2M19A

Solution structure of the haloferax volcanii hvo 2177 protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
106
structure length
106
Chain Sequence
GGGRDYKDDDDKGTMELELRFFATFREVVGQKSIYWRVDDDATVGDVLRSLEAEYDGLAGRLIEDGEVKPHVNVLKNGREVVHLDGMATALDDGDAVSVFPPVAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ubiquitin-like small archaeal modifier protein 2 from Haloferax volcanii.
pubmed doi rcsb
source organism Haloferax volcanii
molecule tags Protein binding
molecule keywords Molybdopterin converting factor subunit 1
total genus 17
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2m19A00
1DOYA 3B2GA 1RM6C 3B2FA 1QOAA 4ZHOA 1QT9A 1ZP0B 4YSXB 2MJEA 1WWTA 1T3QA 3EUB2 5G5GA 3ABVB 1QLBB 1QOGA 1QOFA 1ZUD2 1FRRA 2WU2B 3CWIA 2QJLA 1TYGB 1ROEA 3AE5B 3NS1A 1YQ3B 4JX1C 4KX6B 4A9AA 1FM0D 1NYRA 1YJIA 1XLOA 3BIID 2WU5B 4N58A 4ZOHC 5H92C 1JWBD 1N5WA 1KRHA 1JWAD 2DBYA 3AH7A 1OQRA 1VLBA 3AEDB 1NVID 4C7YA 1FIQA 1J7CA 1QF6A 3P1MA 1XO3A 4N6EB 5EE3A 3AE8B 2MJDA 3DWMA 4IDIA 4US9A 1FRDA 3NVYA 1TKEA 3WCQA 1N60A 1V8CA 1CZPA 2FBWB 1E6EB 1YQ4B 1SIJA 1V97A 3SR6A 1J7BA 1FXAA 2LEKA 4WWMA 1FFVA 3P4PB 2BS3B 1F0ZA 3W5UB 3AN1A 4C80A 1FXIA 2E3TA 2WLBA 1L5PA 4YTNB 1VJKA 1JQ4A 5MPOA 1RYJA 1SB3C 4YTMB 4N59A 3VRAB 3VR8B 2CU3A 1NENB 2K22A 2G1EA 2PVGC 1ZXIA 3AB5A 4JWSC 2WDQB 1XLPA 2AX5A 4USAA 1KF6B 4HRSA 1GAQB 1YJJA 2WDVB 3AE2B 2WS3B 1N5XA 2DWQA 2Y5CA 3KWLA 3AE4B 1PUTA 3VR9B 1NEKB 2K5PA 3HUIA 1E10A 1XLQA 4YSZB 1B9RA 1AYFA 1NI3A 3LB8C 5EE1A 1N63A 1OQQA 2BT6A 2BS2B 3ETRA 5AUKA 3FC4A 2W3RA 1AWDA 3B9JA 4YTPB 1R7SA 2L83A 2OHFA 3AE6B 1E7PB 1DOIA 2JQRB 1ZOYB 1N62A 3NVVA 1CJEA 3ZYYX 4YSYB 5GXGB 3PO0A 1IUEA 2CJOA 3P63A 4P6VF 1DGJA 2N0SB 3FAHA 3NRZA 1RWSA 1JROA 1PFDA 2PKOA 3AEFB 4JWUC 3VRBB 1E9MA 1A70A 2CJNA 2M19A 3AE3B 5H8YE 3L4PA 1TJEA 1L6VA 2H89B 4US8A 4YXDB 1FO4A 1I7HA 1XLNA 1DOXA 