OB9 A;  1N8R U;  2Y90 A;  4J5Y A;  1D0Z A;  3THK A;  2KK4 A;  4EMH A;  1K8A R;  1PRM C;  3MP8 A;  4ORZ A;  2VXE A;  2OJ2 A;  1TUC A;  1XJW B;  1B7T A;  2CZ6 B;  2O9S A;  1CKB A;  1AHJ B;  4LDY A;  3G4S A;  5IXB A;  1U3O A;  1WQW A;  4N4G A;  1VQN Q;  2HBW A;  2RI5 A;  4B6M A;  1VQ8 A;  4KUI A;  3OYN A;  2R5M A;  3NTH A;  2COZ A;  4KT0 E;  3JSC A;  3CC2 T;  1YI2 Q;  2DL4 A;  1YHQ T;  2RJD A;  3PNW C;  1YIJ T;  2QQS A;  2X3X D;  2K3B A;  2PVD B;  2IG0 A;  1WLP B;  2EWN A;  5CQX A;  2KXC A;  3DLM A;  4J9C A;  2JNG A;  2HEQ A;  2X4X A;  1XNI A;  3MPU B;  4Y28 E;  2EQJ A;  2FZG B;  1W6X A;  1MUZ A;  1FMV A;  2LJ0 A;  2P4R A;  4EMG A;  2W0Z A;  3CC7 A;  4JRP A;  3CC4 A;  4C0D C;  2RQV A;  3CBP A;  2QA4 T;  2KT8 A;  3V8J A;  2D9T A;  4M7D C;  2A0F B;  1QVP A;  2MF2 A;  2YUN A;  2F2V A;  3CEY A;  1VQ5 Q;  4JPB W;  2HCK A;  2X4J A;  4M77 F;  2DJQ A;  2QDL A;  1VQP A;  1OQK A;  2YLC A;  1BCO A;  3CCU Q;  2KYM A;  5I22 A;  3JB9 H;  3VS6 A;  2QYZ A;  5I11 A;  2MWO A;  3NGP A;  3P8H A;  4BDZ A;  2C0I A;  5ECA A;  3CME T;  1K73 C;  1KG1 A;  3CCQ T;  1KHI A;  1KK7 A;  2MWP A;  1E6H A;  1ZSZ C;  2C0O A;  4JLG A;  4FW2 A;  3M0P A;  1PG5 B;  2LQN A;  1K9M C;  1WHL A;  2OTL Q;  1JXO A;  4M78 E;  4HVU A;  1M1G A;  3X25 B;  2OAW A;  2DL8 A;  5I2S A;  1H3H A;  2DIL A;  1ABQ A;  3PE0 A;  1VQ4 Q;  3QBY A;  4X34 A;  3JCM X;  3CCM A;  2RQU A;  4BI8 B;  1WXT A;  4FL6 A;  4JS5 A;  2K3X A;  2CDT A;  1KD1 R;  2CZ1 B;  4PJO C;  3I9Q A;  1N27 A;  1GBQ A;  1WXB A;  2J05 A;  1PWT A;  1QW1 A;  2QG9 B;  2XI9 A;  1M8M A;  1TSF A;  5KCO A;  1QVF S;  2ROT A;  1AWO A;  1ACM B;  2LMJ A;  2DE0 X;  4LN2 A;  4C8Q D;  4GLK A;  3CCJ T;  2RJF A;  2DXC A;  2K57 A;  4D8K A;  2XD0 A;  5C0M A;  2VWF A;  1MV3 A;  2RJE A;  1GRI A;  2GTJ A;  2HQE A;  2COW A;  2CSI A;  2KEA A;  3EFR A;  1TUD A;  4N4H A;  1SHF A;  4JRQ A;  1WJR A;  4C5H A;  1AD5 A;  5GMK m;  4C8Q F;  3LGF A;  2XK0 A;  2MCN A;  3LH5 A;  5CIU A;  4BE2 A;  3M0Q A;  1PSF A;  4JJC A;  5FU6 B;  3BDL A;  2NUT A;  3CCS A;  2QGG A;  1HYO A;  1IHW A;  3CPF A;  3I35 A;  3OSV A;  1JO8 A;  1YCY A;  1ZLM A;  2BZX A;  2K4Y A;  2BZ8 A;  5GMK e;  