2M0XA

Solution structure of u14ub1, an engineered ubiquitin variant with increased affinity for usp14
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
76
structure length
76
Chain Sequence
MQIFVKGLTGKTTTLEVEPSDTIENVKAKIQDKTGLPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHIVWRLRGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords engineered ubiquitin variant
publication title Conformational dynamics control ubiquitin-deubiquitinase interactions and influence in vivo signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags De novo protein
total genus 9
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2012-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2m0xA00
4DHZE 5BO4B 4KV2A 2LVPA 2O6VD 3JVZX 3PZDA 4DHZB 2BYEA 2L00B 4RM9A 2LXCA 2DZKA 1WZ3A 1YD8U 4WJPA 5CTRC 1C3TA 1JRUA 3DVGX 4GOCA 1UELA 4MSMB 3U8ZA 1ISNA 1ZGUB 2O2VB 1OEYA 3MHSD 4GDKB 1R4NI 4MJSB 5EDSA 4ZRJA 1EF5A 1A5RA 4RMAA 3A4RA 2BKRB 2L05A 3IVFA 4HDOA 2DYMA 3SD5A 2DX5B 4DWFA 3M3JA 3Q3JA 4FA6A 3AU4A 1E8WA 2J0KA 1WE6A 3VHTC 1TZ1A 2UYZB 1YX6B 3SU8X 2G4SA 2C7NB 3APCA 1VD2A 2KJRA 2KLGA 3DDCB 2N9PC 2WX1A 3TIXA 4LJPB 3WANA 3CSTA 3OLMD 4URKA 4A3PA 1NDDA 3B0AA 3ML9A 4FULA 2CR5A 1WR1A 3ZDTA 2ZPYA 3UF8A 2NPTB 4BFRA 4IC7B 5L83A 4NQLB 1GG3A 3N32A 2XK5A 1E8ZA 2NBWB 3PV1A 4TQ1A 5D7GA 4I6LB 2N7EA 2J7QB 1RLFA 4E74A 4GDLB 2KJ6A 3QA8A 1NI2A 5GMVA 1WGDA 2A5UA 2AEHA 2DAJA 1H8CA 2FUHB 4ICUA 3NZUA 2AWTA 3DVGY 1E90A 3PVLA 1WGRA 2HTHA 3JW0X 3VUWA 4IM2A 3PPAA 2FIFA 4WQOB 1L2NA 1EF1A 1V6EA 3UQAA 3VH3B 3RUIB 4MDKE 4PYZA 2KTRA 1MG8A 1YQBA 3A1QA 1E5WA 3H1UA 1GC6A 3AI5A 3VUXA 5E6OA 3L17A 3QX1A 3M95A 4K81A 3APFA 3H9DA 2MQJA 4AWJA 2RPQA 5G55A 1WH3A 2CS4A 3KW5B 2KC2A 2V1YA 2NBVB 4GB9A 2DYBA 1IYFA 1WGYA 1WX8A 2O2VA 4EZLA 3B1LX 2D3GA 2D11A 4GDKA 3ZIMA 4MJSA 2EKEC 3BY4B 1UGMA 3ONSA 4FBJB 1P98A 3JYUA 4M8MA 2ZVOA 2Z59B 2XEWA 2K6QA 2KQSA 2KXJA 3R3MA 3KVFB 3WA0A 2KTFA 3WAOA 3LJ3A 4KSKC 4PS7A 3B08A 4ZRKA 1E7UA 5C1ZA 2EMTA 2BYVE 3KH0A 4G50A 3JSVB 4MELA 3AULA 4A20A 2NBUA 2CKHB 3PREA 4II2B 2G3QB 3PTFC 3O65B 1WJUA 2JRHA 3CSFA 4HDQA 2PJHA 2MW5A 2V3SA 2LZ6A 2VRRB 4LDTD 2KWCA 1V9JA 2ZEQA 2LASA 2LRWA 3RZFA 1FXTB 3DBSA 2KD0A 1Q0WB 5JZEB 2KMCA 2NPTA 2M0XA 1SGHA 2LUEA 3WIMA 3PLVA 5JHBA 3IBEA 3AU5A 3UIPB 2BGFA 5FR6A 2I1KA 1P9DU 2N7DA 4IM0A 2K25A 1WJ4A 2MBHA 4K7UA 4M0WB 3UIOB 3GZNI 4GDLA 4KZ0A 1Y8RC 2MA9B 4FJYA 2KDEB 3X23A 2AL6A 2MBBB 4NJ7A 2LJ5A 1UH6A 2AYOB 3OAWA 2KNBA 2V4LA 4F8CB 2IO1B 3R7QA 4ANUA 2L0TA 2OOBB 3QK0A 4ICVA 2KFKB 3VTWA 3PHWB 4GSWA 3VUYA 1D3ZA 2ZCBA 1I35A 4DHJB 1WGHA 3KUCB 4AP4C 4ANVA 3T8MA 4W9HA 1IP9A 5D6JB 5J18A 2DAFA 4I6PA 1GUAB 2ZNVB 1YJ1A 3ZO5B 4CO7A 5JH5C 3P2BA 2HJ8A 2JXXA 3QC8B 2ZVNA 4W9CA 2W9NA 1KOTA 3HM3A 4BVUC 5AEKB 4ASWC 1WXAA 4BKSA 1GJZA 4HVBA 2DENB 2DZIA 1QZEA 3N3KB 5D94A 4GU2A 2LGDA 4RM8A 1L7YA 3H7SA 3PSEB 1NBFC 4AJWA 2MP2B 3PGEA 4FLHA 5J2RA 4W9FA 1WR6E 1SIFA 4J6IA 4B95A 1BT0A 4XC2A 2ZJDA 3DVNU 4HJKA 2D2QA 2NVUI 2MBOA 2J0JA 3D32A 1LXDA 3JSVA 4IWPA 3I3TB 3TCAA 2BWES 1H4RA 1P3QU 1WX7A 2IO3B 2KZRA 3EHVA 3OJ3A 2BWFA 3QQ8B 2K1FA 2PEAA 4MGKE 4B6WA 1UBQA 1IPGA 1Z2MA 3MTNB 2K8HA 3TMPB 1XD3B 2IZVB 4W9KA 2C7MB 3WAMA 4K7SA 3QHTA 2Y5BB 2KOXA 3NOBA 1WXMA 2ZCCA 1TTNA 3V62A 3AXCA 3NHEB 2KX3A 3V6CB 1S1QB 4GGQA 1HE8A 1F9JA 1WZ0A 2FCMA 2GBMA 4HWIB 2WX0A 4IWOA 2RGFA 5AZGA 4KVGB 4WJOA 3GOEA 3TJPA 3PS6A 4EZJA 3M63B 3VFKA 1AARA 4MGZE 2DZMA 1U4AA 2M8SA 1J8CA 2D07B 4HCPB 2GOWA 2FNJB 4TUUA 4NPNA 3DOWA 3EECA 1RRBA 1V5OA 2KX0A 2MBQA 4GMVA 2LVQA 2L3ZA 2IO0B 3HIZA 4CYEA 2JVCA 2KFKA 2FCQA 3ZUNA 3K9OB 2LGYA 4W9EA 4BOZB 4KSLC 2N1VA 2KWVB 3V6EB 2PPHA 2RD0A 3IHPC 3UQBA 4BKSD 4F7ZA 4BBNF 2CHXA 2KWUB 1ZKHA 4M8NA 3HK0A 2KN5A 4GIVA 1OTRB 5E6NA 2YLMA 4ZRIA 3VAWA 1CMXB 2GBKA 3NY5A 4OVUA 4W9IA 2LVOA 2GBJA 4W9DA 4AJYB 1C1YB 3A9JB 2N4FA 2FCNA 3TL5A 2EMSA 2JZ3B 2KDFB 4IM3A 2K39A 5IA7A 5LLIA 2BF8B 2MP2A 4N9F4 3VXWA 2KO3A 2NCNA 2FCSA 1UD7A 3ENEA 2KVRA 2ZNVC 5DPWA 3L0WB 1WJNA 4XZ4A 2UWQA 4NNJB 2WDTB 2LXAA 3ZKJC 2BKFA 3RZWC 1Q5WB 2JF5A 4TKNA 2KDIA 1V49A 2G45B 2CHWA 2KFJA 2N9EB 2PE9A 4NAWB 5LXIB 2KANA 3WALA 4A3OA 4MGYE 3RD2A 3VQIA 5D2MB 2MX2A 2KHWB 3K9PB 4JGHB 1K8RB 3QJZA 4BKTA 2NR2A 5KHQA 1XT9B 3ZNHB 3KUDB 3QARA 1WXSA 3V61A 1XQQA 4JL9A 2A4ZA 3ZNID 2GBRA 3DQVA 3VH4B 4HCNB 2IY0B 2ZPNA 2MCNB 3DPDA 4DBGA 2KQ7A 3R7RA 1LQBA 3V60A 1P0RA 1V2YA 3T9LA 1WMHB 1J0GA 3KYDD 2HD5B 3KYCD 4K7WA 3W1SA 3W1YA 2QHOA 1V5TA 3A9KB 3C0RB 2L0FA 3L08A 2FIDA 2K8BA 3ZNGC 3OJ4B 4WJQA 3UINB 2JZZA 4PS8A 5CX3A 1P1AA 2MLBA 2O6VB 3TBLD 3A33B 2GMIC 1RAXA 4JQWC 2G4DB 2C60A 3ZTCA 2I1JA 4CHKA 4EFOA 3H7PB 3NZSA 3DVNV 1T0YA 3VDZA 1ZW7A 3ZLZA 1E7VA 1WY8A 2LRUA 2RR9A 4MGIE 2GBNA 3VTUA 4NJ6A 4HXDA 2L7RA 2L76A 2RSUA 3U7DA 3IG3A 3W1SC 4TV3A 4DK5A 1VCBA 4P7IA 4XX5A 2B3AA 2FAZA 2JT4B 3DBLI 3ZNZB 4FN2A 1UZXB 2JWZA 4TQ0A 3UGBB 3RT3B 1LFDA 4IWQA 4DDGD 2HE7A 4KIKB 2MWSB 3A9JA 1WGGA 4NY0A 1M94A 4PYUA 1X1MA 5HKHA 1OEYJ 2NS5A 3PLUA 4KZCA 5IAAC 3PT2B 1YX5B 2K8CA 3ZW3A 4WAAA 1SE9A 3NS8A 1E8YA 3APDA 3PHXB 2BYFA 3KUZA 1WJ6A 3HM6X 4BBNC 3CF6E 2PE6B 3QAQA 4DXAB 4W9JA 4NAWA 4MSQB 3DCGA 1EUVB 3X0WA 2KDBA 3EC8A 5G2NA 3VVWB 4HK2A 2C9WB 4E3CA 4MH0E 3L16A 4HPMB 4KDIC 3DBRI 2JPHA 4B9KA 4OVVA 3PRZA 4F1SA 5CHFA 3ML8A 4WWOA 2JY6A 2Z0EB 1WXVA 4LCDE 1S3SG 2KMAA 2N1WA 3ZVVA 4GN1A 4FHKA 3Q3FA 2XBBC 1KM7A 4MEMA 4EOYA 5TR5A 5DPRA 3RCZA 3HHMA 1WYWB 1WMHA 1WF9A 1GC7A 4AUQC 4W9LA 3A9KA 2MRPA 2MBEA 1G6JA 1TBEA 2R2OA 2M4NA 1WM2A 2DHZA 3M62B 4G0NB 2KC1A 2AL3A 3L10B 5KHOA 3A4SC 3ZRFA 5J17A 4KDLB 2O6VA 4ANXA 3QCAA 2K6DB 3CMMB 2DYOA 4NQKE 2DZJA 5DPTA 2M17A 5AZHA 5CHVC 2CHZA 3H7PA 3L13A 4EEWA 5LXHA 1WI0A 2BPSA 2KK8A 1V81A 3QIJA 3SHQA 3ZTDA 3BINA 3ALBA 4FHJA 4AOFA 1R4MI 4FJZA 4ZDVA 3QWZB 4JLCA 1RFAA 3RULA 4WWPA 4PS3A 4IUMB 1E8XA 4K1RB 2N9XA 4WJNA 3N30A 2REXA 4YL8A 1EO6A 1WM3A 3R66C 4G3XB 1KLVA 3WAPA 2L8JA 4WWNA 1WFYA 2KJHB 4KIKA 4ANWA 2ZZPB 2J0MA 2WWZA 5DCNA 4LJOB 4W9GA 1PQSA 2OJRA 2C7HA 2IYDB 3U30A 3PRMB 1I42A 4I6NB 1WE7A 3PRPB 4IG7B 3LDZE 3DBHI 2LGXA 5DPSA 4EUTA 2Z0DB 4FJVB 2IBIB 1Q1OA 3H6NA 3ZRCA 3MJWA 4EKUA 3L54A 1WX9A 4LDTB 1Z5SB 2D10A 2IO2B 4E71A 4G11A 2YVCA 2LD9A 1YIWA 2LWPA 1GNUA 2MSED 2XK5B 4EZKA 5JHAA 5E6PA 1WIAA 4II3B 3S2AA 5L95C 4BOSC 2KKCA 3ZDMC 4IW0A 2C5LC 2KLCA 4FADA 4DDID 1OGWA 2LI5A 1V86A 1OQYA 4HPLB 3EFUA 3SDLC 3ECIA 4X57B 3VTVA 1J19A 2R2QA 4GXBA 2JUOA 2IY1B 5CHWA 3RYTA 1V80A 4ZYNA 1UBIA 2ASQA 4DHJD 3IFWB 4HLEA 4BKGA 5C23A 2CU1A 4JIOU 4MM3A 1TGZB 1LM8B 1KJTA 5AZFA 2M1MA 2WYQA 2JRIB 1WRDB 2KTRB 3A1QB
chains in the Genus database with same CATH superfamily