2B76B 1WRIA 3SFEB 2M56B 3AEGB 1SF0A 2BS4B 2PIAA 2WDRB 1UWMA 3AE9B 1EWYC 1KFYB 2Q5WD 4WQMA 3P4SB 1WXQA 4ZHPA 1WGKA 1FMAD 3AV8A 3P4QB 1J7AA 1FFUA 2W55A 1NYQA 1TKYA 2MH7A 2JX5A 2KAJA 1PDXA 2WP9B 1GPXA 1TKGA 2WQYB 3AECB 1N61A 1L6UA 2L52A 3AE1B 2QIEB 3CIRB 3LXFA 1JW9D 4FXCA 3DWGC 3RPFC 2W3SA 2EKIA 5EE0A 1JRPA 3HVZA 3P4RB 1OFFA 5C3JB 2ACZB 1E0ZA 3AEEB 3AEAB 3NVZA 4HROA 3W5VB 4LTUA 4ITKA 1QOBA 1VDVA 4C7ZA 4YT0B 2H88B 3AM9A 2PVOD 1JALA 2W54A 3AE7B 1WYGA 3NVWA 3AMZA 5AUIA 3W9CB 2HTME 2MJ3A 5G5HA 3HRDD 5EE9A 5C2TB 3AEBB 2KMMA 3SFDB 2K9XA 1RFKA 1L0VB
chains in the Genus database with same CATH superfamily
4W9FA 3C8YA 2KJHB 5D2MB 2FAZA 4YSXB 1L0YB 2GB1A 3O13A 4MACA 4RF0A 3OWEB 1FCLA 2V1YA 4TQ1A 2NS5A 2JVCA 1DYQA 3N3KB 1GG3A 3PHXB 4S17A 4K81A 3DVGY 2ZPNA 3QK0A 1NVID 1TKEA 1UELA 1V2YA 1SBBB 3WCQA 1E6EB 1WXVA 4N9F4 1FXAA 2LEKA 1FFVA 1H4RA 3W5UB 2KDMA 1RAXA 2MEKA 3I57A 3PGEA 1ZXIA 2I2YA 5E6PA 4RNAA 1TT5B 4BOZB 1GC6A 2MX2A 2QHOA 3CSFA 4OW0A 1XLQA 4WJOA 1B9RA 1OQQA 2JU6X 5AUKA 2WXJA 4A20A 4HKZE 1AW7A 3DBHB 1HXYD 2NMQA 1S3SG 4MSQB 2KK8A 2DYMA 4XWTA 4LLGM 3ENEA 1I7HA 3PHWB 3SFEB 2RDHA 2G45B 3UQBA 2KX3A 2GI9A 2WP9B 3ZJTA 2ZCBA 4KGTA 1WXAA 4F8CB 1UBQA 2L0FA 1WX8A 4EOYA 1X1MA 5JHAA 4YT0B 4OZAA 3BK2A 2WNMA 2JXTA 2N9KA 4KV2A 2FUG1 2FCSA 3L16A 2TSSA 4LCDE 1RFKA 3B2GA 3MC8A 2LGXA 3Q8EA 2M0AA 3EUB2 3WA0A 3ABVB 2V4LA 5E6OA 4DXAB 3RI7C 1V80A 3A9KA 2WDTB 5E6JA 2LJIA 5GMVA 4ZOHC 1GB1A 2D11A 1SE2A 4P16A 1JWBD 3IXSA 1KM7A 2MBHA 1ET6A 3W2DA 3H8HA 2NTTA 1K52A 4W9CA 4K1RB 2N4FA 4K7UA 3KH0A 3A9KB 3PREA 2ZPYA 4B95A 2E3TA 1C76A 5MPOA 2N9PC 3VQIA 4IKGA 3HIZA 1V6EA 4XZ4A 2REXA 2WS3B 3VAWA 1E8ZA 5HI1A 2V3NA 1R4NI 1KH0A 2IY1B 3GOEA 1CMXB 1J8CA 2BYEA 3BINA 5BMGA 2E6XA 2D07B 4YSYB 3M3JA 1V1PA 3H6NA 3NRZA 1TY2A 3N1ZC 2K1FA 1PFDA 2AQ2B 2CU1A 4AS1A 2KVZA 4NJ7A 2B76B 3X0WA 3UGBB 4G3XB 1SF0A 