1VQ9 A;  3M54 A;  3OBY A;  3OW2 S;  1GFC A;  4PJN A;  3H41 A;  2CH4 A;  1HSQ A;  4JJD A;  3CMA T;  4M78 D;  4PJL A;  4C5I A;  1OZ2 A;  4A63 B;  4JRI A;  1D0X A;  5GAM g;  2G3R A;  3JB9 J;  3VS2 A;  2A7Y A;  2EGA A;  1VQ6 Q;  3PMT A;  2KYB A;  2EPD A;  2J6F A;  2FVU A;  3L2U A;  5HK3 A;  2EGE A;  2HKN A;  1NEG A;  1YJ9 Q;  1G3W A;  1N6A A;  4CI0 C;  3M9Q A;  1HD3 A;  2PNI A;  2DL3 A;  2YRD A;  2L2P A;  3OS1 A;  4M77 A;  4M77 B;  3QYG B;  1PSE A;  5KYW A;  3JCM b;  2CKK A;  1YIT A;  2M0O A;  3G71 T;  5KYW B;  2GQV A;  3FRN A;  2GF7 A;  1UG1 A;  2XG8 D;  1GBR A;  3EGU A;  5CKB A;  4Y92 A;  4OMQ A;  3G6E Q;  2ZPG B;  3TEE A;  4KH0 B;  4QQD A;  3A1P A;  3RMQ A;  4LUE A;  1W70 A;  2OX7 A;  3HKS A;  1NZ9 A;  4C0G A;  4FYW B;  3L2V A;  4IUV A;  2MOX A;  3OY9 A;  1ARK A;  2VVK A;  2NUZ A;  4DOV A;  5A0G A;  2ABL A;  1ZX6 A;  2DJZ A;  3C94 A;  3QWX X;  1D09 B;  1SSF A;  1XQH A;  1VQN T;  2F5K A;  2XDB A;  1NLP C;  1QKX A;  3HRT A;  2L89 A;  4FIB A;  4C0F A;  2EBP A;  4KRT A;  3I55 A;  2YSQ A;  4J6W A;  1YI2 T;  3DB4 A;  3QKJ A;  2KMT A;  4ESR A;  1KC8 C;  5CKH A;  2GQI A;  3NMZ C;  3V8K A;  3E9F A;  1K0S A;  1VQ7 Q;  1FWZ A;  3OS2 A;  3VS1 A;  3CPW P;  4BE0 A;  4MDW A;  4M7D F;  3RKW A;  5FU6 C;  4LDW A;  4PFO A;  2LJ3 A;  4AT1 B;  1BU1 A;  1LCK A;  4DBQ A;  4HKE A;  7AT1 B;  1M3C A;  1SPK A;  5D6W A;  1G5V A;  2KY9 A;  3BW1 A;  1X2K A;  5GAN 4;  2KDS A;  4E7S A;  1KQ2 A;  1KQ1 A;  1VQO A;  1NPR A;  1PRL C;  5GAO l;  2DMO A;  1HK9 A;  5LL6 S;  4X9D A;  3M4G A;  1AWJ A;  3QII A;  4C8Q B;  1N8R C;  3QO3 A;  1VQ5 T;  1RI0 A;  1X27 A;  1OUL A;  4PL6 A;  4F7U F;  3L2Q A;  4E47 A;  3ZL7 C;  3OYJ A;  3FJP A;  1QVG S;  1X69 A;  3DLL A;  3OS5 A;  4BY6 B;  3CCU T;  1KSW A;  4JUV A;  2CP3 A;  4C8Q G;  1LVK A;  3HSB A;  2X9H A;  2FO0 A;  2QDY B;  1WZO A;  2O01 E;  3I56 A;  5HK0 A;  1UFF A;  3OYY A;  1GXI E;  5KYN A;  1TXQ A;  1K1Z A;  1D1B A;  4LD6 A;  2ZCF B;  4BDY A;  2CP6 A;  1V76 A;  2MAM A;  3M59 A;  3A8L B;  4HVV A;  4M77 C;  5CKF A;  2OTL T;  5KE2 A;  5GAO p;  3PTA A;  1OYX A;  3V8L A;  3BY7 A;  3EG0 A;  1QCN A;  1YBY A;  2YRV A;  6AT1 B;  4PJO F;  1PKT