4KV2A 2G9HD 2LVPA 2BYEA 1ZXHA 1YD8U 2WS3B 1XO3A 1FEHA 1C4AA 3FKYA 1UELA 4MSMB 1B1ZA 3U8ZA 2O2VB 1E10A 1C4CA 1R4NI 2KT7A 3V3XA 2JX5A 4RMAA 2XN9C 1UGJA 3A4RA 2BKRB 2L05A 1SE2A 2PVGC 3M3JA 1E8WA 1GAQB 1TZ1A 4B0MA 1YX6B 2G4SA 2D3AA 4C7YA 1VD2A 3DDCB 4MACA 2N9PC 3AM9A 4A3PA 1NDDA 4DXFA 2PKOA 2QJLA 3ML9A 3ZDTA 1WR1A 5H8YE 2ZPYA 2NBWB 2B76B 1XLOA 1I4XA 4HPPA 2DAJA 2PLPA 4ICUA 2AWTA 1YMHE 1D6EC 3PVLA 3VUWA 5BMIA 3PPAA 1EF1A 2WXPA 3RUIB 2XNAC 4RGTA 1EU3A 5D3IB 2KTRA 3H1UA 5C2TB 3AI5A 3VUXA 5E6OA 3C19A 3DHGC 3H9DA 2GRIA 2RPQA 1NEKB 5G55A 1D5ZC 2NBVB 1C77A 4GB9A 3DBHB 3AN1A 2OHFA 1EWYC 3UI3A 4MJSA 2EKEC 3B2GA 3BY4B 1TS3A 3MC9A 4NJCA 3TSSA 3WA0A 4KGRA 4KSKC 4ZRKA 2EMTA 3AULA 4II2B 2ZW1A 1GOZA 3AE2B 4LNNA 3CSFA 4LLGM 1N62A 2DWQA 3LYYA 2V3SA 2VRRB 3FC4A 2KWCA 2ZEQA 2LASA 2W82A 1FXTB 1Q0WB 1VLBA 2NPTA 2M0XA 1GPXA 4YSZB 5JHBA 3AU5A 3FILA 2I1KA 1PUTA 2N7DA 3EFCA 4IM0A 1WJ4A 1XLPA 4M0WB 1ZPSA 2H89B 1Y8RC 2AL6A 2ICIA 2LJ5A 1TJEA 2KNBA 2IO1B 3R7QA 3NS1A 3RNAC 2V3NA 2TSSA 1FCLA 3VR8B 3ZJTA 2ZCBA 1WGHA 3T8MA 5D6JB 2DAFA 3W5VB 2SEBD 3RNBC 3ZO5B 1JMLA 4W9CA 3C8YA 4BVUC 1WXAA 2G1EA 1QZEA 1WGKA 4WH4A 1NBFC 1V1PB 1Q10A 2MP2B 3PGEA 4WURA 1MVKA 1SIFA 4XC2A 3AMZA 3WCQA 1F77A 3D32A 1I4HA 1N61A 2BWES 1H4RA 2BW2A 1D5XC 2BQQA 4MGKE 1UBQA 2WU5B 4BAXA 2R61A 3KWVA 2M19A 2YEPB 3EA6A 3AXCA 3NHEB 3AEEB 1AN8A 3V6CB 4DXGA 2OEDA 2GBMA 1HZ6A 4WJOA 3PS6A 4EZJA 5G5HA 2X8XX 3VTVA 2J4XA 3EECA 1V5OA 2KX0A 2MBQA 1QKZA 3HVDA 4PT5A 4A6QA 3P63A 2JVCA 2KFKA 1VZ8A 1GB1A 1YN3A 3KLSX 2LGYA 2N1VA 4O1NA 1EWCA 1EM7A 2MH7A 2QMTA 4RF0A 4BKSD 1OTRB 3RNEC 4RCOA 3BWUD 2QCZA 4LTUA 1NENB 2JZ3B 1AWDA 4ZOHC 5LLIA 2FCSA 4S17A 2KVRA 3IAM1 4C7ZA 2UWQA 2WDTB 3GZNB 4A9AA 2CHWA 2KANA 4A3OA 5BYRA 1L0VB 4RNAA 1K8RB 1XT9B 2FE8A 1SJED 3KUDB 1ENFA 4P16A 3V61A 3ZNID 1FXIA 1LQBA 1WMHB 4N6EB 3BK1A 2L0FA 2FIDA 3ZNGC 3OJ4B 2QILA 2W3SA 4LNOA 2J42A 2O6VB 3A33B 2PVOD 2I1JA 3H7PB 2PMVA 3VTUA 2D5GA 3W1SC 2KQ4X 4DK5A 1VCBA 2B3AA 2FAZA 2JT4B 3DBLI 1ACCA 2JWZA 3RN9C 4TQ0A 3UGBB 3RT3B 3I57A 5HKHA 3PLUA 3PT2B 3RNFC 4KKIA 4A90A 1SE9A 2BYFA 3KUZA 1PGXA 1WJ6A 2Y5CA 4BBNC 3CF6E 4DXAB 3VVWB 4E3CA 3EUB2 4LNIA 1I7HA 2JPHA 4B9KA 1QT9A 4OVVA 4F1SA 2VH1A 1WXVA 1WWTA 4LCDE 1S3SG 1MFWA 1KM7A 3AE9B 4UDUC 1GC7A 4AUQC 3I5JC 3A9KA 2MBEA 1TBEA 3Q8AA 1WM2A 2MJ3A 4G0NB 3ZRFA 4ANXA 4NQKE 2DZJA 1WI0A 2BPSA 3SHQA 4KGSA 1R4MI 2BTEA 4RFBA 1XXGA 1J7CA 3RULA 1BUIC 3N30A 2REXA 4YL8A 1WM3A 4G3XB 1VDVA 2L8JA 4WWNA 2ZW0A 4W9GA 2C7HA 3PRMB 1YJIA 1YJJA 4I6NB 1WE7A 1MG4A 1YN5A 4FJVB 2IBIB 2D10A 2IO2B 4E71A 2LD9A 5E6PA 1WIAA 4II3B 3S2AA 2IGDA 2KKCA 3RFZB 4RF1A 3NRZA 1PGAA 3KWLA 4X57B 3ZGZA 3Q3MC 2EKIA 1N6ZA 3LXFA 3RYTA 1V80A 3TEYA 4MM3A 1KJTA 2FBWB 5AZFA 2JRIB 4JE3B 3DVGX 2KTRB 1RWSA 2O6VD 3PZDA 2L00B 2L83A 2LXCA 2WXGA 1WZ3A 5EE1A 2ACZB 1C3TA 4GOCA 1XEEA 4OVZA 3AEFB 1ISNA 3MHSD 3IT6B 4MJSB 1A5RA 1EF5A 2SAKA 4HDOA 1F52A 1T0SC 2KN4A 3Q3JA 2N7JA 3DBRB 3GE8C 2UYZB 2W55A 4ZRQA 2C7NB 2KJRA 2KLGA 3TIXA 2WX1A 4LJPB 3CSTA 3B0AA 4J3OD 3PZ7A 4FULA 1F0ZA 2WXRA 2FUG1 2NPTB 4BFRA 4IC7B 4JPSA 4ZRPA 4NQLB 3AE4B 3FILB 4TQ1A 3PV1A 1P7FA 1RLFA 1D5MC 1J7BA 1NI2A 5GMVA 1WGDA 5EE0A 1C9FA 2WGSA 4XYCA 2FUHB 2I2YA 4WWMA 1WGRA 3JW0X 4IM2A 4WQOB 2FIFA 1L2NA 4PYZA 1MG8A 3R2TA 1E5WA 3M95A 1I4GA 3AEGB 4AWJA 4YTMB 1PFDA 1WH3A 2CS4A 1IBXA 3KW5B 1C4PA 4EZLA 3VRBB 1HEZE 1A70A 2JWUA 1KTKA 1SEBD 1UGMA 1SF0A 2Z59B 3E56A 1HQRD 3R3MA 2BS2B 1CK1A 2JU6X 2BYVE 4MELA 1TYGB 2NBUA 2CKHB 3ZXVA 3O65B 1WJUA 4HDQA 2LEKA 3GE3C 3TUOA 2WNMA 1HTOA 2I38A 3SFDB 3DBSA 1V8CA 5JZEB 4WIPA 3RNGC 1SGHA 3WIMA 4JWUC 3Q3NC 2N0SB 3IBEA 5BYSA 5FR6A 2V9HA 4K7UA 3UIOB 4KZ0A 2WXQA 3X23A 2RDGA 1STEA 2MBBB 1UH6A 2AYOB 1F2RC 3OAWA 1RM6C 2V4LA 4ANUA 4ICVA 2KFKB 3VTWA 3VUYA 2MEKA 4DHJB 3PZ8A 3KUCB 4ANVA 2UU7A 1IP9A 5J18A 4I6PA 1TS5A 1GUAB 2ZNVB 1L0YB 3HUIA 1R7SA 3QC8B 2ZVNA 2W9NA 1JQ4A 1FMAD 5AEKB 4ASWC 5BMGA 1MHXA 1WYGA 2DENB 2DZIA 1QF6A 5D94A 4GU2A 3Q8BA 4RM8A 1I4PA 3PO0A 4FLHA 1FXAA 2MJDA 4J6IA 4C56C 1BT0A 1FCCC 3NVYA 1LXDA 3JSVA 3TCAA 1RFKA 2IO3B 3OJ3A 3VR9B 4REZA 1NYQA 2RPVA 2PEAA 4XE0A 4B6WA 1Z2MA 4KGTA 4W9KA 1KFYB 4K7SA 3NOBA 2ZCCA 4EE2A 1TTNA 2KX3A 1HTQA 3R2IA 3V05A 2INCC 1PYWD 3M63B 1SE4A 5JXVA 2DZMA 2IPKD 1JWBD 4HCPB 4NPNA 3DOWA 4GMVA 2LVQA 2L32A 5AUKA 4CYEA 3P42A 2AQ2B 4W9EA 4Q2JA 4BOZB 4AS1A 3IHPC 1VJKA 2KYWA 3AB5A 2KWUB 1ZKHA 4M8NA 2KN5A 4GIVA 4H2AA 5E6NA 2KACA 3NY5A 4OVUA 1CJEA 2D3CA 4AJYB 2E6XA 1C1YB 4US8A 1N5WA 2N4FA 2EMSA 4IM3A 4M02A 5IA7A 4N9F4 1UD7A 3ENEA 1WJNA 2X38A 4XZ4A 4NNJB 2LXAA 2JF5A 4TKNA 3ZQ4A 2N9EB 2PE9A 2KFJA 4XWWA 5LXIB 2JSVX 2H88B 5D2MB 1B9RA 2MX2A 3K9PB 4JGHB 1DOIA 4BKTA 2W3RA 2IJ0A 1K51A 3ZYYX 5IP4D 2PW9A 1ROEA 1TKGA 2IY0B 2ZPNA 2KQ7A 1AYFA 1J0GA 3KYDD 2HD5B 3KYCD 3W1SA 3A9KB 1L4DB 1E7PB 4WJQA 3TBLD 4CHKA 1K52A 3P4QB 1M4VA 1FRRA 1E7VA 1WY8A 4MGIE 2RR9A 2GBNA 4HXDA 2RSUA 3U7DA 3IG3A 3RNCC 1KH0A 5HFYA 4XX5A 2E3TA 3J9CA 4C4VA 1JWAD 1ZXIA 1YNTE 2WXLA 4PYUA 1X1MA 2NTSA 2KWDA 3R8BA 3AECB 3ZW3A 4WAAA 2LUMA 3NS8A 3APDA 2YEPF 3HM6X 3QAQA 3X0WA 2KDBA 3EC8A 2LGSA 3I9V1 3L16A 3PRZA 2BS4B 4FXCA 4YWGG 2JY6A 2Z0EB 4RGNA 2N9LA 2LHDA 4FHKA 2CJOA 4L1BA 3ZXRA 3H8HA 4MEMA 4EOYA 1I4QA 4MM3B 3RCZA 1T5XD 1WF9A 1UWXA 4W9LA 5I4DA 1ZUD2 4HRSA 2R2OA 2KC1A 5KHOA 3A4SC 5J17A 2QC8A 3QCAA 2LFIA 2DYOA 5AZHA 4EEWA 5CHVC 3L13A 2M56B 2WXIA 4RH6A 2KK8A 2M0AA 3BINA 3HRDD 4FJZA 4JLCA 4YTPB 3ABVB 1E8XA 3NVVA 2N9XA 5H92C 1IUEA 3R66C 2KJHB 4ANWA 2ZZPB 2WWZA 1PQSA 2OJRA 3E9SA 1OQRA 3AEAB 3PRPB 3DBHI 4EUTA 2Z0DB 1FNUA 1Q1OA 3MJWA 4EKUA 3L54A 3AV8A 2MHJA 2YVCA 3N20C 1YIWA 2LWPA 5L95C 2KAJA 4NZLB 2C5LC 2KLCA 1OGWA 2LI5A 1OQYA 2WXMA 3SR6A 3AEBB 4ZHOA 1SBBB 2K5PA 2IY1B 3Q2AC 2HTME 5IN7A 3RMKC 1JCKB 1N60A 4DHZE 1L5PA 3JVZX 3Q3OC 4RM9A 3ETRA 3SFEB 1IBXB 4AQ7A 5HG2A 4HKQA 4M01A 1ZGUB 1HZ5A 1OEYA 2WP9B 2AQ3B 1K50A 4ZRJA 4ARIA 1E6EB 1XLNA 3BVZA 2DX5B 3N1ZC 4DWFA 3Q8FA 3VHTC 3NJTA 3SU8X 5FKAC 1SXTA 4K3BA 3HVZA 2CR5A 3MC0B 4D2KA 1HA5A 3DWGC 2NMQA 2WDQB 3Q14C 2XK5A 5D3DA 2JYEA 1L4ZB 2N7EA 5T8IA 2J7QB 1J7AA 3OWEB 3URYA 4ZYSA 4E74A 2V0GA 3QA8A 2KMMA 2L1AA 1QOAA 2BB6A 3T3NA 2NTTA 5EE3A 1V6EA 3VH3B 4MDKE 1T3QA 3Q8EA 1GC6A 3GB1A 3QX1A 3L4PA 2GLSA 1FFVA 2KC2A 1WX8A 1K53A 2D3GA 4XGAB 2D11A 4GDKA 4QAYA 3ONSA 1TIFA 1P98A 3JYUA 4M8MA 2XEWA 2K6QA 2KQSA 3KVFB 3WAOA 4P1CC 3LJ3A 3BK2A 4PS7A 1VRAB 1E7UA 1SE3A 1E9MA 3KH0A 4G50A 3JSVB 4A55A 4A20A 3MFGA 2LHEA 2PJHA 2MW5A 2LZ6A 5AUIA 1Y56A 3RZFA 2KMCA 4BZAA 4KX6B 3PLVA 4M00A 3UIPB 4ZHPA 4YSXB 3U7ZA 2MBHA 3GZNI 4GDLA 1QLBB 2JQRB 2MA9B 2KDEB 4NJ7A 4TSSA 1R4NB 4F8CB 4N58A 2VZKB 2L0TA 3QK0A 4GSWA 1D3ZA 4AP4C 4YXDB 4W9HA 1JALA 5JH5C 1WRIA 3B9JA 2HJ8A 2IGHA 1KOTA 3N1XC 2K0PA 2LGDA 2BVCA 5J2RA 1FPYA 1WR6E 1BXTA 2ZJDA 3DVNU 2MJEA 4HJKA 2D2QA 2NVUI 2MBOA 2J0JA 3BVMA 4RGMA 4IWPA 4N59A 1P3QU 2WDRB 2K1FA 1JROA 1QOBA 3MTNB 1OQQA 1XD3B 2C7MB 3WAMA 3QHTA 3LB8C 2Y5BB 2KOXA 1WXMA 3RPFC 1S1QB 4GGQA 1HE8A 1F9JA 1WZ0A 2LJIA 4ACFA 2RGFA 5AZGA 3GOEA 3TJPA 3VFKA 1U4AA 2M8SA 2DNFA 2D07B 3AE6B 2GOWA 2FNJB 2QDFA 2IO0B 3KQ4A 3V6EB 3UQBA 1TT5B 3P4PB 2CHXA 4BBNF 2Y3AA 1SJHD 2YLMA 1PGBA 1CMXB 2QEJC 2QIEB 2DBYA 4MT5A 5BYQA 4C4VB 4W9DA 3TL5A 3Q6BA 5DPWA 3B2FA 3ZKJC 2BKFA 3AE5B 5IKCM 4OHJA 3AH7A 3W5UB 2KDIA 1C76A 1V49A 2Y5PA 4JWSC 1MJDA 3WALA 3FAHA 4MGYE 2CJNA 2KHWB 4C00A 4CQNA 2NR2A 5KHQA 3QARA 1QOFA 4JL9A 2A4ZA 3GP7A 2INPE 3VH4B 3NVZA 3DPDA 2MCNB 4DBGA 2JXTA 1P7EA 3GS2A 4K7WA 2J53A 2VZKD 3W1YA 1IGDA 2JZZA 4PS8A 1P1AA 1YN4A 2MLBA 3AEDB 1RAXA 4JQWC 4EFOA 4HEA1 3NZSA 4OZBA 1ZW7A 3ZLZA 4NJ6A 2L7RA 4TV3A 5C3JB 3MP9A 1IGCA 3ZNZB 5MPOA 1FRDA 5FR3A 4IWQA 2AQ1B 3EGRA 3A9JA 1WGGA 1C78A 1BMLC 1OEYJ 2NS5A 1KLGD 1YX5B 1JRPA 2K8CA 3TEZA 1GB4A 1E8YA 3PHXB 2PE6B 4US9A 1JW9D 4W9JA 4NAWA 4MSQB 3MHZA 3DCGA 4HK2A 2C9WB 5TSSA 1KRHA 3DWMA 3DBRI 5CHFA 1FD6A 4WWOA 1LGRA 4WQMA 1QILA 4GN1A 1VR9A 3Q3FA 2L52A 2XBBC 4YT0B 5TR5A 3HHMA 1L6UA 4XDCA 