3NZ3A 1Z5SB 1WXQA 1QZEA 1PDXA 1ACCA 1TKGA 4O1NA 3ECIA 2QIEB 2DLBA 2MCNB 3R7QA 3Q3JA 2GMIC 2DYBA 4ITKA 1LXDA 2IO3B 3EHVA 4R3DA 1WXMA 2OJWA 4PYZA 1OTRB 4A3OA 2DZKA 2LHEA 3W9CB 1F52A 3ZJUA 2Z8LA 4W9LA 5C2TB 2N7DA 1BT0A 1DOYA 3TMPB 2L0TA 1GC7A 3ZUNA 4FJVB 3JYUA 1T3QA 3IBEA 4FULA 3VUYA 1F1HA 2J0KA 2KTRB 4N58A 1EU4A 1OQYA 4WIPA 4OZCA 4BOSC 1QF6A 5I4DA 2EELA 4N6EB 2SEBD 2UWQA 1XCTL 4BKGA 3JVZX 1V8CA 2KO3A 2KT7A 2GBMA 2FBWB 3U7ZA 4UDUC 4RGNA 2KYWA 2IGGA 4D2KA 2QEJC 2NBUA 1C78A 3BVGA 2JWZA 2JT4B 3RULA 3TL5A 1TS5A 3VRAB 2WXLA 2WX1A 3IT4B 2IO0B 4NQKE 3GE8C 3CSTA 5LLIA 2RR9A 3FKYA 3MTNB 2WXQA 4FN2A 1EO6A 1STEA 1I42A 2RMMA 3AI5A 1AWDA 2OHFA 2V9HA 4HEA1 5L83A 5GXGB 3PVLA 5HKHA 4JWUC 2PKOA 2BB5A 1E9MA 1C4CA 3A9JA 4AQ7A 2L8JA 2JZ3B 1UH6A 2Q5WD 1SJHD 2WWZA 3P4SB 1WM3A 5FR6A 1FMAD 1EM7A 3PZDA 4ARIA 1KLGD 1TKYA 2WXKA 5BYSA 4XC2A 2EMTA 2BQQA 4FXCA 3KVFB 1E90A 1ZPSA 1OEYA 5IA7A 3EFUA 2LJ5A 5L95C 2O6VA 3NVWA 2MSED 3H1UA 4DDID 1K53A 2W9NA 1E8YA 5FKAC 1JWSD 1K51A 2LUEA 3SU8X 1PGAA 1WIAA 4BVUC 4J3OD 1XXGA 3NS1A 1C79A 2N9XA 3RN9C 4A9AA 2EKEC 2O6VD 2UYZB 4XYCA 4BKSD 2RPQA 3A4RA 1E5WA 1J7CA 1FIQA 3P1MA 3A1QB 3EECA 3K9OB 4IDIA 4HK2A 2VZKD 4IM3A 3RUIB 1L4ZB 4HDQA 2A4ZA 2HD5B 2BYVE 4NNJB 4WWPA 5C23A 5JZEB 4S0RA 1J7BA 3DQVA 5FK9C 1XEEA 1YN5A 2FCQA 2WLBA 4JL9A 3DBSA 3APDA 2G3QB 5JH5C 3ZXRA 4CO7A 5BYQA 4REZA 1C4AA 4HRSA 2KDEB 2JXXA 2IO1B 3QHTA 1NEKB 1NI3A 2BT6A 3ZDMC 2KWUB 1IBXA 1F2RC 2N9EB 2RPVA 1E7PB 1LO5D 4NY0A 5BMHA 2PE6B 4ASWC 1WM2A 4XDCA 1TTNA 2UU7A 3L08A 1YQBA 3V62A 4LDTD 5BMIA 4BFRA 2BS4B 3NY5A 5E6NA 3AU4A 4ZHPA 2N1VA 2AL3A 1L2NA 2WXPA 3I5JC 2KJRA 2EKIA 3DHIC 1Y56A 3PZ7A 4RGTA 2C7MB 2KFKA 3PRZA 4TUUA 2L7RA 2L00B 2IJ0A 4EUTA 5AUIA 1E7UA 1M94A 3I63C 4L1BA 4KDLB 3APFA 2BYFA 3BWUD 1ZUD2 5HFYA 4MGYE 2KQ4X 2BKFA 2WU5B 2V4IB 3Q3OC 3AH7A 2CR5A 2PTLA 2Z0DB 3VFKA 3V6CB 2LHDA 2INCC 