A;  5EG2 A;  1VQ4 T;  1WGS A;  5GAM f;  3CC7 Q;  8ATC B;  4FW1 A;  4X9C A;  3CC4 Q;  4KGX B;  3HRU A;  5AYF A;  2I0N A;  1K8A U;  2O88 A;  2QQR A;  2AKL A;  2YLB A;  2GFU A;  2DD4 A;  3CCR A;  4DEY A;  2R58 A;  3L2W A;  4FYX B;  1ZBJ A;  5HCK A;  1SRL A;  1FMW A;  2E41 A;  3JCM g;  1MMG A;  1IGQ A;  2X3W D;  1V1C A;  4E7L A;  1U06 A;  4ATO A;  2AZV A;  3LWH A;  4ZGE B;  5CK9 A;  2CT4 A;  1XTD A;  4QVD A; 
#chains in the Genus database with same CATH homology
 3JCM d;  3GPL A;  2KK4 A;  1VQK A;  3RMS A;  5LJ3 h;  4D6W A;  2EIF A;  3QZ5 B;  3MO8 A;  2FL7 A;  4EMH A;  1KD1 C;  3HPW A;  3MP8 A;  1WPY A;  4IUT A;  2VXE A;  5J26 A;  1QP2 A;  2RHX A;  4IUR A;  2CZ6 B;  3CXC S;  5A0D A;  2K3Y A;  1AHJ B;  2WSE E;  1M4Z A;  3CMA A;  1YIT T;  4LDY A;  3G4S A;  1WQW A;  5FU7 B;  3MEW A;  4N4G A;  5GMK h;  3JB9 I;  2RH2 A;  5FU7 C;  1W2B S;  2RI5 A;  3EAE A;  1VQ5 A;  5CAI A;  1M8V A;  1VQ8 A;  4OGC A;  4BD3 A;  2EQK A;  4BB7 A;  2EQM A;  4KUI A;  3OYN A;  2DIQ A;  2R5M A;  3NTH A;  5FLX E;  2E6Z A;  3F70 A;  4IUQ A;  4KT0 E;  3JSC A;  4J6X A;  3CC2 T;  1N9S A;  1K8A C;  1M1K C;  1YHQ T;  2QQA A;  2RJD A;  3G7Z A;  3PNW C;  4IUP A;  5GMK l;  3CCU A;  1YIJ T;  2XID A;  2EJ9 A;  2QQS A;  4YTL A;  1UGS B;  2PVD B;  1Q81 U;  3QSU A;  4A53 A;  2IG0 A;  2EWN A;  5CQX A;  1K73 U;  2LT1 A;  4XAX B;  2HQX A;  3DLM A;  2DPP B;  2JNG A;  1EIF A;  4L59 A;  2GCX A;  1KHC A;  3LH0 A;  2RHZ A;  3RER A;  3NTK A;  4PLI A;  1NJI U;  3KBG A;  5GAN e;  2RI3 A;  1XNI A;  2RM4 A;  2VGM A;  2X4X A;  4Y28 E;  2QEX A;  2EQJ A;  1K9M U;  3OYK A;  3MET A;  2LCL A;  3OYI A;  5DY9 A;  2OTL A;  2M9U A;  3T9N A;  3TU4 K;  4EMG A;  4RKU E;  2L3R A;  3JAM E;  5GAM e;  3CC7 A;  4JRP A;  3S3M A;  1VQL A;  4LDX A;  2RI2 A;  4J8O A;  4M7A B;  4C0D B;  5GAO m;  4M7A C;  3G71 A;  4C0D C;  5LJ5 g;  3CC4 A;  3CBP A;  2LNV A;  2MI6 A;  3OSS C;  4F7U E;  1UGR B;  2QA4 T;  4M7D A;  1UGP B;  3V8J A;  2D9T A;  3PIP A;  3GLX A;  4RG8 A;  3OYC A;  4M7D B;  4M7D C;  1BI3 A;  1QVP A;  2MF2 A;  3X28 B;  5M9O A;  3OYL A;  4PJO D;  1VQ4 A;  1VQ6 T;  3CEY A;  2CYZ B;  4ELY C;  2L8D A;  2AHJ B;  3DKM A;  3I55 