2M0PA

Solution structure of the tenth complement type repeat of human megalin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
46
structure length
46
Chain Sequence
THAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDEKNCNSTET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Gentamicin binds to the megalin receptor as a competitive inhibitor using the common ligand binding motif of complement type repeats: insight from the nmr structure of the 10th complement type repeat domain alone and in complex with gentamicin.
pubmed doi rcsb
molecule keywords Low-density lipoprotein receptor-related protein 2
molecule tags Lipid binding protein
source organism Homo sapiens
total genus 9
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 2m0pA00
1XFEA 2M7PA 1J8EA 2M96A 1D2JA 1D2LA 1LDLA 1LDRA 1K7BA 2LGPA 2FYJA 2I1PA 1F5YA 1N7DA 2JM4A 1CR8A 2KNXA 2FYLB 2M0PA 2KNYA 1JRFA 2FCWB
chains in the Genus database with same CATH superfamily
1XFEA 2M7PA 1J8EA 2M96A 1D2JA 1D2LA 1LDLA 1LDRA 1K7BA 2LGPA 2FYJA 2I1PA 1F5YA 1N7DA 2JM4A 1CR8A 2KNXA 2FYLB 2M0PA 2KNYA 1JRFA 2FCWB
chains in the Genus database with same CATH topology
1XFEA 2M7PA 1J8EA 2M96A 1D2JA 1D2LA 1LDLA 1LDRA 1K7BA 2LGPA 2FYJA 2I1PA 1F5YA 1N7DA 2JM4A 1CR8A 2KNXA 2FYLB 2M0PA 2KNYA 1JRFA 2FCWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFE A;  2M7P A;  1J8E A;  2M96 A;  1D2J A;  1D2L A;  1LDL A;  1LDR A;  1K7B A;  2LGP A;  2FYJ A;  2I1P A;  1F5Y A;  1N7D A;  2JM4 A;  1CR8 A;  2KNX A;  2FYL B;  2M0P A;  2KNY A;  1JRF A;  2FCW B; 
#chains in the Genus database with same CATH topology
 1XFE A;  2M7P A;  1J8E A;  2M96 A;  1D2J A;  1D2L A;  1LDL A;  1LDR A;  1K7B A;  2LGP A;  2FYJ A;  2I1P A;  1F5Y A;  1N7D A;  2JM4 A;  1CR8 A;  2KNX A;  2FYL B;  2M0P A;  2KNY A;  1JRF A;  2FCW B; 
#chains in the Genus database with same CATH homology
 1XFE A;  2M7P A;  1J8E A;  2M96 A;  1D2J A;  1D2L A;  1LDL A;  1LDR A;  1K7B A;  2LGP A;  2FYJ A;  2I1P A;  1F5Y A;  1N7D A;  2JM4 A;  1CR8 A;  2KNX A;  2FYL B;  2M0P A;  2KNY A;  1JRF A;  2FCW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...