1E0ZA 2DHZA 4HJGE 3M62B 4P1BC 2QSDA 5GXGB 3L10B 4KDLB 2K6DB 1NI3A 5DPTA 1CQVA 5LXHA 2K9XA 4OZCA 4FHJA 3IXSA 1RFAA 1UUPA 4PS3A 4K1RB 2INDC 1WFYA 4KIKA 2J0MA 5DCNA 1MPEA 1JWUD 3U30A 2WHIA 4PK1A 3LDZE 4HKZE 3ZRCA 4WAFA 1WX9A 4LDTB 1Z5SB 4G11A 5JHAA 2XK5B 3O13A 3T3OA 3ZDMC 4IW0A 4FADA 2IGGA 1T6BX 3EFUA 2WU2B 1J19A 5CHWA 3AE3B 4ZYNA 2ASQA 1PDXA 4DHJD 3IFWB 4HLEA 2CU1A 4JIOU 3DBLB 1WRDB 1WGYA 5BO4B 1V97A 4DHZB 2DZKA 2KDMA 4WJPA 5CTRC 1JRUA 1CZPA 2K22A 2RDHA 2WXHA 1SIJA 1VZ7A 1TKYA 4GDKB 5EDSA 3IVFA 3SD5A 2DYMA 3RI7C 1FIQA 4FA6A 3AU4A 2GI9A 2J0KA 2VH2A 2D3BA 1WE6A 2DLBA 1YQ3B 1DYQA 2BBCA 1ET9A 3APCA 4OW0A 5LNK1 1RYJA 3WANA 3OLMD 4URKA 4KKJA 3MC8A 5BMHA 1SB3C 3UF8A 4C80A 5L83A 1GG3A 3N32A 1N63A 1E8ZA 5E6JA 5D7GA 1NYRA 4I6LB 2OJWA 4GDLB 2KJ6A 2A5UA 2AEHA 1H8CA 3I63C 3ZJVA 3NZUA 3DVGY 1MI0A 3OG5A 1E90A 1R4MB 2HTHA 2IDYA 3UQAA 1YQBA 3A1QA 3AE1B 1TS2A 3L17A 3NVWA 4K81A 3APFA 2MQJA 2WLBA 2V1YA 2DYBA 1IYFA 2O2VA 1C79A 3B1LX 3ZIMA 1FNVA 4B0EA 2AX5A 3AE8B 4FBJB 2ZVOA 2KXJA 2KTFA 2JZPA 3B08A 1L6VA 5C1ZA 1YOVB 3PREA 2G3QB 3PTFC 3BZDB 4LK0M 2JRHA 4ITKA 3P4RB 4LDTD 2WXKA 1V9JA 3P1MA 2LRWA 2KD0A 3Q69A 1D4BA 2LUEA 4LNKA 3Q8CA 2BGFA 4XDDA 1P9DU 5G5GA 2K25A 2RMMA 3CWIA 4FJYA 2WDVB 2WXFA 2V3PA 2KVZA 2OOBB 3PHWB 1I35A 1ET6A 4YSYB 1L0XB 1ZDVA 1YJ1A 4CO7A 3P2BA 3DHHC 4OZAA 2JXXA 2WQYB 3HM3A 4BKSA 4ARCA 4A8XC 1GJZA 4HVBA 3TEWA 3N3KB 1I4RA 1L7YA 3H7SA 3PSEB 2INNE 4AJWA 1FO4A 4W9FA 3BYTB 4MH8A 4B95A 2BB5A 3VRAB 1AW7A 1HXYD 3I3TB 3EHVA 1WX7A 1N5XA 2KZRA 3BYYB 2BWFA 1TZOA 3QQ8B 1IPGA 2K8HA 4L23A 3TMPB 2IZVB 1QQRA 3P4SB 3BIID 3V62A 1ZDXA 1DGJA 1ZOYB 2FCMA 2EELA 4HWIB 4IWOA 2WX0A 4KVGB 4M0WA 1AARA 4MGZE 4USAA 1KF6B 1J8CA 3DHIC 4JX1C 1WXQA 1YQ4B 4TUUA 1RRBA 1MHHE 1F2RI 2L3ZA 3HIZA 2FCQA 3U2SC 3ZUNA 3K9OB 4TMAB 4KSLC 2BT6A 2KWVB 2CU3A 2PPHA 2RD0A 1NVID 4F7ZA 2J52A 3HK0A 3N9YC 1ZE3D 1SSNA 4ZRIA 3VAWA 1UWMA 2GBKA 4W9IA 2LGIA 2GBJA 2LVOA 1KLUD 1TKEA 3A9JB 2FCNA 2KDFB 2K39A 2WXOA 2RDBC 1V1PA 2BF8B 2MP2A 3VXWA 2KO3A 2NCNA 3IT4B 1FM0D 2HJ1A 2ZNVC 1T0RC 3L0WB 4NAMA 1TS4A 3RZWC 1JWSD 1Q5WB 2WXNA 4NAWB 2G45B 5HHDG 2PIAA 3NZ3A 3VQIA 3RD2A 5HI1A 3QJZA 2K3UA 3ZNHB 5IOIA 1WXSA 1XQQA 1XLQA 3BVGA 4YTNB 2GBRA 3DQVA 5IO9A 4HCNB 4IOIE 3R7RA 3V60A 3SEBA 1P0RA 1V2YA 3T9LA 1EU4A 1UF0A 1F1HA 1XF5L 2QHOA 1V5TA 2HDEA 3U4EG 3C0RB 3MJ5A 3L08A 2K8BA 3UINB 5CX3A 4RGOS 2GMIC 2G4DB 2C60A 3ZTCA 2ONQA 3DVNV 1T0YA 3VDZA 1QOGA 2LRUA 2BS3B 2WXJA 2L76A 1FFUA 4P7IA 2JYTA 4FN2A 1UZXB 3ZJUA 1LFDA 2PTLA 4DDGD 2HE7A 4KIKB 2MWSB 3IAS1 4NY0A 1M94A 1TY2A 4KZCA 4L2YA 5IAAC 2LMCA 2V4IB 1ZP0B 1EUVB 5G2NA 3NUHB 4MH0E 1XCTL 1JWMD 4HPMB 4KDIC 3ML8A 1LO5D 3CIRB 3AE7B 2KMAA 2N1WA 3ZVVA 4IKGA 3N1YC 4IDIA 3NG0A 2GB1A 5FK9C 2Q5WD 5DPRA 1WYWB 1WMHA 4R3DA 1XCQL 1VZ6A 2MRPA 1G6JA 2M4NA 2AL3A 4XWTA 2O6VA 1DOYA 3CMMB 4GLSC 2M17A 2CHZA 3H7PA 1V81A 3QIJA 3ZTDA 3ALBA 4AOFA 1DOXA 4ZDVA 3QWZB 3W2DA 4WWPA 3W9CB 4IUMB 4WJNA 1T0QC 1EO6A 1FNWA 5EE9A 3U52E 1KLVA 3WAPA 2ON8A 4LJOB 1V1OA 1ESFA 2IYDB 1I42A 1TY0A 4IG7B 2LGXA 2W54A 5DPSA 3H6NA 4EZKA 1GNUA 2MSED 4S0RA 4BOSC 4DDID 4LNFA 1V86A 2Z8LA 4HPLB 3SDLC 1UNSA 3ECIA 4HROA 4K3CA 2R2QA 4GXBA 2JUOA 1OFFA 1WSPA 1UBIA 4P6VF 4BKGA 4DQOC 5C23A 2N9KA 3TEXA 1TGZB 1LM8B 2M1MA 2WYQA 2BYTA 3A1QB
chains in the Genus database with same CATH topology
4DHZE 5BO4B 4KV2A 2LVPA 2O6VD 3JVZX 3PZDA 4DHZB 2BYEA 2L00B 4RM9A 2LXCA 2DZKA 1WZ3A 1YD8U 4WJPA 5CTRC 1C3TA 1JRUA 3DVGX 4GOCA 1UELA 4MSMB 3U8ZA 1ISNA 1ZGUB 2O2VB 1OEYA 3MHSD 4GDKB 1R4NI 4MJSB 5EDSA 4ZRJA 1EF5A 1A5RA 4RMAA 3A4RA 2BKRB 2L05A 3IVFA 4HDOA 2DYMA 3SD5A 2DX5B 4DWFA 3M3JA 3Q3JA 4FA6A 3AU4A 1E8WA 2J0KA 1WE6A 3VHTC 1TZ1A 2UYZB 1YX6B 3SU8X 2G4SA 2C7NB 3APCA 1VD2A 2KJRA 2KLGA 3DDCB 2N9PC 2WX1A 3TIXA 4LJPB 3WANA 3CSTA 3OLMD 4URKA 4A3PA 1NDDA 3B0AA 3ML9A 4FULA 2CR5A 1WR1A 3ZDTA 2ZPYA 3UF8A 2NPTB 4BFRA 4IC7B 5L83A 4NQLB 1GG3A 3N32A 2XK5A 1E8ZA 2NBWB 3PV1A 4TQ1A 5D7GA 4I6LB 2N7EA 2J7QB 1RLFA 4E74A 4GDLB 2KJ6A 3QA8A 1NI2A 5GMVA 1WGDA 2A5UA 2AEHA 2DAJA 1H8CA 2FUHB 4ICUA 3NZUA 2AWTA 3DVGY 1E90A 3PVLA 1WGRA 2HTHA 3JW0X 3VUWA 4IM2A 3PPAA 2FIFA 4WQOB 1L2NA 1EF1A 1V6EA 3UQAA 3VH3B 3RUIB 4MDKE 4PYZA 2KTRA 1MG8A 1YQBA 3A1QA 1E5WA 3H1UA 1GC6A 3AI5A 3VUXA 5E6OA 3L17A 3QX1A 3M95A 4K81A 3APFA 3H9DA 2MQJA 4AWJA 2RPQA 5G55A 1WH3A 2CS4A 3KW5B 2KC2A 2V1YA 2NBVB 4GB9A 2DYBA 1IYFA 1WGYA 1WX8A 2O2VA 4EZLA 3B1LX 2D3GA 2D11A 4GDKA 3ZIMA 4MJSA 2EKEC 3BY4B 1UGMA 3ONSA 4FBJB 1P98A 3JYUA 4M8MA 2ZVOA 2Z59B 2XEWA 2K6QA 2KQSA 2KXJA 3R3MA 3KVFB 3WA0A 2KTFA 3WAOA 3LJ3A 4KSKC 4PS7A 3B08A 4ZRKA 1E7UA 5C1ZA 2EMTA 2BYVE 3KH0A 4G50A 3JSVB 4MELA 3AULA 4A20A 2NBUA 2CKHB 3PREA 4II2B 2G3QB 3PTFC 3O65B 1WJUA 2JRHA 3CSFA 4HDQA 2PJHA 2MW5A 2V3SA 2LZ6A 2VRRB 4LDTD 2KWCA 1V9JA 2ZEQA 2LASA 2LRWA 3RZFA 1FXTB 3DBSA 2KD0A 1Q0WB 5JZEB 2KMCA 2NPTA 2M0XA 1SGHA 2LUEA 3WIMA 3PLVA 5JHBA 3IBEA 3AU5A 3UIPB 2BGFA 5FR6A 2I1KA 1P9DU 2N7DA 4IM0A 2K25A 1WJ4A 2MBHA 4K7UA 4M0WB 3UIOB 3GZNI 4GDLA 4KZ0A 1Y8RC 2MA9B 4FJYA 2KDEB 3X23A 2AL6A 2MBBB 4NJ7A 2LJ5A 1UH6A 2AYOB 3OAWA 2KNBA 2V4LA 4F8CB 2IO1B 3R7QA 4ANUA 2L0TA 2OOBB 3QK0A 4ICVA 2KFKB 3VTWA 3PHWB 4GSWA 3VUYA 1D3ZA 2ZCBA 1I35A 4DHJB 1WGHA 3KUCB 4AP4C 4ANVA 3T8MA 4W9HA 1IP9A 5D6JB 5J18A 2DAFA 4I6PA 1GUAB 2ZNVB 1YJ1A 3ZO5B 4CO7A 5JH5C 3P2BA 2HJ8A 2JXXA 3QC8B 2ZVNA 4W9CA 2W9NA 1KOTA 3HM3A 4BVUC 5AEKB 4ASWC 1WXAA 4BKSA 1GJZA 4HVBA 2DENB 2DZIA 1QZEA 3N3KB 5D94A 4GU2A 2LGDA 4RM8A 1L7YA 3H7SA 3PSEB 1NBFC 4AJWA 2MP2B 3PGEA 4FLHA 5J2RA 4W9FA 1WR6E 1SIFA 4J6IA 4B95A 1BT0A 4XC2A 2ZJDA 3DVNU 4HJKA 2D2QA 2NVUI 2MBOA 2J0JA 3D32A 1LXDA 3JSVA 4IWPA 3I3TB 3TCAA 2BWES 1H4RA 1P3QU 1WX7A 2IO3B 2KZRA 3EHVA 3OJ3A 2BWFA 3QQ8B 2K1FA 2PEAA 4MGKE 4B6WA 1UBQA 1IPGA 1Z2MA 3MTNB 2K8HA 3TMPB 1XD3B 2IZVB 4W9KA 2C7MB 3WAMA 4K7SA 3QHTA 2Y5BB 2KOXA 3NOBA 1WXMA 2ZCCA 1TTNA 3V62A 3AXCA 3NHEB 2KX3A 3V6CB 1S1QB 4GGQA 1HE8A 1F9JA 1WZ0A 2FCMA 2GBMA 4HWIB 2WX0A 4IWOA 2RGFA 5AZGA 4KVGB 4WJOA 3GOEA 3TJPA 3PS6A 4EZJA 3M63B 3VFKA 1AARA 4MGZE 2DZMA 1U4AA 2M8SA 1J8CA 2D07B 4HCPB 2GOWA 2FNJB 4TUUA 4NPNA 3DOWA 3EECA 1RRBA 1V5OA 2KX0A 2MBQA 4GMVA 2LVQA 2L3ZA 2IO0B 3HIZA 4CYEA 2JVCA 2KFKA 2FCQA 3ZUNA 3K9OB 2LGYA 4W9EA 4BOZB 4KSLC 2N1VA 2KWVB 3V6EB 2PPHA 2RD0A 3IHPC 3UQBA 4BKSD 4F7ZA 4BBNF 2CHXA 2KWUB 1ZKHA 4M8NA 3HK0A 2KN5A 4GIVA 1OTRB 5E6NA 2YLMA 4ZRIA 3VAWA 1CMXB 2GBKA 3NY5A 4OVUA 4W9IA 2LVOA 2GBJA 4W9DA 4AJYB 1C1YB 3A9JB 2N4FA 2FCNA 3TL5A 2EMSA 2JZ3B 2KDFB 4IM3A 2K39A 5IA7A 5LLIA 2BF8B 2MP2A 4N9F4 3VXWA 2KO3A 2NCNA 2FCSA 1UD7A 3ENEA 2KVRA 2ZNVC 5DPWA 3L0WB 1WJNA 4XZ4A 2UWQA 4NNJB 2WDTB 2LXAA 3ZKJC 2BKFA 3RZWC 1Q5WB 2JF5A 4TKNA 2KDIA 1V49A 2G45B 2CHWA 2KFJA 2N9EB 2PE9A 4NAWB 5LXIB 2KANA 3WALA 4A3OA 4MGYE 3RD2A 3VQIA 5D2MB 2MX2A 2KHWB 3K9PB 4JGHB 1K8RB 3QJZA 4BKTA 2NR2A 5KHQA 1XT9B 3ZNHB 3KUDB 3QARA 1WXSA 3V61A 1XQQA 4JL9A 2A4ZA 3ZNID 2GBRA 3DQVA 3VH4B 4HCNB 2IY0B 2ZPNA 2MCNB 3DPDA 4DBGA 2KQ7A 3R7RA 1LQBA 3V60A 1P0RA 1V2YA 3T9LA 1WMHB 1J0GA 3KYDD 2HD5B 3KYCD 4K7WA 3W1SA 3W1YA 2QHOA 1V5TA 3A9KB 3C0RB 2L0FA 3L08A 2FIDA 2K8BA 3ZNGC 3OJ4B 4WJQA 3UINB 2JZZA 4PS8A 5CX3A 1P1AA 2MLBA 2O6VB 3TBLD 3A33B 2GMIC 1RAXA 4JQWC 2G4DB 2C60A 3ZTCA 2I1JA 4CHKA 4EFOA 3H7PB 3NZSA 3DVNV 1T0YA 3VDZA 1ZW7A 