T;  5GAN g;  4M7A G;  2X4J A;  4B9X A;  3HL8 A;  3ASK A;  4M77 F;  4M77 E;  1YJ9 T;  2WSC E;  2CZ0 B;  5I21 A;  3OYB A;  3GOX A;  1G3Y A;  4XTZ A;  4OB1 B;  5IT9 E;  4WF2 A;  2DXT A;  1XOV A;  1VQP A;  3CCE A;  4M7D G;  3CBO A;  2YLC A;  1WQ7 A;  2QQB A;  4EMK C;  3JCM J;  4NS5 A;  3JCM h;  5CCA A;  3JB9 H;  1BIB A;  2QXF A;  2L5Q A;  2MWO A;  2DZC A;  2RJC A;  3P8H A;  5GAN d;  2FYK A;  4BDZ A;  3QYH B;  2DK3 A;  5HY6 A;  4BE1 A;  2GFA A;  1KQS S;  5KH6 A;  3CME T;  1WNL A;  2K2V A;  2ZPH B;  4OB3 B;  4C5G A;  4F7U A;  3CCS T;  1K73 C;  1KG1 A;  3UDC A;  4OMF B;  1ZQ1 A;  4C92 F;  4C92 E;  4F7U B;  5GAM d;  3CCQ T;  3CCV T;  1KHI A;  4M75 D;  4MZT A;  2MWP A;  4R55 A;  1VQM A;  2M1H A;  4A54 A;  4JLG A;  2A3L A;  1NJI C;  3NTI A;  1LNX A;  3L1A A;  1K9M C;  1Y7X A;  3EFS A;  5LJ3 f;  5DLO A;  5DM7 R;  3JCM Q;  3OYE A;  3GNF B;  4M78 F;  4M78 E;  5HKC A;  1VQO T;  4KUL A;  5J39 A;  5CQY A;  1M1G A;  4VUB A;  3X25 B;  3QXE B;  4IUU A;  2EKO A;  4QW2 A;  3P8D A;  4ZTF A;  5I2S A;  2JVV A;  5A2Q E;  2E10 A;  3G6E T;  1BIA A;  4RCB A;  3J81 E;  1YI2 A;  4PLL A;  3LX7 A;  4DA4 A;  1ZBX A;  3S3O A;  3QBY A;  2RHY A;  5D6X A;  2VC8 A;  4X34 A;  5GMK i;  3JCM X;  3CCM A;  1YJN T;  3CD6 T;  3HFO A;  5FRN A;  3A8G B;  4BI8 B;  1QVG A;  4C92 A;  3OBW A;  4QQ6 A;  4XU0 A;  4A4K A;  2DKG A;  4M75 F;  4M75 E;  3M57 A;  4EPC A;  4FL6 A;  3OA6 A;  2K3X A;  2E1H A;  4JS5 A;  3MP1 A;  3OMC A;  3JB9 D;  3CC2 A;  4CRI A;  3X26 B;  4PJO A;  5GAO q;  2CZ1 B;  4PJO B;  3R6O A;  4MZP A;  1YHQ A;  3UT1 A;  3VV0 A;  3I56 T;  3OYA A;  3J7A F;  4PJO C;  1N27 A;  1YIJ A;  1WJQ A;  5GAN 2;  5GAN 5;  1QW1 A;  2XI9 A;  2VUB A;  5FRO A;  3M4Y A;  2DVE A;  1VIE A;  4Z02 A;  5KCO A;  2M16 A;  4A4H A;  5GAN j;  1QVF S;  3MEU A;  1M1F A;  4RCC A;  2PQW A;  5GAN 3;  1S72 A;  4XTY A;  2EQU A;  5A0L A;  4FT2 A;  5GAM j;  4PJO G;  5LJ5 h;  3KUF A;  2CZ7 B;  4C8Q D;  1NE8 A;  4GLK A;  4P5N A;  3CCJ T;  3CCL T;  4OGE A;  2RJF A;  1Q86 U;  2QI2 A;  3QPH A;  4JJN K;  2DXC A;  2K57 A;  4M75 A;  4M75 B;  3JB9 F;  3PFS A;  2ZPE B;  4OP0 A;  3MEV A;  4OB0 B;  2QA4 A;  1OZ3 A;  4E7H A;  