1V81A 1R4MI 4LK0M 1I4HA 4FADA 1SIJA 1V97A 2LXAA 1U4AA 2KWVB 4WWMA 3AULA 1L5PA 1IP9A 3WAPA 3KUZA 2CU3A 2K22A 3T9LA 3DCGA 4TKNA 3RMKC 3NUHB 2BWFA 5J2RA 3AE2B 2Z59B 4KVGB 3KWLA 2ZW1A 2BW2A 3RNFC 4ZRPA 2K5PA 4FBJB 3RT3B 1V1OA 4WURA 4MM3A 2AEHA 3OG5A 1M4VA 2NVUI 4LJPB 5D6JB 1JWUD 3VVWB 4GLSC 3AE3B 1E8XA 1L6VA 2IO2B 5IOIA 2JYEA 1WMHA 2PW9A 2N7JA 1P1AA 2BVCA 2MWSB 3ZKJC 2K8HA 4HJKA 4WWOA 3H9DA 4PS8A 1XD3B 3SHQA 4LNIA 3HM3A 3BVZA 1V5TA 1MHHE 1RLFA 2VRRB 4C4VA 1XF5L 3W1YA 1MFWA 2J0JA 1QOAA 1JMLA 3IG3A 2OOBB 5G5GA 4B9KA 2LVOA 1JRUA 2JWUA 1NYRA 4EEWA 1XLOA 3AXCA 2KOXA 4ZYNA 4DXFA 5EE3A 4E71A 2KDFB 2PLPA 1YD8U 1YJ1A 4NPNA 2D3GA 2JSVX 3RNGC 2KXJA 1F0ZA 2KQSA 4WAFA 2XK5B 1P7FA 1RYJA 3Q8FA 3BVMA 2EMSA 1GAQB 1YJJA 3EA6A 4IOIE 3V61A 1B1ZA 1FEHA 4GDKA 4AWJA 1TGZB 3HUIA 3Q14C 2MHJA 3DVGX 2ZNVC 5EE1A 1N63A 4IWOA 2PPHA 2QCZA 3AE6B 2IYDB 3EGRA 2KTFA 3PO0A 4MH0E 3M95A 5C1ZA 4XE0A 1A70A 4J6IA 4ANVA 4G0NB 3PTFC 3U7DA 1F77A 2NBWB 4PT5A 4PK1A 2M56B 2XK5A 4GN1A 3GP7A 4ICVA 2JF5A 3AE9B 5J17A 1WGKA 3CIRB 3DVNU 3RPFC 2DZMA 2K8CA 1WX9A 4DQOC 3KLSX 3HVZA 3AEAB 2RDBC 1YX6B 3ZXVA 1VD2A 2HTME 2DZJA 1GB4A 2WGSA 1KJTA 2BF8B 3B2FA 1EU3A 2HTHA 3DDCB 1QT9A 2MJEA 4KDIC 3PRPB 4NAMA 5AZFA 2K3UA 4B0MA 2MA9B 3HVDA 4WQOB 2BGFA 3C0RB 4WAAA 2A5UA 2BYTA 1WYWB 1JWAD 3AEDB 1I4GA 3KYCD 2GLSA 4MGZE 3L54A 2LUMA 1IGDA 4HJGE 3E9SA 1UGJA 3MC9A 1CZPA 2CHZA 3A4SC 1SGHA 3EC8A 2GRIA 3P4PB 2KTRA 2M4NA 1XT9B 2XN9C 4LJOB 3NZUA 1FXIA 3B08A 1HTOA 3R8BA 1IPGA 4W9JA 1Z2MA 3J9CA 3QJZA 1TS4A 4X57B 3SDLC 2DHZA 2Y5BB 2KKCA 2WDVB 2LGDA 4F1SA 1NBFC 4TQ0A 2KZRA 3JSVB 4HCNB 1P9DU 1WJNA 4JQWC 1R7SA 5HHDG 2ZJDA 2WXNA 4TV3A 3PZ8A 1Q0WB 4K3CA 2J7QB 3AEFB 3NJTA 3M63B 4MSMB 2H89B 2LZ6A 2JY6A 3GB1A 1FXTB 4GSWA 4AJWA 1FD6A 2KMAA 4IG7B 2KNBA 3VXWA 1F9JA 2X8XX 2WQYB 1L6UA 2RDGA 4ANUA 4BKTA 2ZVNA 3Q6BA 4FA6A 2NBVB 3AM9A 1JALA 2PE9A 