3ZLZA 1E7VA 1WY8A 2LRUA 2RR9A 4MGIE 2GBNA 3VTUA 4NJ6A 4HXDA 2L7RA 2L76A 2RSUA 3U7DA 3IG3A 3W1SC 4TV3A 4DK5A 1VCBA 4P7IA 4XX5A 2B3AA 2FAZA 2JT4B 3DBLI 3ZNZB 4FN2A 1UZXB 2JWZA 4TQ0A 3UGBB 3RT3B 1LFDA 4IWQA 4DDGD 2HE7A 4KIKB 2MWSB 3A9JA 1WGGA 4NY0A 1M94A 4PYUA 1X1MA 5HKHA 1OEYJ 2NS5A 3PLUA 4KZCA 5IAAC 3PT2B 1YX5B 2K8CA 3ZW3A 4WAAA 1SE9A 3NS8A 1E8YA 3APDA 3PHXB 2BYFA 3KUZA 1WJ6A 3HM6X 4BBNC 3CF6E 2PE6B 3QAQA 4DXAB 4W9JA 4NAWA 4MSQB 3DCGA 1EUVB 3X0WA 2KDBA 3EC8A 5G2NA 3VVWB 4HK2A 2C9WB 4E3CA 4MH0E 3L16A 4HPMB 4KDIC 3DBRI 2JPHA 4B9KA 4OVVA 3PRZA 4F1SA 5CHFA 3ML8A 4WWOA 2JY6A 2Z0EB 1WXVA 4LCDE 1S3SG 2KMAA 2N1WA 3ZVVA 4GN1A 4FHKA 3Q3FA 2XBBC 1KM7A 4MEMA 4EOYA 5TR5A 5DPRA 3RCZA 3HHMA 1WYWB 1WMHA 1WF9A 1GC7A 4AUQC 4W9LA 3A9KA 2MRPA 2MBEA 1G6JA 1TBEA 2R2OA 2M4NA 1WM2A 2DHZA 3M62B 4G0NB 2KC1A 2AL3A 3L10B 5KHOA 3A4SC 3ZRFA 5J17A 4KDLB 2O6VA 4ANXA 3QCAA 2K6DB 3CMMB 2DYOA 4NQKE 2DZJA 5DPTA 2M17A 5AZHA 5CHVC 2CHZA 3H7PA 3L13A 4EEWA 5LXHA 1WI0A 2BPSA 2KK8A 1V81A 3QIJA 3SHQA 3ZTDA 3BINA 3ALBA 4FHJA 4AOFA 1R4MI 4FJZA 4ZDVA 3QWZB 4JLCA 1RFAA 3RULA 4WWPA 4PS3A 4IUMB 1E8XA 4K1RB 2N9XA 4WJNA 3N30A 2REXA 4YL8A 1EO6A 1WM3A 3R66C 4G3XB 1KLVA 3WAPA 2L8JA 4WWNA 1WFYA 2KJHB 4KIKA 4ANWA 2ZZPB 2J0MA 2WWZA 5DCNA 4LJOB 4W9GA 1PQSA 2OJRA 2C7HA 2IYDB 3U30A 3PRMB 1I42A 4I6NB 1WE7A 3PRPB 4IG7B 3LDZE 3DBHI 2LGXA 5DPSA 4EUTA 2Z0DB 4FJVB 2IBIB 1Q1OA 3H6NA 3ZRCA 3MJWA 4EKUA 3L54A 1WX9A 4LDTB 1Z5SB 2D10A 2IO2B 4E71A 4G11A 2YVCA 2LD9A 1YIWA 2LWPA 1GNUA 2MSED 2XK5B 4EZKA 5JHAA 5E6PA 1WIAA 4II3B 3S2AA 5L95C 4BOSC 2KKCA 3ZDMC 4IW0A 2C5LC 2KLCA 4FADA 4DDID 1OGWA 2LI5A 1V86A 1OQYA 4HPLB 3EFUA 3SDLC 3ECIA 4X57B 3VTVA 1J19A 2R2QA 4GXBA 2JUOA 2IY1B 5CHWA 3RYTA 1V80A 4ZYNA 1UBIA 2ASQA 4DHJD 3IFWB 4HLEA 4BKGA 5C23A 2CU1A 4JIOU 4MM3A 1TGZB 1LM8B 1KJTA 5AZFA 2M1MA 2WYQA 2JRIB 1WRDB 2KTRB 3A1QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DHZ E;  5BO4 B;  4KV2 A;  2LVP A;  2O6V D;  3JVZ X;  3PZD A;  4DHZ B;  2BYE A;  2L00 B;  4RM9 A;  2LXC A;  2DZK A;  1WZ3 A;  1YD8 U;  4WJP A;  5CTR C;  1C3T A;  1JRU A;  3DVG X;  4GOC A;  1UEL A;  4MSM B;  3U8Z A;  1ISN A;  1ZGU B;  2O2V B;  1OEY A;  3MHS D;  4GDK B;  1R4N I;  4MJS B;  5EDS A;  4ZRJ A;  1EF5 A;  1A5R A;  4RMA A;  3A4R A;  2BKR B;  2L05 A;  3IVF A;  4HDO A;  2DYM A;  3SD5 A;  2DX5 B;  4DWF A;  3M3J A;  3Q3J A;  4FA6 A;  3AU4 A;  1E8W A;  2J0K A;  1WE6 A;  3VHT C;  1TZ1 A;  2UYZ B;  1YX6 B;  3SU8 X;  2G4S A;  2C7N B;  3APC A;  1VD2 A;  2KJR A;  2KLG A;  3DDC B;  2N9P C;  2WX1 A;  3TIX A;  4LJP B;  3WAN A;  3CST A;  3OLM D;  4URK A;  4A3P A;  1NDD A;  3B0A A;  3ML9 A;  4FUL A;  2CR5 A;  1WR1 A;  3ZDT A;  2ZPY A;  3UF8 A;  2NPT B;  4BFR A;  4IC7 B;  5L83 A;  4NQL B;  1GG3 A;  3N32 A;  2XK5 A;  1E8Z A;  2NBW B;  3PV1 A;  4TQ1 A;  5D7G A;  4I6L B;  2N7E A;  2J7Q B;  1RLF A;  4E74 A;  4GDL B;  2KJ6 A;  3QA8 A;  1NI2 A;  5GMV A;  1WGD A;  2A5U A;  2AEH A;  2DAJ A;  1H8C A;  2FUH B;  4ICU A;  3NZU A;  2AWT A;  3DVG Y;  1E90 A;  3PVL A;  1WGR A;  2HTH A;  3JW0 X;  3VUW A;  4IM2 A;  3PPA A;  2FIF A;  4WQO B;  1L2N A;  1EF1 A;  1V6E A;  3UQA A;  3VH3 B;  3RUI B;  4MDK E;  4PYZ A;  2KTR A;  1MG8 A;  1YQB A;  3A1Q A;  1E5W A;  3H1U A;  1GC6 A;  3AI5 A;  3VUX A;  5E6O A;  3L17 A;  3QX1 A;  3M95 A;  4K81 A;  3APF A;  3H9D A;  2MQJ A;  4AWJ A;  2RPQ A;  5G55 A;  1WH3 A;  2CS4 A;  3KW5 B;  2KC2 A;  2V1Y A;  2NBV B;  4GB9 A;  2DYB A;  1IYF A;  1WGY A;  1WX8 A;  2O2V A;  4EZL A;  3B1L X;  2D3G A;  2D11 A;  4GDK A;  3ZIM A;  4MJS A;  2EKE C;  3BY4 B;  1UGM A;  3ONS A;  4FBJ B;  1P98 A;  3JYU A;  4M8M A;  2ZVO A;  2Z59 B;  2XEW A;  2K6Q A;  2KQS A;  2KXJ A;  3R3M A;  3KVF B;  3WA0 A;  2KTF A;  3WAO A;  3LJ3 A;  4KSK C;  4PS7 A;  3B08 A;  4ZRK A;  1E7U A;  5C1Z A;  2EMT A;  2BYV E;  3KH0 A;  4G50 A;  3JSV B;  4MEL A;  3AUL A;  4A20 A;  2NBU A;  2CKH B;  3PRE A;  4II2 B;  2G3Q B;  3PTF C;  3O65 B;  1WJU A;  2JRH A;  3CSF A;  4HDQ A;  2PJH A;  2MW5 A;  2V3S A;  2LZ6 A;  2VRR B;  4LDT D;  2KWC A;  1V9J A;  2ZEQ A;  2LAS A;  2LRW A;  3RZF A;  1FXT B;  3DBS A;  2KD0 A;  1Q0W B;  5JZE B;  2KMC A;  2NPT A;  2M0X A;  1SGH A;  2LUE A;  3WIM A;  3PLV A;  5JHB A;  3IBE A;  3AU5 A;  3UIP B;  2BGF A;  5FR6 A;  2I1K A;  1P9D U;  2N7D A;  4IM0 A;  2K25 A;  1WJ4 A;  2MBH A;  4K7U A;  4M0W B;  3UIO B;  3GZN I;  4GDL A;  4KZ0 A;  1Y8R C;  2MA9 B;  4FJY A;  2KDE B;  3X23 A;  2AL6 A;  2MBB B;  4NJ7 A;  2LJ5 A;  1UH6 A;  2AYO B;  3OAW A;  2KNB A;  2V4L A;  4F8C B;  2IO1 B;  3R7Q A;  4ANU A;  2L0T A;  2OOB B;  3QK0 A;  4ICV A;  2KFK B;  3VTW A;  3PHW B;  4GSW A;  3VUY A;  1D3Z A;  2ZCB A;  1I35 A;  4DHJ B;  1WGH A;  3KUC B;  4AP4 C;  4ANV A;  3T8M A;  4W9H A;  1IP9 A;  5D6J B;  5J18 A;  2DAF A;  4I6P A;  1GUA B;  2ZNV B;  1YJ1 A;  3ZO5 B;  4CO7 A;  5JH5 C;  3P2B A;  2HJ8 A;  2JXX A;  3QC8 B;  2ZVN A;  4W9C A;  2W9N A;  1KOT A;  3HM3 A;  4BVU C;  5AEK B;  4ASW C;  1WXA A;  4BKS A;  1GJZ A;  4HVB A;  2DEN B;  2DZI A;  1QZE A;  3N3K B;  5D94 A;  4GU2 A;  2LGD A;  4RM8 A;  1L7Y A;  3H7S A;  3PSE B;  1NBF C;  4AJW A;  2MP2 B;  3PGE A;  4FLH A;  5J2R A;  4W9F A;  1WR6 E;  1SIF A;  4J6I A;  4B95 A;  1BT0 A;  4XC2 A;  2ZJD A;  3DVN U;  4HJK A;  2D2Q A;  2NVU I;  2MBO A;  2J0J A;  3D32 A;  1LXD A;  3JSV A;  4IWP A;  3I3T B;  3TCA A;  2BWE S;  1H4R A;  1P3Q U;  1WX7 A;  2IO3 B;  2KZR A;  3EHV A;  3OJ3 A;  2BWF A;  3QQ8 B;  2K1F A;  2PEA A;  4MGK E;  4B6W A;  1UBQ A;  1IPG A;  1Z2M A;  3MTN B;  2K8H A;  3TMP B;  1XD3 B;  2IZV B;  4W9K A;  2C7M B;  3WAM A;  4K7S A;  3QHT A;  2Y5B B;  2KOX A;  3NOB A;  1WXM A;  2ZCC A;  1TTN A;  3V62 A;  3AXC A;  3NHE B;  2KX3 A;  3V6C B;  1S1Q B;  4GGQ A;  1HE8 A;  1F9J A;  1WZ0 A;  2FCM A;  2GBM A;  4HWI B;  2WX0 A;  4IWO A;  2RGF A;  5AZG A;  4KVG B;  4WJO A;  3GOE A;  3TJP A;  3PS6 A;  4EZJ A;  3M63 B;  3VFK A;  1AAR A;  4MGZ E;  2DZM A;  1U4A A;  2M8S A;  1J8C A;  2D07 B;  4HCP B;  2GOW A;  2FNJ B;  4TUU A;  4NPN A;  3DOW A;  3EEC A;  1RRB A;  1V5O A;  2KX0 A;  2MBQ A;  4GMV A;  2LVQ A;  2L3Z A;  2IO0 B;  3HIZ A;  4CYE A;  2JVC A;  2KFK A;  2FCQ A;  3ZUN A;  3K9O B;  2LGY A;  4W9E A;  4BOZ B;  4KSL C;  2N1V A;  2KWV B;  3V6E B;  2PPH A;  2RD0 A;  3IHP C;  3UQB A;  4BKS D;  4F7Z A;  4BBN F;  2CHX A;  2KWU B;  1ZKH A;  4M8N A;  3HK0 A;  2KN5 A;  4GIV A;  1OTR B;  5E6N A;  2YLM A;  4ZRI A;  3VAW A;  1CMX B;  2GBK A;  3NY5 A;  4OVU A;  4W9I A;  2LVO A;  2GBJ A;  4W9D A;  4AJY B;  1C1Y B;  3A9J B;  2N4F A;  2FCN A;  3TL5 A;  2EMS A;  2JZ3 B;  2KDF B;  4IM3 A;  2K39 A;  5IA7 A;  5LLI A;  2BF8 B;  2MP2 A;  4N9F 4;  3VXW A;  2KO3 A;  2NCN A;  2FCS A;  1UD7 A;  3ENE A;  2KVR A;  2ZNV C;  5DPW A;  3L0W B;  1WJN A;  4XZ4 A;  2UWQ A;  4NNJ B;  2WDT B;  2LXA A;  3ZKJ C;  2BKF A;  3RZW C;  1Q5W B;  2JF5 A;  4TKN A;  2KDI A;  1V49 A;  2G45 B;  2CHW A;  2KFJ A;  2N9E B;  2PE9 A;  4NAW B;  5LXI B;  2KAN A;  3WAL A;  4A3O A;  4MGY E;  3RD2 A;  3VQI A;  5D2M B;  2MX2 A;  2KHW B;  3K9P B;  4JGH B;  1K8R B;  3QJZ A;  4BKT A;  2NR2 A;  5KHQ A;  1XT9 B;  3ZNH B;  3KUD B;  3QAR A;  1WXS A;  3V61 A;  1XQQ A;  4JL9 A;  2A4Z A;  3ZNI D;  2GBR A;  