2LCC A;  4IKF A;  1UEB A;  1O9S A;  1VUB A;  1ZHI A;  5C0M A;  5FRM A;  2ZPF B;  2XD0 A;  3H8Z A;  2RJE A;  3J80 E;  1VQ7 T;  4OF1 A;  2HQE A;  3E1S A;  2OTJ T;  1VQ6 A;  3EFR A;  4N4H A;  1JBM A;  1G3T A;  2K5F A;  4JRQ A;  1WJR A;  3DB3 A;  4C5H A;  4ME7 A;  2DTI A;  4ZTJ A;  5IAY A;  1W4S A;  3JCM f;  4BI4 A;  3QDR B;  3CCR T;  1P92 A;  5GMK m;  4HCB A;  4A4F A;  2Y4X A;  4M77 D;  4C8Q F;  3LGF A;  2LX9 A;  4C8Q E;  2XK0 A;  2JUF A;  5GAO n;  3VJP A;  4BE2 A;  5CIU A;  1PSF A;  3LW5 E;  2LVM A;  5LJ3 e;  2PVG B;  5GAN 6;  5FU6 B;  3CME A;  3BDL A;  1JJ2 A;  3CCS A;  1JB0 E;  2VGN A;  3C12 A;  3CCQ A;  3CPF A;  3CPW A;  2DXB A;  3CCV A;  1YJW T;  1QP3 A;  3OSV A;  3QUI A;  2V8J A;  1YCY A;  3OYD A;  1FX7 A;  4C92 D;  2R57 A;  4HCC A;  2PVO B;  2K4Y A;  5GMK e;  1VQ9 A;  3M54 A;  2HNI A;  1BI1 A;  3OBY A;  3OW2 S;  3MCA B;  4JRK A;  3HRS A;  1Q86 C;  2XDD A;  4LD9 K;  3CXC A;  2E65 A;  2I2L A;  3S3N A;  3CMA T;  3QJ6 A;  4M78 D;  4C5I A;  4C8Q A;  1I5L A;  1OZ2 A;  3G6E A;  3A8O B;  5LJ3 g;  1W2B A;  3OYG A;  4JRI A;  2MMP A;  3V7R A;  3OMG A;  2G3R A;  2YHT A;  5GAM g;  4LDU A;  3JB9 J;  2R5A A;  2D6F A;  5GAN 8;  2A7Y A;  2HD0 A;  5GAO r;  2XIC A;  2C06 A;  3FEO A;  4MDX A;  2K5L A;  3PMT A;  4XTX A;  1I4K 1;  3BFM A;  4UC4 A;  3VYG A;  3AHU A;  4ZN3 A;  2FVU A;  3QJY A;  3JCM c;  3L2U A;  3LWI A;  1B34 A;  4O6J A;  5LJ3 d;  2E5Q A;  5HK3 A;  1Q7Y C;  1Q82 C;  1B34 B;  2EJG A;  2P0K A;  4KUD K;  1Y96 A;  1G3W A;  1N6A A;  4CI0 C;  1Y96 B;  3A5Z B;  1M5Q 1;  3L42 A;  3M9Q A;  3S6W A;  4J83 A;  2WSF E;  3SWN A;  2XDP A;  3E19 A;  3UPU A;  3MHX A;  3SWN B;  4J7F A;  3ZEH A;  4BAC A;  3SWN C;  2X4W A;  3M58 A;  3OS0 A;  4PKC C;  3OS1 A;  4N0A A;  4M77 A;  5LJ5 f;  2QEX T;  3PT9 A;  4M77 B;  4N0A C;  3OYH A;  4F7U G;  3QYG B;  2ZPI B;  3PGG A;  1PSE A;  2RK1 A;  4DQ2 A;  3CCJ A;  4Q5W A;  2CKK A;  2F69 A;  2K5I A;  2M0O A;  4J5Y A;  1FXX A;  4MML A;  3JCM b;  2GQV A;  3G71 T;  3GIB A;  3FRN A;  4RG2 A;  1MGQ A;  1RL2 A;  2GF7 A;  5GAN f;  1DJ7 B;  5I2M A;  3FLG A;  2XG8 D;  4FU6 A;  3ER0 A;  2EYQ A;  5CKB A;  4XU3 A;  3OYF A;  1KC8 U;  1BI2 A;  