4RMAA 2KC1A 3AMZA 2ICIA 1TIFA 4OVVA 4MDKE 4DHJB 2BWES 4AOFA 3IFWB 4ZHOA 3TEYA 1YNTE 4MT5A 3PLVA 3RYTA 4E3CA 3URYA 2KFJA 1ZDXA 3R3MA 3NHEB 1WFYA 3S2AA 2AWTA 3MFGA 2DBYA 3KYDD 1XO3A 4DHJD 2GBKA 2KVRA 2R2OA 3U8ZA 3V6EB 2PJHA 3N20C 5J18A 2IDYA 2FIDA 2IZVB 2O6VB 2ZCCA 1SB3C 4YTMB 1T0RC 4H2AA 1AARA 2XBBC 3N1YC 2Z0EB 2KN5A 4MELA 4W9GA 2HE7A 3LB8C 3ETRA 2V0GA 5KHOA 2JQRB 1UZXB 1F2RI 2D3AA 2N0SB 5G55A 3ZIMA 3H7PB 3BYYB 4DWFA 1TJEA 2DENB 2AQ1B 2FE8A 4US8A 3ZDTA 1FO4A 5KHQA 4KGSA 2MBOA 2PIAA 1ESFA 1Q5WB 4A55A 2MH7A 3ZLZA 1PGBA 4BZAA 2LGYA 4KZCA 1WGRA 3AECB 3AE1B 1CQVA 4MGKE 5BYRA 2GOWA 2D10A 3H7PA 4EE2A 4GOCA 4C7ZA 3APCA 2WXIA 2PVOD 2W54A 3AE7B 5G5HA 3HRDD 5EE9A 2KMCA 4EFOA 2K9XA 1L0VB 2PEAA 3TUOA 1V1PB 4RH6A 3IAS1 1BUIC 1FRRA 4YL8A 3U4EG 4RM9A 1WRDB 1FM0D 2N7EA 5H92C 1N5WA 1WH3A 4YWGG 3BK1A 4HKQA 2M0XA 3UQAA 1D3ZA 1JCKB 3M62B 2QDFA 2K8BA 4M0WA 2ASQA 2FNJB 1C77A 1I4QA 1ISNA 2G1EA 2PVGC 3V60A 2KHWB 3EFCA 3Q3FA 4JWSC 2VH2A 2LRWA 1KF6B 3WIMA 2DWQA 2CKHB 4BKSA 2KWDA 4C56C 4EKUA 2NPTB 2L83A 3R66C 3T3OA 4KIKA 1CJEA 4W9HA 1C9FA 3SD5A 1DGJA 3FAHA 5LNK1 5IN7A 1PGXA 1WX7A 3RZWC 3NZSA 1SIFA 3RFZB 3VUWA 4ACFA 4K3BA 2BTEA 3ALBA 4WQMA 3WALA 3Q2AC 2D2QA 2YEPB 2KN4A 1N61A 1VR9A 3B1LX 3DWGC 1HA5A 3E56A 4AP4C 1MI0A 2HDEA 4MEMA 1VDVA 2CHXA 4HLEA 4KKJA 4L2YA 1WZ3A 3IHPC 2NPTA 3TEWA 4LNKA 5CTRC 4HDOA 1ZP0B 3SEBA 1UNSA 5FR3A 2FUHB 4JX1C 4HWIB 4E74A 4M01A 2N1WA 3BIID 3PS6A 1EF1A 3A9JB 3DBLB 1QKZA 1LQBA 4HPMB 4RGOS 4W9KA 1ZW7A 2MJDA 3RNEC 1N60A 2LASA 1WY8A 4XDDA 4RGMA 4I6LB 1H8CA 1WXSA 2ON8A 3N1XC 4GMVA 1WR6E 5BO4B 1RRBA 3AB5A 4JGHB 3N30A 3PLUA 1D5MC 3R2IA 3ZTCA 1SE4A 2KX0A 1WJUA 2C9WB 3AU5A 3ZNZB 4W9EA 3RD2A 2C7NB 2XEWA 3AE4B 2DAJA 3MC0B 3OJ3A 3MHZA 1UWXA 4CYEA 2WXHA 1WF9A 2BS2B 1WGHA 1EWCA 3D32A 2N9LA 3JW0X 2W82A 2PMVA 1VCBA 1UGMA 2JZZA 1N62A 2SAKA 4WJNA 2MQJA 3ML8A 2ZZPB 1WZ0A 