3DQV A;  3VH4 B;  4HCN B;  2IY0 B;  2ZPN A;  2MCN B;  3DPD A;  4DBG A;  2KQ7 A;  3R7R A;  1LQB A;  3V60 A;  1P0R A;  1V2Y A;  3T9L A;  1WMH B;  1J0G A;  3KYD D;  2HD5 B;  3KYC D;  4K7W A;  3W1S A;  3W1Y A;  2QHO A;  1V5T A;  3A9K B;  3C0R B;  2L0F A;  3L08 A;  2FID A;  2K8B A;  3ZNG C;  3OJ4 B;  4WJQ A;  3UIN B;  2JZZ A;  4PS8 A;  5CX3 A;  1P1A A;  2MLB A;  2O6V B;  3TBL D;  3A33 B;  2GMI C;  1RAX A;  4JQW C;  2G4D B;  2C60 A;  3ZTC A;  2I1J A;  4CHK A;  4EFO A;  3H7P B;  3NZS A;  3DVN V;  1T0Y A;  3VDZ A;  1ZW7 A;  3ZLZ A;  1E7V A;  1WY8 A;  2LRU A;  2RR9 A;  4MGI E;  2GBN A;  3VTU A;  4NJ6 A;  4HXD A;  2L7R A;  2L76 A;  2RSU A;  3U7D A;  3IG3 A;  3W1S C;  4TV3 A;  4DK5 A;  1VCB A;  4P7I A;  4XX5 A;  2B3A A;  2FAZ A;  2JT4 B;  3DBL I;  3ZNZ B;  4FN2 A;  1UZX B;  2JWZ A;  4TQ0 A;  3UGB B;  3RT3 B;  1LFD A;  4IWQ A;  4DDG D;  2HE7 A;  4KIK B;  2MWS B;  3A9J A;  1WGG A;  4NY0 A;  1M94 A;  4PYU A;  1X1M A;  5HKH A;  1OEY J;  2NS5 A;  3PLU A;  4KZC A;  5IAA C;  3PT2 B;  1YX5 B;  2K8C A;  3ZW3 A;  4WAA A;  1SE9 A;  3NS8 A;  1E8Y A;  3APD A;  3PHX B;  2BYF A;  3KUZ A;  1WJ6 A;  3HM6 X;  4BBN C;  3CF6 E;  2PE6 B;  3QAQ A;  4DXA B;  4W9J A;  4NAW A;  4MSQ B;  3DCG A;  1EUV B;  3X0W A;  2KDB A;  3EC8 A;  5G2N A;  3VVW B;  4HK2 A;  2C9W B;  4E3C A;  4MH0 E;  3L16 A;  4HPM B;  4KDI C;  3DBR I;  2JPH A;  4B9K A;  4OVV A;  3PRZ A;  4F1S A;  5CHF A;  3ML8 A;  4WWO A;  2JY6 A;  2Z0E B;  1WXV A;  4LCD E;  1S3S G;  2KMA A;  2N1W A;  3ZVV A;  4GN1 A;  4FHK A;  3Q3F A;  2XBB C;  1KM7 A;  4MEM A;  4EOY A;  5TR5 A;  5DPR A;  3RCZ A;  3HHM A;  1WYW B;  1WMH A;  1WF9 A;  1GC7 A;  4AUQ C;  4W9L A;  3A9K A;  2MRP A;  2MBE A;  1G6J A;  1TBE A;  2R2O A;  2M4N A;  1WM2 A;  2DHZ A;  3M62 B;  4G0N B;  2KC1 A;  2AL3 A;  3L10 B;  5KHO A;  3A4S C;  3ZRF A;  5J17 A;  4KDL B;  2O6V A;  4ANX A;  3QCA A;  2K6D B;  3CMM B;  2DYO A;  4NQK E;  2DZJ A;  5DPT A;  2M17 A;  5AZH A;  5CHV C;  2CHZ A;  3H7P A;  3L13 A;  4EEW A;  5LXH A;  1WI0 A;  2BPS A;  2KK8 A;  1V81 A;  3QIJ A;  3SHQ A;  3ZTD A;  3BIN A;  3ALB A;  4FHJ A;  4AOF A;  1R4M I;  4FJZ A;  4ZDV A;  3QWZ B;  4JLC A;  1RFA A;  3RUL A;  4WWP A;  4PS3 A;  4IUM B;  1E8X A;  4K1R B;  2N9X A;  4WJN A;  3N30 A;  2REX A;  4YL8 A;  1EO6 A;  1WM3 A;  3R66 C;  4G3X B;  1KLV A;  3WAP A;  2L8J A;  4WWN A;  1WFY A;  2KJH B;  4KIK A;  4ANW A;  2ZZP B;  2J0M A;  2WWZ A;  5DCN A;  4LJO B;  4W9G A;  1PQS A;  2OJR A;  2C7H A;  2IYD B;  3U30 A;  3PRM B;  1I42 A;  4I6N B;  1WE7 A;  3PRP B;  4IG7 B;  3LDZ E;  3DBH I;  2LGX A;  5DPS A;  4EUT A;  2Z0D B;  4FJV B;  2IBI B;  1Q1O A;  3H6N A;  3ZRC A;  3MJW A;  4EKU A;  3L54 A;  1WX9 A;  4LDT B;  1Z5S B;  2D10 A;  2IO2 B;  4E71 A;  4G11 A;  2YVC A;  2LD9 A;  1YIW A;  2LWP A;  1GNU A;  2MSE D;  2XK5 B;  4EZK A;  5JHA A;  5E6P A;  1WIA A;  4II3 B;  3S2A A;  5L95 C;  4BOS C;  2KKC A;  3ZDM C;  4IW0 A;  2C5L C;  2KLC A;  4FAD A;  4DDI D;  1OGW A;  2LI5 A;  1V86 A;  1OQY A;  4HPL B;  3EFU A;  3SDL C;  3ECI A;  4X57 B;  3VTV A;  1J19 A;  2R2Q A;  4GXB A;  2JUO A;  2IY1 B;  5CHW A;  3RYT A;  1V80 A;  4ZYN A;  1UBI A;  2ASQ A;  4DHJ D;  3IFW B;  4HLE A;  4BKG A;  5C23 A;  2CU1 A;  4JIO U;  4MM3 A;  1TGZ B;  1LM8 B;  1KJT A;  5AZF A;  2M1M A;  2WYQ A;  2JRI B;  1WRD B;  2KTR B;  3A1Q B; 
#chains in the Genus database with same CATH topology
 4KV2 A;  2G9H D;  2LVP A;  2BYE A;  1ZXH A;  1YD8 U;  2WS3 B;  1XO3 A;  1FEH A;  1C4A A;  3FKY A;  1UEL A;  4MSM B;  1B1Z A;  3U8Z A;  2O2V B;  1E10 A;  1C4C A;  1R4N I;  2KT7 A;  3V3X A;  2JX5 A;  4RMA A;  2XN9 C;  1UGJ A;  3A4R A;  2BKR B;  2L05 A;  1SE2 A;  2PVG C;  3M3J A;  1E8W A;  1GAQ B;  1TZ1 A;  4B0M A;  1YX6 B;  2G4S A;  2D3A A;  4C7Y A;  1VD2 A;  3DDC B;  4MAC A;  2N9P C;  3AM9 A;  4A3P A;  1NDD A;  4DXF A;  2PKO A;  2QJL A;  3ML9 A;  3ZDT A;  1WR1 A;  5H8Y E;  2ZPY A;  2NBW B;  2B76 B;  1XLO A;  1I4X A;  4HPP A;  2DAJ A;  2PLP A;  4ICU A;  2AWT A;  1YMH E;  1D6E C;  3PVL A;  3VUW A;  5BMI A;  3PPA A;  1EF1 A;  2WXP A;  3RUI B;  2XNA C;  4RGT A;  1EU3 A;  5D3I B;  2KTR A;  3H1U A;  5C2T B;  3AI5 A;  3VUX A;  5E6O A;  3C19 A;  3DHG C;  3H9D A;  2GRI A;  2RPQ A;  1NEK B;  5G55 A;  1D5Z C;  2NBV B;  1C77 A;  4GB9 A;  3DBH B;  3AN1 A;  2OHF A;  1EWY C;  3UI3 A;  4MJS A;  2EKE C;  3B2G A;  3BY4 B;  1TS3 A;  3MC9 A;  4NJC A;  3TSS A;  3WA0 A;  4KGR A;  4KSK C;  4ZRK A;  2EMT A;  3AUL A;  4II2 B;  2ZW1 A;  1GOZ A;  3AE2 B;  4LNN A;  3CSF A;  4LLG M;  1N62 A;  2DWQ A;  3LYY A;  2V3S A;  2VRR B;  3FC4 A;  2KWC A;  2ZEQ A;  2LAS A;  2W82 A;  1FXT B;  1Q0W B;  1VLB A;  2NPT A;  2M0X A;  1GPX A;  4YSZ B;  5JHB A;  3AU5 A;  3FIL A;  2I1K A;  1PUT A;  2N7D A;  3EFC A;  4IM0 A;  1WJ4 A;  1XLP A;  4M0W B;  1ZPS A;  2H89 B;  1Y8R C;  2AL6 A;  2ICI A;  2LJ5 A;  1TJE A;  2KNB A;  2IO1 B;  3R7Q A;  3NS1 A;  3RNA C;  2V3N A;  2TSS A;  1FCL A;  3VR8 B;  3ZJT A;  2ZCB A;  1WGH A;  3T8M A;  5D6J B;  2DAF A;  3W5V B;  2SEB D;  3RNB C;  3ZO5 B;  1JML A;  4W9C A;  3C8Y A;  4BVU C;  1WXA A;  2G1E A;  1QZE A;  1WGK A;  4WH4 A;  1NBF C;  1V1P B;  1Q10 A;  2MP2 B;  3PGE A;  4WUR A;  1MVK A;  1SIF A;  4XC2 A;  3AMZ A;  3WCQ A;  1F77 A;  3D32 A;  1I4H A;  1N61 A;  2BWE S;  1H4R A;  2BW2 A;  1D5X C;  2BQQ A;  4MGK E;  1UBQ A;  2WU5 B;  4BAX A;  2R61 A;  3KWV A;  2M19 A;  2YEP B;  3EA6 A;  3AXC A;  3NHE B;  3AEE B;  1AN8 A;  3V6C B;  4DXG A;  2OED A;  2GBM A;  1HZ6 A;  4WJO A;  3PS6 A;  4EZJ A;  5G5H A;  2X8X X;  3VTV A;  2J4X A;  3EEC A;  1V5O A;  2KX0 A;  2MBQ A;  1QKZ A;  3HVD A;  4PT5 A;  4A6Q A;  3P63 A;  2JVC A;  2KFK A;  1VZ8 A;  1GB1 A;  1YN3 A;  3KLS X;  2LGY A;  2N1V A;  4O1N A;  1EWC A;  1EM7 A;  2MH7 A;  2QMT A;  4RF0 A;  4BKS D;  1OTR B;  3RNE C;  4RCO A;  3BWU D;  2QCZ A;  4LTU A;  1NEN B;  2JZ3 B;  1AWD A;  4ZOH C;  5LLI A;  2FCS A;  4S17 A;  2KVR A;  3IAM 1;  4C7Z A;  2UWQ A;  2WDT B;  3GZN B;  4A9A A;  2CHW A;  2KAN A;  4A3O A;  5BYR A;  1L0V B;  4RNA A;  1K8R B;  1XT9 B;  2FE8 A;  1SJE D;  3KUD B;  1ENF A;  4P16 A;  3V61 A;  3ZNI D;  1FXI A;  1LQB A;  1WMH B;  4N6E B;  3BK1 A;  2L0F A;  2FID A;  3ZNG C;  3OJ4 B;  2QIL A;  2W3S A;  4LNO A;  2J42 A;  2O6V B;  3A33 B;  2PVO D;  2I1J A;  3H7P B;  2PMV A;  3VTU A;  2D5G A;  3W1S C;  2KQ4 X;  4DK5 A;  1VCB A;  2B3A A;  2FAZ A;  2JT4 B;  3DBL I;  1ACC A;  2JWZ A;  3RN9 C;  4TQ0 A;  3UGB B;  3RT3 B;  3I57 A;  5HKH A;  3PLU A;  3PT2 B;  3RNF C;  4KKI A;  4A90 A;  1SE9 A;  2BYF A;  3KUZ A;  1PGX A;  1WJ6 A;  2Y5C A;  4BBN C;  3CF6 E;  4DXA B;  3VVW B;  4E3C A;  3EUB 2;  4LNI A;  1I7H A;  2JPH A;  4B9K A;  1QT9 A;  4OVV A;  4F1S A;  2VH1 A;  1WXV A;  1WWT A;  4LCD E;  1S3S G;  1MFW A;  1KM7 A;  3AE9 B;  4UDU C;  1GC7 A;  4AUQ C;  3I5J C;  3A9K A;  2MBE A;  1TBE A;  3Q8A A;  1WM2 A;  2MJ3 A;  4G0N B;  3ZRF A;  4ANX A;  4NQK E;  2DZJ A;  1WI0 A;  2BPS A;  3SHQ A;  4KGS A;  1R4M I;  2BTE A;  4RFB A;  1XXG A;  1J7C A;  3RUL A;  1BUI C;  3N30 A;  2REX A;  4YL8 A;  1WM3 A;  4G3X B;  1VDV A;  2L8J A;  4WWN A;  2ZW0 A;  4W9G A;  2C7H A;  3PRM B;  1YJI A;  1YJJ A;  4I6N B;  1WE7 A;  1MG4 A;  1YN5 A;  4FJV