2RB6 A;  4C92 B;  3JCM e;  1YIT A;  2DTH A;  4C92 C;  5KE3 A;  2ZPG B;  3TEE A;  4LDV A;  2P0P A;  2JTM A;  3N5B B;  5CO7 A;  4QQD A;  3VYH B;  4ZGD B;  2QTX A;  1BKB A;  1X75 C;  2DIG A;  2DTO A;  2ZGW A;  2LC4 A;  2DXU A;  4XQ3 A;  4TVR A;  3Q1J A;  3RMQ A;  4M78 A;  3O8V A;  3BDU A;  4M78 B;  3RIR A;  2VV5 A;  2H3J A;  3TCJ A;  2X4Y A;  1LJO A;  4M78 C;  4Y91 A;  3CCE T;  4J7I A;  3HKS A;  2QQ9 A;  4C92 G;  1NZ9 A;  4R56 A;  4C0G A;  5LJ3 j;  5CR2 A;  1Y71 A;  1X6O A;  1U8R A;  3CBM A;  3L2V A;  4IUV A;  1V29 B;  2BIV A;  3OY9 A;  1KQS A;  1JRI A;  2RD1 A;  2P0Q A;  4M7A D;  2Y4Y A;  4MMK A;  4PNO A;  3KXT A;  4DOV A;  1Y07 A;  4M78 G;  5A0G A;  3SD4 A;  4FT4 A;  4C0Z A;  1OI1 A;  3CPW S;  2DJZ A;  1IZ6 A;  2X35 A;  2XHC A;  1SSF A;  3C94 A;  3GNG A;  1XQH A;  4M75 C;  3GP8 A;  4XU2 A;  3VKI A;  4BI3 A;  5GAN h;  4DOW A;  1VQN T;  2PUO B;  2F5K A;  4MZM A;  3RKX A;  2XDB A;  3CCL A;  2LTO A;  3WXM B;  3HRT A;  2L89 A;  4FIB A;  3RES A;  3V7C A;  4C0F A;  3LGL A;  5IN1 A;  5GAM h;  3P8B B;  3PMI A;  1M90 C;  4BUG A;  1R8O B;  3ZBD A;  3MP6 A;  3I55 A;  4HA8 A;  2DZ9 A;  4J6W A;  1YI2 T;  4NOY A;  1Q7Y U;  4ELZ C;  3DB4 A;  3QKJ A;  4L6V 5;  1Q82 U;  2KMT A;  4M75 G;  3QHS A;  1KC8 C;  1YJ9 A;  5CKH A;  2D0Q B;  2DD5 A;  3CCM T;  5GAN 7;  3V8K A;  5CVI A;  3E9F A;  4RMO A;  2IVW A;  3UWN A;  3X20 B;  2DO3 A;  2LDM A;  3QG1 A;  1FWZ A;  2F5T X;  2PU9 B;  3JCM P;  4M7A E;  3OS2 A;  4M7A F;  3VU3 C;  4N4I A;  1UGQ B;  4BE0 A;  4MDW A;  3E9G A;  4JLI A;  4M7D F;  4M7D E;  3PIO A;  2RK2 A;  3RKW A;  5LJ5 e;  5FU6 C;  4LDW A;  1X01 A;  2HBP A;  2RA2 A;  3FC3 A;  3FB9 A;  3HFN A;  4HT8 A;  4HKE A;  4II1 A;  3C4S A;  1QVF A;  2DAQ A;  2RHI A;  5D6W A;  1VQK T;  1G5V A;  2KY9 A;  3BW1 A;  5CKD A;  1S72 T;  2HAX A;  5GAN 4;  2KDS A;  4O5V A;  3OQ5 A;  1KQ2 A;  3RUX A;  1KQ1 A;  4XK8 E;  1VQO A;  1NPR A;  3INZ A;  2ZZD A;  5GAO l;  1HK9 A;  2CS7 A;  3JB9 G;  5LL6 S;  4X9D A;  3M4G A;  3G4S T;  3M55 A;  1G3S A;  3C95 A;  3QII A;  3HP9 A;  4C8Q B;  1N8R C;  4M7A A;  4C8Q C;  3QZ9 B;  3QO3 A;  2V8K A;  3TRE A;  1VQ5 T;  1RI0 A;  1VQ8 T;  1LOJ A;  4PL6 