1RFAA 4ZRIA 4GB9A 2MBEA 1A5RA 4GGQA 1VZ8A 2CJNA 2M19A 3RNAC 3L4PA 2RSUA 2V3SA 1N6ZA 2BB6A 2J4XA 3ZGZA 3U52E 2OEDA 1D5ZC 1BXTA 3AV8A 2W55A 2JX5A 4EZKA 1ZE3D 2L3ZA 1C3TA 2ZW0A 1OFFA 3CMMB 1AN8A 1KLVA 1E7VA 4DXGA 1WJ6A 3UIOB 3RCZA 1IBXB 5CHWA 2WX0A 5HG2A 3H7SA 1SE3A 2WXMA 3T8MA 2G4DB 1WWTA 2L76A 1SE9A 2WU2B 4HVBA 2Y5PA 2IY0B 3QA8A 2JRIB 1Q10A 4GDLB 4M0WB 2DNFA 5T8IA 5DPWA 2D3BA 1J0GA 2KC2A 4IW0A 1VLBA 3WANA 3N9YC 2M17A 3AE8B 1WGGA 1VZ6A 2QMTA 1TZ1A 4M00A 4OVZA 3AN1A 4N59A 4W9DA 4KIKB 1NENB 2KANA 2ZNVB 2HJ1A 1SXTA 3L10B 2WDQB 3L13A 3BY4B 1KOTA 1WJ4A 2QC8A 3P42A 2YVCA 4JE3B 3VTVA 4MH8A 2K6QA 4FJZA 4GDLA 3QARA 4YSZB 1P98A 4JIOU 3NS8A 2FIFA 3B9JA 4YTPB 3KUDB 3DOWA 1J19A 1HE8A 1V49A 1LGRA 1XLNA 4QAYA 2J42A 2J52A 4GIVA 1I4XA 1EWYC 1L0XB 3NOBA 2LXCA 1P0RA 2RGFA 3RZFA 1WI0A 2HJ8A 5EE0A 3P4RB 1K50A 1WE6A 2MW5A 3OLMD 1UF0A 4MJSA 3KQ4A 4KGRA 1GNUA 2YLMA 1ENFA 2KMMA 3DBHI 2O2VA 2INNE 1QLBB 1QOGA 3CWIA 1L7YA 1T0SC 1SSNA 3AE5B 5LXHA 3K9PB 4KX6B 4OZBA 2WXFA 3HM6X 3ZO5B 3ZW3A 1T0YA 5D7GA 3IVFA 4NQLB 2RD0A 5AZGA 1Y8RC 3ZNHB 4W9IA 3GZNB 3LJ3A 3OAWA 3OJ4B 4PYUA 4EZJA 3UIPB 3PPAA 2JPHA 4C80A 4K7SA 1VJKA 4IWQA 3C19A 1MJDA 4I6NB 2MBBB 3ML9A 2LVQA 1KTKA 2AX5A 3QAQA 1C1YB 2MP2A 4DDGD 5CX3A 3QQ8B 1AYFA 3U2SC 1TS2A 2W3RA 4NAWA 2WHIA 1HTQA 1ZOYB 5TSSA 5DCNA 1OGWA 3Q69A 4P6VF 4WH4A 1OEYJ 3T3NA 1WSPA 2MLBA 1DOXA 2FCNA 5JXVA 3UI3A 3WAOA 1NYQA 4ZRQA 3HHMA 2LFIA 3MJWA 2KLCA 1JRPA 2KD0A 1TZOA 3NVZA 3Q8BA 2AYOB 4PS7A 2LGSA 2K25A 1GPXA 4B0EA 1RM6C 4ZRKA 1KLUD 1XCQL 4II2B 1VRAB 3I3TB 1VZ7A 1SJED 4GU2A 3DBRI 4EZLA 1ZKHA 3GS2A 2C60A 4C00A 1UUPA 2VZKB 2LI5A 1YN4A 3VHTC 2NTSA 1WR1A 1EUVB 2KJ6A 4DHZB 2J53A 4RM8A 4ANWA 1JQ4A 4ZRJA 2BKRB 4RF1A 2LWPA 5G2NA 4P1CC 4BBNC 4TSSA 2G4SA 3B0AA 3KW5B 4XWWA 1LFDA 3N32A 2DZIA 3IAM1 2M8SA 4WJQA 2L1AA 3VR9B 3DBRB 2IGDA 1Q1OA 3TBLD 2I38A 3FC4A 2R61A 