B;  2IBI B;  2D10 A;  2IO2 B;  4E71 A;  2LD9 A;  5E6P A;  1WIA A;  4II3 B;  3S2A A;  2IGD A;  2KKC A;  3RFZ B;  4RF1 A;  3NRZ A;  1PGA A;  3KWL A;  4X57 B;  3ZGZ A;  3Q3M C;  2EKI A;  1N6Z A;  3LXF A;  3RYT A;  1V80 A;  3TEY A;  4MM3 A;  1KJT A;  2FBW B;  5AZF A;  2JRI B;  4JE3 B;  3DVG X;  2KTR B;  1RWS A;  2O6V D;  3PZD A;  2L00 B;  2L83 A;  2LXC A;  2WXG A;  1WZ3 A;  5EE1 A;  2ACZ B;  1C3T A;  4GOC A;  1XEE A;  4OVZ A;  3AEF B;  1ISN A;  3MHS D;  3IT6 B;  4MJS B;  1A5R A;  1EF5 A;  2SAK A;  4HDO A;  1F52 A;  1T0S C;  2KN4 A;  3Q3J A;  2N7J A;  3DBR B;  3GE8 C;  2UYZ B;  2W55 A;  4ZRQ A;  2C7N B;  2KJR A;  2KLG A;  3TIX A;  2WX1 A;  4LJP B;  3CST A;  3B0A A;  4J3O D;  3PZ7 A;  4FUL A;  1F0Z A;  2WXR A;  2FUG 1;  2NPT B;  4BFR A;  4IC7 B;  4JPS A;  4ZRP A;  4NQL B;  3AE4 B;  3FIL B;  4TQ1 A;  3PV1 A;  1P7F A;  1RLF A;  1D5M C;  1J7B A;  1NI2 A;  5GMV A;  1WGD A;  5EE0 A;  1C9F A;  2WGS A;  4XYC A;  2FUH B;  2I2Y A;  4WWM A;  1WGR A;  3JW0 X;  4IM2 A;  4WQO B;  2FIF A;  1L2N A;  4PYZ A;  1MG8 A;  3R2T A;  1E5W A;  3M95 A;  1I4G A;  3AEG B;  4AWJ A;  4YTM B;  1PFD A;  1WH3 A;  2CS4 A;  1IBX A;  3KW5 B;  1C4P A;  4EZL A;  3VRB B;  1HEZ E;  1A70 A;  2JWU A;  1KTK A;  1SEB D;  1UGM A;  1SF0 A;  2Z59 B;  3E56 A;  1HQR D;  3R3M A;  2BS2 B;  1CK1 A;  2JU6 X;  2BYV E;  4MEL A;  1TYG B;  2NBU A;  2CKH B;  3ZXV A;  3O65 B;  1WJU A;  4HDQ A;  2LEK A;  3GE3 C;  3TUO A;  2WNM A;  1HTO A;  2I38 A;  3SFD B;  3DBS A;  1V8C A;  5JZE B;  4WIP A;  3RNG C;  1SGH A;  3WIM A;  4JWU C;  3Q3N C;  2N0S B;  3IBE A;  5BYS A;  5FR6 A;  2V9H A;  4K7U A;  3UIO B;  4KZ0 A;  2WXQ A;  3X23 A;  2RDG A;  1STE A;  2MBB B;  1UH6 A;  2AYO B;  1F2R C;  3OAW A;  1RM6 C;  2V4L A;  4ANU A;  4ICV A;  2KFK B;  3VTW A;  3VUY A;  2MEK A;  4DHJ B;  3PZ8 A;  3KUC B;  4ANV A;  2UU7 A;  1IP9 A;  5J18 A;  4I6P A;  1TS5 A;  1GUA B;  2ZNV B;  1L0Y B;  3HUI A;  1R7S A;  3QC8 B;  2ZVN A;  2W9N A;  1JQ4 A;  1FMA D;  5AEK B;  4ASW C;  5BMG A;  1MHX A;  1WYG A;  2DEN B;  2DZI A;  1QF6 A;  5D94 A;  4GU2 A;  3Q8B A;  4RM8 A;  1I4P A;  3PO0 A;  4FLH A;  1FXA A;  2MJD A;  4J6I A;  4C56 C;  1BT0 A;  1FCC C;  3NVY A;  1LXD A;  3JSV A;  3TCA A;  1RFK A;  2IO3 B;  3OJ3 A;  3VR9 B;  4REZ A;  1NYQ A;  2RPV A;  2PEA A;  4XE0 A;  4B6W A;  1Z2M A;  4KGT A;  4W9K A;  1KFY B;  4K7S A;  3NOB A;  2ZCC A;  4EE2 A;  1TTN A;  2KX3 A;  1HTQ A;  3R2I A;  3V05 A;  2INC C;  1PYW D;  3M63 B;  1SE4 A;  5JXV A;  2DZM A;  2IPK D;  1JWB D;  4HCP B;  4NPN A;  3DOW A;  4GMV A;  2LVQ A;  2L32 A;  5AUK A;  4CYE A;  3P42 A;  2AQ2 B;  4W9E A;  4Q2J A;  4BOZ B;  4AS1 A;  3IHP C;  1VJK A;  2KYW A;  3AB5 A;  2KWU B;  1ZKH A;  4M8N A;  2KN5 A;  4GIV A;  4H2A A;  5E6N A;  2KAC A;  3NY5 A;  4OVU A;  1CJE A;  2D3C A;  4AJY B;  2E6X A;  1C1Y B;  4US8 A;  1N5W A;  2N4F A;  2EMS A;  4IM3 A;  4M02 A;  5IA7 A;  4N9F 4;  1UD7 A;  3ENE A;  1WJN A;  2X38 A;  4XZ4 A;  4NNJ B;  2LXA A;  2JF5 A;  4TKN A;  3ZQ4 A;  2N9E B;  2PE9 A;  2KFJ A;  4XWW A;  5LXI B;  2JSV X;  2H88 B;  5D2M B;  1B9R A;  2MX2 A;  3K9P B;  4JGH B;  1DOI A;  4BKT A;  2W3R A;  2IJ0 A;  1K51 A;  3ZYY X;  5IP4 D;  2PW9 A;  1ROE A;  1TKG A;  2IY0 B;  2ZPN A;  2KQ7 A;  1AYF A;  1J0G A;  3KYD D;  2HD5 B;  3KYC D;  3W1S A;  3A9K B;  1L4D B;  1E7P B;  4WJQ A;  3TBL D;  4CHK A;  1K52 A;  3P4Q B;  1M4V A;  1FRR A;  1E7V A;  1WY8 A;  4MGI E;  2RR9 A;  2GBN A;  4HXD A;  2RSU A;  3U7D A;  3IG3 A;  3RNC C;  1KH0 A;  5HFY A;  4XX5 A;  2E3T A;  3J9C A;  4C4V A;  1JWA D;  1ZXI A;  1YNT E;  2WXL A;  4PYU A;  1X1M A;  2NTS A;  2KWD A;  3R8B A;  3AEC B;  3ZW3 A;  4WAA A;  2LUM A;  3NS8 A;  3APD A;  2YEP F;  3HM6 X;  3QAQ A;  3X0W A;  2KDB A;  3EC8 A;  2LGS A;  3I9V 1;  3L16 A;  3PRZ A;  2BS4 B;  4FXC A;  4YWG G;  2JY6 A;  2Z0E B;  4RGN A;  2N9L A;  2LHD A;  4FHK A;  2CJO A;  4L1B A;  3ZXR A;  3H8H A;  4MEM A;  4EOY A;  1I4Q A;  4MM3 B;  3RCZ A;  1T5X D;  1WF9 A;  1UWX A;  4W9L A;  5I4D A;  1ZUD 2;  4HRS A;  2R2O A;  2KC1 A;  5KHO A;  3A4S C;  5J17 A;  2QC8 A;  3QCA A;  2LFI A;  2DYO A;  5AZH A;  4EEW A;  5CHV C;  3L13 A;  2M56 B;  2WXI A;  4RH6 A;  2KK8 A;  2M0A A;  3BIN A;  3HRD D;  4FJZ A;  4JLC A;  4YTP B;  3ABV B;  1E8X A;  3NVV A;  2N9X A;  5H92 C;  1IUE A;  3R66 C;  2KJH B;  4ANW A;  2ZZP B;  2WWZ A;  1PQS A;  2OJR A;  3E9S A;  1OQR A;  3AEA B;  3PRP B;  3DBH I;  4EUT A;  2Z0D B;  1FNU A;  1Q1O A;  3MJW A;  4EKU A;  3L54 A;  3AV8 A;  2MHJ A;  2YVC A;  3N20 C;  1YIW A;  2LWP A;  5L95 C;  2KAJ A;  4NZL B;  2C5L C;  2KLC A;  1OGW A;  2LI5 A;  1OQY A;  2WXM A;  3SR6 A;  3AEB B;  4ZHO A;  1SBB B;  2K5P A;  2IY1 B;  3Q2A C;  2HTM E;  5IN7 A;  3RMK C;  1JCK B;  1N60 A;  4DHZ E;  1L5P A;  3JVZ X;  3Q3O C;  4RM9 A;  3ETR A;  3SFE B;  1IBX B;  4AQ7 A;  5HG2 A;  4HKQ A;  4M01 A;  1ZGU B;  1HZ5 A;  1OEY A;  2WP9 B;  2AQ3 B;  1K50 A;  4ZRJ A;  4ARI A;  1E6E B;  1XLN A;  3BVZ A;  2DX5 B;  3N1Z C;  4DWF A;  3Q8F A;  3VHT C;  3NJT A;  3SU8 X;  5FKA C;  1SXT A;  4K3B A;  3HVZ A;  2CR5 A;  3MC0 B;  4D2K A;  1HA5 A;  3DWG C;  2NMQ A;  2WDQ B;  3Q14 C;  2XK5 A;  5D3D A;  2JYE A;  1L4Z B;  2N7E A;  5T8I A;  2J7Q B;  1J7A A;  3OWE B;  3URY A;  4ZYS A;  4E74 A;  2V0G A;  3QA8 A;  2KMM A;  2L1A A;  1QOA A;  2BB6 A;  3T3N A;  2NTT A;  5EE3 A;  1V6E A;  3VH3 B;  4MDK E;  1T3Q A;  3Q8E A;  1GC6 A;  3GB1 A;  3QX1 A;  3L4P A;  2GLS A;  1FFV A;  2KC2 A;  1WX8 A;  1K53 A;  2D3G A;  4XGA B;  2D11 A;  4GDK A;  4QAY A;  3ONS A;  1TIF A;  1P98 A;  3JYU A;  4M8M A;  2XEW A;  2K6Q A;  2KQS A;  3KVF B;  3WAO A;  4P1C C;  3LJ3 A;  3BK2 A;  4PS7 A;  1VRA B;  1E7U A;  1SE3 A;  1E9M A;  3KH0 A;  4G50 A;  3JSV B;  4A55 A;  4A20 A;  3MFG A;  2LHE A;  2PJH A;  2MW5 A;  2LZ6 A;  5AUI A;  1Y56 A;  3RZF A;  2KMC A;  4BZA A;  4KX6 B;  3PLV A;  4M00 A;  3UIP B;  4ZHP A;  4YSX B;  3U7Z A;  2MBH A;  3GZN I;  4GDL A;  1QLB B;  2JQR B;  2MA9 B;  2KDE B;  4NJ7 A;  4TSS A;  1R4N B;  4F8C B;  4N58 A;  2VZK B;  2L0T A;  3QK0 A;  4GSW A;  1D3Z A;  4AP4 C;  4YXD B;  4W9H A;  1JAL A;  5JH5 C;  1WRI A;  3B9J A;  2HJ8 A;  2IGH A;  1KOT A;  3N1X C;  2K0P A;  2LGD A;  2BVC A;  5J2R A;  1FPY A;  1WR6 E;  1BXT A;  2ZJD A;  3DVN U;  2MJE A;  4HJK A;  2D2Q A;  2NVU I;  2MBO A;  2J0J A;  3BVM A;  4RGM A;  4IWP A;  4N59 A;  1P3Q U;  2WDR B;  2K1F A;  1JRO A;  1QOB A;  3MTN B;  1OQQ A;  1XD3 B;  2C7M B;  3WAM A;  3QHT A;  3LB8 C;  2Y5B B;  2KOX A;  1WXM A;  3RPF C;  1S1Q B;  4GGQ A;  1HE8 A;  1F9J A;  1WZ0 A;  2LJI A;  4ACF A;  2RGF A;  5AZG A;  3GOE A;  3TJP A;  3VFK A;  1U4A A;  2M8S A;  2DNF A;  2D07 B;  3AE6 B;  2GOW A;  2FNJ B;  2QDF A;  2IO0 B;  3KQ4 A;  3V6E B;  3UQB A;  1TT5 B;  3P4P B;  2CHX A;  4BBN F;  2Y3A A;  1SJH D;  2YLM A;  1PGB A;  1CMX B;  2QEJ C;  2QIE B;  2DBY A;  4MT5 A;  5BYQ A;  4C4V B;  4W9D A;  3TL5 A;  3Q6B A;  5DPW A;  3B2F A;  3ZKJ C;  2BKF A;  3AE5 B;  5IKC M;  4OHJ A;  3AH7 A;  3W5U B;  2KDI A;  1C76 A;  1V49 A;  2Y5P A;  4JWS C;  1MJD A;  3WAL A;  3FAH A;  4MGY E;  2CJN A;  2KHW B;  4C00 A;  4CQN A;  2NR2 A;  5KHQ A;  3QAR A;  1QOF A;  4JL9 A;  2A4Z A;  3GP7 A;  2INP E;  3VH4 B;  3NVZ A;  