A;  2O4X A;  4F7U F;  2FHD A;  3L2Q A;  4E47 A;  2O4X B;  4GY5 A;  1YJN A;  3CD6 A;  2BUD A;  1I81 A;  1YJW A;  1H64 1;  2JOY A;  3FJP A;  3OYJ A;  1BYM A;  1BI0 A;  3A8M B;  3H6Z A;  3M5A A;  5KCH A;  3OS5 A;  3WVE B;  4BY6 B;  3DLL A;  3L2Z A;  2JZ2 A;  4KBM B;  3V7S A;  1HXD A;  4JUV A;  2JTF A;  3VUZ A;  4BY6 C;  3JCM V;  3L2R A;  3CCU T;  5LJ5 d;  4C8Q G;  3GF5 A;  3HSB A;  2EFI A;  2QDY B;  2O01 E;  3I56 A;  2ZPB B;  5HK0 A;  3X24 B;  3A8H B;  3OYY A;  1GXI E;  3JCM W;  2VXF A;  4FM4 B;  4EMK A;  1H3Z A;  2XKO C;  1QVG S;  4EMK B;  3FIF A;  4XTW A;  4LD6 A;  2ZCF B;  1UB4 A;  2LT4 A;  4BDY A;  5CKF A;  2MAM A;  3M59 A;  2BKD N;  3A8L B;  4M77 C;  2OTL T;  5KE2 A;  1Q81 C;  2WAC A;  5D6Y A;  5GAO p;  3PTA A;  1VQL T;  3CC7 T;  1OYX A;  5J3B A;  3BY7 A;  3V8L A;  4NL2 A;  5L8R E;  4OB2 B;  4B9W A;  2DEQ A;  1TH7 A;  4J6Y A;  3M56 A;  3CC4 T;  1KD1 U;  1M90 U;  2E12 A;  1MHN A;  1YBY A;  2YRV A;  1M9S A;  2EJF A;  4HCZ A;  2E70 A;  4PJO F;  3NFC A;  4PJO E;  4JDS A;  5DLQ E;  1VQ9 T;  1D3B A;  3M53 A;  2LQ8 A;  3FDR A;  4QVZ A;  4C5E A;  4JS4 A;  1D3B B;  3URG A;  3OW2 A;  4M77 G;  2V8I A;  1I8F A;  5EG2 A;  1VQ4 T;  3VUB A;  1WGS A;  5GAM f;  4OVA A;  2E6N A;  3LLR A;  1VQN A;  5C6S A;  2FB7 A;  2NLU A;  4E7K A;  1VQ7 A;  4HT9 A;  4X9C A;  1O75 A;  1N9R A;  2XU8 A;  3HRU A;  2RHU A;  5AYF A;  4NL3 A;  2OTJ A;  4EDU A;  2EAY A;  4XTU A;  1NPP A;  4QQG A;  2CGH A;  1K8A U;  5CKE A;  2QQR A;  1U1S A;  3RKY A;  4ZN1 A;  4E7J A;  1M1K U;  3SDZ A;  2OAU A;  1VQP T;  2YLB A;  2GFU A;  2P4T A;  3LYI A;  2DD4 A;  2B8A A;  2PUK B;  3HHT B;  3CCR A;  2R58 A;  2KSS A;  4FSX A;  3SB2 A;  3L2W A;  2LRQ A;  4QVC A;  2LQK A;  5LJ5 j;  1IRE B;  2KAF A;  3ZFJ A;  4V2S A;  2KQW A;  4L5G A;  3MEA A;  3ME9 A;  2E41 A;  2RO0 A;  3JCM g;  1WJS A;  2JN0 A;  4ZGJ B;  1VQM T;  1VIF A;  5GMK j;  4E7I A;  4QVD A;  4E7L A;  1JJ2 S;  4ATO A;  3JRZ A;  2E64 A;  4XTV A;  4M7D D;  1U1T A;  3LWH A;  3OB9 A;  4A4G A;  4ZGE B;  5CK9 A;  3SFM A;  2VYT A;  1N8R U;  3WVD B;  2KVQ G;  1XTD A;  2Y90 A;  4XU1 A;  4A4E A;  3OYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...