3DPD A;  2MCN B;  4DBG A;  2JXT A;  1P7E A;  3GS2 A;  4K7W A;  2J53 A;  2VZK D;  3W1Y A;  1IGD A;  2JZZ A;  4PS8 A;  1P1A A;  1YN4 A;  2MLB A;  3AED B;  1RAX A;  4JQW C;  4EFO A;  4HEA 1;  3NZS A;  4OZB A;  1ZW7 A;  3ZLZ A;  4NJ6 A;  2L7R A;  4TV3 A;  5C3J B;  3MP9 A;  1IGC A;  3ZNZ B;  5MPO A;  1FRD A;  5FR3 A;  4IWQ A;  2AQ1 B;  3EGR A;  3A9J A;  1WGG A;  1C78 A;  1BML C;  1OEY J;  2NS5 A;  1KLG D;  1YX5 B;  1JRP A;  2K8C A;  3TEZ A;  1GB4 A;  1E8Y A;  3PHX B;  2PE6 B;  4US9 A;  1JW9 D;  4W9J A;  4NAW A;  4MSQ B;  3MHZ A;  3DCG A;  4HK2 A;  2C9W B;  5TSS A;  1KRH A;  3DWM A;  3DBR I;  5CHF A;  1FD6 A;  4WWO A;  1LGR A;  4WQM A;  1QIL A;  4GN1 A;  1VR9 A;  3Q3F A;  2L52 A;  2XBB C;  4YT0 B;  5TR5 A;  3HHM A;  1L6U A;  4XDC A;  1E0Z A;  2DHZ A;  4HJG E;  3M62 B;  4P1B C;  2QSD A;  5GXG B;  3L10 B;  4KDL B;  2K6D B;  1NI3 A;  5DPT A;  1CQV A;  5LXH A;  2K9X A;  4OZC A;  4FHJ A;  3IXS A;  1RFA A;  1UUP A;  4PS3 A;  4K1R B;  2IND C;  1WFY A;  4KIK A;  2J0M A;  5DCN A;  1MPE A;  1JWU D;  3U30 A;  2WHI A;  4PK1 A;  3LDZ E;  4HKZ E;  3ZRC A;  4WAF A;  1WX9 A;  4LDT B;  1Z5S B;  4G11 A;  5JHA A;  2XK5 B;  3O13 A;  3T3O A;  3ZDM C;  4IW0 A;  4FAD A;  2IGG A;  1T6B X;  3EFU A;  2WU2 B;  1J19 A;  5CHW A;  3AE3 B;  4ZYN A;  2ASQ A;  1PDX A;  4DHJ D;  3IFW B;  4HLE A;  2CU1 A;  4JIO U;  3DBL B;  1WRD B;  1WGY A;  5BO4 B;  1V97 A;  4DHZ B;  2DZK A;  2KDM A;  4WJP A;  5CTR C;  1JRU A;  1CZP A;  2K22 A;  2RDH A;  2WXH A;  1SIJ A;  1VZ7 A;  1TKY A;  4GDK B;  5EDS A;  3IVF A;  3SD5 A;  2DYM A;  3RI7 C;  1FIQ A;  4FA6 A;  3AU4 A;  2GI9 A;  2J0K A;  2VH2 A;  2D3B A;  1WE6 A;  2DLB A;  1YQ3 B;  1DYQ A;  2BBC A;  1ET9 A;  3APC A;  4OW0 A;  5LNK 1;  1RYJ A;  3WAN A;  3OLM D;  4URK A;  4KKJ A;  3MC8 A;  5BMH A;  1SB3 C;  3UF8 A;  4C80 A;  5L83 A;  1GG3 A;  3N32 A;  1N63 A;  1E8Z A;  5E6J A;  5D7G A;  1NYR A;  4I6L B;  2OJW A;  4GDL B;  2KJ6 A;  2A5U A;  2AEH A;  1H8C A;  3I63 C;  3ZJV A;  3NZU A;  3DVG Y;  1MI0 A;  3OG5 A;  1E90 A;  1R4M B;  2HTH A;  2IDY A;  3UQA A;  1YQB A;  3A1Q A;  3AE1 B;  1TS2 A;  3L17 A;  3NVW A;  4K81 A;  3APF A;  2MQJ A;  2WLB A;  2V1Y A;  2DYB A;  1IYF A;  2O2V A;  1C79 A;  3B1L X;  3ZIM A;  1FNV A;  4B0E A;  2AX5 A;  3AE8 B;  4FBJ B;  2ZVO A;  2KXJ A;  2KTF A;  2JZP A;  3B08 A;  1L6V A;  5C1Z A;  1YOV B;  3PRE A;  2G3Q B;  3PTF C;  3BZD B;  4LK0 M;  2JRH A;  4ITK A;  3P4R B;  4LDT D;  2WXK A;  1V9J A;  3P1M A;  2LRW A;  2KD0 A;  3Q69 A;  1D4B A;  2LUE A;  4LNK A;  3Q8C A;  2BGF A;  4XDD A;  1P9D U;  5G5G A;  2K25 A;  2RMM A;  3CWI A;  4FJY A;  2WDV B;  2WXF A;  2V3P A;  2KVZ A;  2OOB B;  3PHW B;  1I35 A;  1ET6 A;  4YSY B;  1L0X B;  1ZDV A;  1YJ1 A;  4CO7 A;  3P2B A;  3DHH C;  4OZA A;  2JXX A;  2WQY B;  3HM3 A;  4BKS A;  4ARC A;  4A8X C;  1GJZ A;  4HVB A;  3TEW A;  3N3K B;  1I4R A;  1L7Y A;  3H7S A;  3PSE B;  2INN E;  4AJW A;  1FO4 A;  4W9F A;  3BYT B;  4MH8 A;  4B95 A;  2BB5 A;  3VRA B;  1AW7 A;  1HXY D;  3I3T B;  3EHV A;  1WX7 A;  1N5X A;  2KZR A;  3BYY B;  2BWF A;  1TZO A;  3QQ8 B;  1IPG A;  2K8H A;  4L23 A;  3TMP B;  2IZV B;  1QQR A;  3P4S B;  3BII D;  3V62 A;  1ZDX A;  1DGJ A;  1ZOY B;  2FCM A;  2EEL A;  4HWI B;  4IWO A;  2WX0 A;  4KVG B;  4M0W A;  1AAR A;  4MGZ E;  4USA A;  1KF6 B;  1J8C A;  3DHI C;  4JX1 C;  1WXQ A;  1YQ4 B;  4TUU A;  1RRB A;  1MHH E;  1F2R I;  2L3Z A;  3HIZ A;  2FCQ A;  3U2S C;  3ZUN A;  3K9O B;  4TMA B;  4KSL C;  2BT6 A;  2KWV B;  2CU3 A;  2PPH A;  2RD0 A;  1NVI D;  4F7Z A;  2J52 A;  3HK0 A;  3N9Y C;  1ZE3 D;  1SSN A;  4ZRI A;  3VAW A;  1UWM A;  2GBK A;  4W9I A;  2LGI A;  2GBJ A;  2LVO A;  1KLU D;  1TKE A;  3A9J B;  2FCN A;  2KDF B;  2K39 A;  2WXO A;  2RDB C;  1V1P A;  2BF8 B;  2MP2 A;  3VXW A;  2KO3 A;  2NCN A;  3IT4 B;  1FM0 D;  2HJ1 A;  2ZNV C;  1T0R C;  3L0W B;  4NAM A;  1TS4 A;  3RZW C;  1JWS D;  1Q5W B;  2WXN A;  4NAW B;  2G45 B;  5HHD G;  2PIA A;  3NZ3 A;  3VQI A;  3RD2 A;  5HI1 A;  3QJZ A;  2K3U A;  3ZNH B;  5IOI A;  1WXS A;  1XQQ A;  1XLQ A;  3BVG A;  4YTN B;  2GBR A;  3DQV A;  5IO9 A;  4HCN B;  4IOI E;  3R7R A;  3V60 A;  3SEB A;  1P0R A;  1V2Y A;  3T9L A;  1EU4 A;  1UF0 A;  1F1H A;  1XF5 L;  2QHO A;  1V5T A;  2HDE A;  3U4E G;  3C0R B;  3MJ5 A;  3L08 A;  2K8B A;  3UIN B;  5CX3 A;  4RGO S;  2GMI C;  2G4D B;  2C60 A;  3ZTC A;  2ONQ A;  3DVN V;  1T0Y A;  3VDZ A;  1QOG A;  2LRU A;  2BS3 B;  2WXJ A;  2L76 A;  1FFU A;  4P7I A;  2JYT A;  4FN2 A;  1UZX B;  3ZJU A;  1LFD A;  2PTL A;  4DDG D;  2HE7 A;  4KIK B;  2MWS B;  3IAS 1;  4NY0 A;  1M94 A;  1TY2 A;  4KZC A;  4L2Y A;  5IAA C;  2LMC A;  2V4I B;  1ZP0 B;  1EUV B;  5G2N A;  3NUH B;  4MH0 E;  1XCT L;  1JWM D;  4HPM B;  4KDI C;  3ML8 A;  1LO5 D;  3CIR B;  3AE7 B;  2KMA A;  2N1W A;  3ZVV A;  4IKG A;  3N1Y C;  4IDI A;  3NG0 A;  2GB1 A;  5FK9 C;  2Q5W D;  5DPR A;  1WYW B;  1WMH A;  4R3D A;  1XCQ L;  1VZ6 A;  2MRP A;  1G6J A;  2M4N A;  2AL3 A;  4XWT A;  2O6V A;  1DOY A;  3CMM B;  4GLS C;  2M17 A;  2CHZ A;  3H7P A;  1V81 A;  3QIJ A;  3ZTD A;  3ALB A;  4AOF A;  1DOX A;  4ZDV A;  3QWZ B;  3W2D A;  4WWP A;  3W9C B;  4IUM B;  4WJN A;  1T0Q C;  1EO6 A;  1FNW A;  5EE9 A;  3U52 E;  1KLV A;  3WAP A;  2ON8 A;  4LJO B;  1V1O A;  1ESF A;  2IYD B;  1I42 A;  1TY0 A;  4IG7 B;  2LGX A;  2W54 A;  5DPS A;  3H6N A;  4EZK A;  1GNU A;  2MSE D;  4S0R A;  4BOS C;  4DDI D;  4LNF A;  1V86 A;  2Z8L A;  4HPL B;  3SDL C;  1UNS A;  3ECI A;  4HRO A;  4K3C A;  2R2Q A;  4GXB A;  2JUO A;  1OFF A;  1WSP A;  1UBI A;  4P6V F;  4BKG A;  4DQO C;  5C23 A;  2N9K A;  3TEX A;  1TGZ B;  1LM8 B;  2M1M A;  2WYQ A;  2BYT A;  3A1Q B; 
#chains in the Genus database with same CATH homology
 4DHZ E;  5BO4 B;  4KV2 A;  2LVP A;  2O6V D;  3JVZ X;  3PZD A;  4DHZ B;  2BYE A;  2L00 B;  4RM9 A;  2LXC A;  2DZK A;  1WZ3 A;  1YD8 U;  4WJP A;  5CTR C;  1C3T A;  1JRU A;  3DVG X;  4GOC A;  1UEL A;  4MSM B;  3U8Z A;  1ISN A;  1ZGU B;  2O2V B;  1OEY A;  3MHS D;  4GDK B;  1R4N I;  4MJS B;  5EDS A;  4ZRJ A;  1EF5 A;  1A5R A;  4RMA A;  3A4R A;  2BKR B;  2L05 A;  3IVF A;  4HDO A;  2DYM A;  3SD5 A;  2DX5 B;  4DWF A;  3M3J A;  3Q3J A;  4FA6 A;  3AU4 A;  1E8W A;  2J0K A;  1WE6 A;  3VHT C;  1TZ1 A;  2UYZ B;  1YX6 B;  3SU8 X;  2G4S A;  2C7N B;  3APC A;  1VD2 A;  2KJR A;  2KLG A;  3DDC B;  2N9P C;  2WX1 A;  3TIX A;  4LJP B;  3WAN A;  3CST A;  3OLM D;  4URK A;  4A3P A;  1NDD A;  3B0A A;  3ML9 A;  4FUL A;  2CR5 A;  1WR1 A;  3ZDT A;  2ZPY A;  3UF8 A;  2NPT B;  4BFR A;  4IC7 B;  5L83 A;  4NQL B;  1GG3 A;  3N32 A;  2XK5 A;  1E8Z A;  2NBW B;  3PV1 A;  4TQ1 A;  5D7G A;  4I6L B;  2N7E A;  2J7Q B;  1RLF A;  4E74 A;  4GDL B;  2KJ6 A;  3QA8 A;  1NI2 A;  5GMV A;  1WGD A;  2A5U A;  2AEH A;  2DAJ A;  1H8C A;  2FUH B;  4ICU A;  3NZU A;  2AWT A;  3DVG Y;  1E90 A;  3PVL A;  1WGR A;  2HTH A;  3JW0 X;  3VUW A;  4IM2 A;  3PPA A;  2FIF A;  4WQO B;  1L2N A;  1EF1 A;  1V6E A;  3UQA A;  3VH3 B;  3RUI B;  4MDK E;  4PYZ A;  2KTR A;  1MG8 A;  1YQB A;  3A1Q A;  1E5W A;  3H1U A;  1GC6 A;  3AI5 A;  3VUX A;  5E6O A;  3L17 A;  3QX1 A;  3M95 A;  4K81 A;  3APF A;  3H9D A;  2MQJ A;  4AWJ A;  2RPQ A;  5G55 A;  1WH3 A;  2CS4 A;  3KW5 B;  2KC2 A;  2V1Y A;  2NBV B;  4GB9 A;  2DYB A;  1IYF A;  1WGY A;  1WX8 A;  2O2V A;  4EZL A;  3B1L X;  2D3G A;  2D11 A;  4GDK A;  3ZIM A;  4MJS A;  2EKE C;  3BY4 B;  1UGM A;  3ONS A;  4FBJ B;  1P98 A;  3JYU A;  4M8M A;  2ZVO A;  2Z59 B;  2XEW A;  2K6Q A;  2KQS A;  2KXJ A;  3R3M A;  3KVF B;  3WA0 A;  2KTF A;  3WAO A;  3LJ3 A;  4KSK C;  4PS7 A;  3B08 A;  4ZRK A;  1E7U A;  5C1Z A;  2EMT A;  2BYV E;  3KH0 A;  4G50 A;  3JSV B;  4MEL A;  3AUL A;  4A20 A;  2NBU A;  2CKH B;  3PRE A;  4II2 B;  2G3Q B;  3PTF C;  3O65 B;  1WJU A;  2JRH A;  3CSF A;  4HDQ A;  2PJH A;  2MW5 A;  2V3S A;  2LZ6 A;  2VRR B;  4LDT D;  2KWC A;  1V9J A;  2ZEQ A;  2LAS A;  2LRW A;  3RZF A;  1FXT B;  3DBS A;  2KD0 A;  1Q0W B;  5JZE B;  2KMC A;  2NPT A;  2M0X A;  1SGH A;  2LUE A;  3WIM A;  3PLV A;  5JHB A;  3IBE A;  3AU5 A;  3UIP B;  2BGF A;  5FR6 A;  2I1K A;  1P9D U;  2N7D A;  4IM0 A;  2K25 A;  1WJ4 A;  2MBH A;  4K7U A;  4M0W B;  3UIO B;  3GZN I;  4GDL A;  4KZ0 A;  1Y8R C;  2MA9 B;  4FJY A;  2KDE B;  3X23 A;  2AL6 A;  2MBB B;  4NJ7 A;  2LJ5 A;  1UH6 A;  2AYO B;  3OAW A;  2KNB A;  2V4L A;  4F8C B;  2IO1 B;  3R7Q A;  4ANU A;  2L0T A;  2OOB B;  3QK0 A;  4ICV A;  2KFK B;  3VTW A;  3PHW B;  4GSW A;  3VUY A;  1D3Z A;  2ZCB A;  1I35 A;  4DHJ B;  1WGH A;  3KUC B;  4AP4 C;  4ANV A;  3T8M A;  4W9H A;  1IP9 A;  5D6J B;  5J18 A;  2DAF A;  4I6P A;  1GUA B;  2ZNV B;  1YJ1 A;  3ZO5 B;  4CO7 A;  5JH5 C;  3P2B A;  2HJ8 A;  2JXX A;  3QC8 B;  2ZVN A;  4W9C A;  2W9N A;  1KOT A;  3HM3 A;  4BVU C;  5AEK B;  4ASW C;  1WXA A;  4BKS A;  1GJZ A;  4HVB A;  2DEN B;  2DZI A;  1QZE A;  3N3K B;  5D94 A;  4GU2 A;  2LGD A;  4RM8 A;  1L7Y A;  3H7S A;  3PSE B;  1NBF C;  4AJW A;  2MP2 B;  3PGE A;  4FLH A;  5J2R A;  4W9F A;  1WR6 E;  1SIF A;  4J6I A;  4B95 A;  1BT0 A;  4XC2 A;  2ZJD A;  3DVN U;  4HJK A;  2D2Q A;  2NVU I;  2MBO A;  2J0J A;  3D32 A;  1LXD A;  3JSV A;  4IWP A;  3I3T B;  3TCA A;  2BWE S;  1H4R A;  1P3Q U;  1WX7 A;  2IO3 B;  2KZR A;  3EHV A;  3OJ3 A;  2BWF A;  3QQ8 B;  2K1F A;  2PEA A;  4MGK E;  4B6W A;  1UBQ A;  1IPG A;  1Z2M A;  3MTN B;  2K8H A;  3TMP B;  1XD3 B;  2IZV B;  4W9K A;  2C7M B;  3WAM A;  4K7S A;  3QHT A;  2Y5B B;  2KOX A;  3NOB A;  1WXM A;  2ZCC A;  1TTN A;  3V62 A;  3AXC A;  3NHE B;  2KX3 A;  3V6C B;  1S1Q B;  4GGQ A;  1HE8 A;  1F9J A;  1WZ0 A;  2FCM A;  2GBM A;  4HWI B;  2WX0 A;  4IWO A;  2RGF A;  5AZG A;  4KVG B;  4WJO A;  3GOE A;  3TJP A;  3PS6 A;  4EZJ A;  3M63 B;  3VFK A;  1AAR A;  4MGZ E;  2DZM A;  1U4A A;  2M8S A;  1J8C A;  2D07 B;  4HCP B;  2GOW A;  2FNJ B;  4TUU A;  4NPN A;  3DOW A;  3EEC A;  1RRB A;  1V5O A;  2KX0 A;  2MBQ A;  4GMV A;  2LVQ A;  2L3Z A;  2IO0 B;  3HIZ A;  4CYE A;  2JVC A;  2KFK A;  2FCQ A;  3ZUN A;  3K9O B;  2LGY A;  4W9E A;  4BOZ B;  4KSL C;  2N1V A;  2KWV B;  3V6E B;  2PPH A;  2RD0 A;  3IHP C;  3UQB A;  4BKS D;  4F7Z A;  4BBN F;  2CHX A;  2KWU B;  1ZKH A;  4M8N A;  3HK0 A;  2KN5 A;  4GIV A;  1OTR B;  5E6N A;  2YLM A;  4ZRI A;  3VAW A;  1CMX B;  2GBK A;  3NY5 A;  4OVU A;  4W9I A;  2LVO A;  2GBJ A;  4W9D A;  4AJY B;  1C1Y B;  3A9J B;  2N4F A;  2FCN A;  3TL5 A;  2EMS A;  2JZ3 B;  2KDF B;  4IM3 A;  2K39 A;  5IA7 A;  5LLI A;  2BF8 B;  2MP2 A;  4N9F 4;  3VXW A;  2KO3 A;  2NCN A;  2FCS A;  1UD7 A;  3ENE A;  2KVR A;  2ZNV C;  5DPW A;  3L0W B;  1WJN A;  4XZ4 A;  2UWQ A;  4NNJ B;  2WDT B;  2LXA A;  3ZKJ C;  2BKF A;  3RZW C;  1Q5W B;  2JF5 A;  4TKN A;  2KDI A;  1V49 A;  2G45 B;  2CHW A;  2KFJ A;  2N9E B;  2PE9 A;  4NAW B;  5LXI B;  2KAN A;  3WAL A;  4A3O A;  4MGY E;  3RD2 A;  3VQI A;  5D2M B;  2MX2 A;  2KHW B;  3K9P B;  4JGH B;  1K8R B;  3QJZ A;  4BKT A;  2NR2 A;  5KHQ A;  1XT9 B;  3ZNH B;  3KUD B;  3QAR A;  1WXS A;  3V61 A;  1XQQ A;  4JL9 A;  2A4Z A;  3ZNI D;  2GBR A;  3DQV A;  3VH4 B;  4HCN B;  2IY0 B;  2ZPN A;  2MCN B;  3DPD A;  4DBG A;  2KQ7 A;  3R7R A;  1LQB A;  3V60 A;  1P0R A;  1V2Y A;  3T9L A;  1WMH B;  1J0G A;  3KYD D;  2HD5 B;  3KYC D;  4K7W A;  3W1S A;  3W1Y A;  2QHO A;  1V5T A;  3A9K B;  3C0R B;  2L0F A;  3L08 A;  2FID A;  2K8B A;  3ZNG C;  3OJ4 B;  4WJQ A;  3UIN B;  2JZZ A;  4PS8 A;  5CX3 A;  1P1A A;  2MLB A;  2O6V B;  3TBL D;  3A33 B;  2GMI C;  1RAX A;  4JQW C;  2G4D B;  2C60 A;  3ZTC A;  2I1J A;  4CHK A;  4EFO A;  3H7P B;  3NZS A;  3DVN V;  1T0Y A;  3VDZ A;  1ZW7 A;  3ZLZ A;  1E7V A;  1WY8 A;  2LRU A;  2RR9 A;  4MGI E;  2GBN A;  3VTU A;  4NJ6 A;  4HXD A;  2L7R A;  2L76 A;  2RSU A;  3U7D A;  3IG3 A;  3W1S C;  4TV3 A;  4DK5 A;  1VCB A;  4P7I A;  4XX5 A;  2B3A A;  2FAZ A;  2JT4 B;  3DBL I;  3ZNZ B;  4FN2 A;  1UZX B;  2JWZ A;  4TQ0 A;  3UGB B;  3RT3 B;  1LFD A;  4IWQ A;  4DDG D;  2HE7 A;  4KIK B;  2MWS B;  3A9J A;  1WGG A;  4NY0 A;  1M94 A;  4PYU A;  1X1M A;  5HKH A;  1OEY J;  2NS5 A;  3PLU A;  4KZC A;  5IAA C;  3PT2 B;  1YX5 B;  2K8C A;  3ZW3 A;  4WAA A;  1SE9 A;  3NS8 A;  1E8Y A;  3APD A;  3PHX B;  2BYF A;  3KUZ A;  1WJ6 A;  3HM6 X;  4BBN C;  3CF6 E;  2PE6 B;  3QAQ A;  4DXA B;  4W9J A;  4NAW A;  4MSQ B;  3DCG A;  1EUV B;  3X0W A;  2KDB A;  3EC8 A;  5G2N A;  3VVW B;  4HK2 A;  2C9W B;  4E3C A;  4MH0 E;  3L16 A;  4HPM B;  4KDI C;  3DBR I;  2JPH A;  4B9K A;  4OVV A;  3PRZ A;  4F1S A;  5CHF A;  3ML8 A;  4WWO A;  2JY6 A;  2Z0E B;  1WXV A;  4LCD E;  1S3S G;  2KMA A;  2N1W A;  3ZVV A;  4GN1 A;  4FHK A;  3Q3F A;  2XBB C;  1KM7 A;  4MEM A;  4EOY A;  5TR5 A;  5DPR A;  3RCZ A;  3HHM A;  1WYW B;  1WMH A;  1WF9 A;  1GC7 A;  4AUQ C;  4W9L A;  3A9K A;  2MRP A;  2MBE A;  1G6J A;  1TBE A;  2R2O A;  2M4N A;  1WM2 A;  2DHZ A;  3M62 B;  4G0N B;  2KC1 A;  2AL3 A;  3L10 B;  5KHO A;  3A4S C;  3ZRF A;  5J17 A;  4KDL B;  2O6V A;  4ANX A;  3QCA A;  2K6D B;  3CMM B;  2DYO A;  4NQK E;  2DZJ A;  5DPT A;  2M17 A;  5AZH A;  5CHV C;  2CHZ A;  3H7P A;  3L13 A;  4EEW A;  5LXH A;  1WI0 A;  2BPS A;  2KK8 A;  1V81 A;  3QIJ A;  3SHQ A;  3ZTD A;  3BIN A;  3ALB A;  4FHJ A;  4AOF A;  1R4M I;  4FJZ A;  4ZDV A;  3QWZ B;  4JLC A;  1RFA A;  3RUL A;  4WWP A;  4PS3 A;  4IUM B;  1E8X A;  4K1R B;  2N9X A;  4WJN A;  3N30 A;  2REX A;  4YL8 A;  1EO6 A;  1WM3 A;  3R66 C;  4G3X B;  1KLV A;  3WAP A;  2L8J A;  4WWN A;  1WFY A;  2KJH B;  4KIK A;  4ANW A;  2ZZP B;  2J0M A;  2WWZ A;  5DCN A;  4LJO B;  4W9G A;  1PQS A;  2OJR A;  2C7H A;  2IYD B;  3U30 A;  3PRM B;  1I42 A;  4I6N B;  1WE7 A;  3PRP B;  4IG7 B;  3LDZ E;  3DBH I;  2LGX A;  5DPS A;  4EUT A;  2Z0D B;  4FJV B;  2IBI B;  1Q1O A;  3H6N A;  3ZRC A;  3MJW A;  4EKU A;  3L54 A;  1WX9 A;  4LDT B;  1Z5S B;  2D10 A;  2IO2 B;  4E71 A;  4G11 A;  2YVC A;  2LD9 A;  1YIW A;  2LWP A;  1GNU A;  2MSE D;  2XK5 B;  4EZK A;  5JHA A;  5E6P A;  1WIA A;  4II3 B;  3S2A A;  5L95 C;  4BOS C;  2KKC A;  3ZDM C;  4IW0 A;  2C5L C;  2KLC A;  4FAD A;  4DDI D;  1OGW A;  2LI5 A;  1V86 A;  1OQY A;  4HPL B;  3EFU A;  3SDL C;  3ECI A;  4X57 B;  3VTV A;  1J19 A;  2R2Q A;  4GXB A;  2JUO A;  2IY1 B;  5CHW A;  3RYT A;  1V80 A;  4ZYN A;  1UBI A;  2ASQ A;  4DHJ D;  3IFW B;  4HLE A;  4BKG A;  5C23 A;  2CU1 A;  4JIO U;  4MM3 A;  1TGZ B;  1LM8 B;  1KJT A;  5AZF A;  2M1M A;  2WYQ A;  2JRI B;  1WRD B;  2KTR B;  3A1Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...