2G9HD 5IAAC 1DOIA 2DAFA 1HEZE 3ZRFA 4F7ZA 2WXGA 2KACA 2JRHA 5AZHA 3R7RA 2KDBA 3V3XA 3Q3NC 1FNUA 3DHGC 3LDZE 2M1MA 1S1QB 1WRIA 3GZNI 4LDTB 4K7WA 3MJ5A 1J7AA 3VUXA 3W1SA 4G11A 3TJPA 3I9V1 4HPLB 3RNCC 1JW9D 2V3PA 4ICUA 5C3JB 1GUAB 4HROA 2CS4A 3JSVA 4DBGA 1D6EC 2NR2A 4ZDVA 1EF5A 2WXRA 1BMLC 1ET9A 3VH3B 4L23A 4KZ0A 3AEBB 1ZXHA 3PSEB 5DPSA 2LRUA 2L05A 1TYGB 1IGCA 1C4PA 3ZTDA 1YX5B 2KDIA 1KRHA 1D4BA 3MHSD 5IO9A 4DK5A 1PQSA 1L4DB 4A3PA 2OJRA 4HCPB 4AUQC 2XNAC 1I4RA 4KSKC 2JUOA 2X38A 1HQRD 1V86A 1NI2A 1I4PA 4YTNB 2GBRA 4NZLB 5D94A 4FHJA 4JPSA 4II3B 1TY0A 2IPKD 3VTWA 4AJYB 2Y5CA 5CHVC 4B6WA 1ZGUB 1V5OA 1V9JA 3BYTB 2QSDA 2ONQA 2K6DB 1PYWD 2JZPA 1P7EA 3ZYYX 2CJOA 3P63A 3Q8CA 4Q2JA 3Q3MC 1MPEA 1RWSA 3VRBB 2LGIA 3VTUA 4XGAB 3ZNGC 2KLGA 4YXDB 5LXIB 1WGYA 4RFBA 3V05A 2WDRB 1MVKA 3U30A 1MG8A 4ZYSA 2DYOA 2LD9A 2KAJA 3BZDB 3TCAA 1T5XD 2L52A 3FILB 3LXFA 3O65B 2W3SA 3ZRCA 1E0ZA 2ACZB 2FCMA 4LTUA 1QOBA 1FCCC 2AQ3B 1WYGA 1WGDA 4LNFA 4P7IA 3SFDB 2ZVOA 2K0PA 1T6BX 4KKIA 1FNVA 1QOFA 3PT2B 5EDSA 1QILA 2QILA 1ROEA 2BBCA 1YQ3B 2GBJA 1YJIA 3UF8A 4I6PA 4WWNA 1OQRA 4C7YA 3HK0A 4M8NA 3DWMA 3L17A 1FRDA 3NVYA 3FILA 1IYFA 2Y3AA 4ARCA 3CF6E 5JHBA 3QX1A 2L32A 2GBNA 3SR6A 2KFKB 2YEPF 4IUMB 4RCOA 1P3QU 1WE7A 1I35A 4OHJA 1TS3A 1R4NB 5D3IB 1WMHB 5TR5A 3TEZA 3UINB 3VR8B 4CHKA 2KWCA 1TBEA 4USAA 1HZ5A 4M02A 3KUCB 3VH4B 4FJYA 2IBIB 2JYTA 1N5XA 3DPDA 1PUTA 3ZQ4A 2D5GA 4GXBA 2INDC 3NVVA 3GE3C 3KWVA 3MP9A 4URKA 1IUEA 1CK1A 1R4MB 2R2QA 4LNNA 1QQRA 2K39A 1JROA 1UD7A 4IM2A 4MGIE 5IKCM 3PRMB 1XQQA 2ZEQA 4NJCA 3WAMA 3LYYA 2DX5B 4M8MA 2B3AA 1FPYA 2MRPA 1E8WA 4PS3A 1KFYB 1YMHE 1FFUA 1LM8B 1G6JA 2LVPA 3A33B 1MHXA 3TIXA 1UBIA 3AEEB 3W5VB 4DHZE 5CHFA 1YIWA 1GJZA 4IM0A 2BPSA 2INPE 2MJ3A 3X23A 3A1QA 3Q8AA 3TSSA 4MM3B 3QWZB 3RNBC 4A6QA 4FLHA 4A8XC 2QJLA 2J0MA 1D5XC 4HXDA 2VH1A 1JWMD 2LMCA 1T0QC 4IWPA 3L0WB 4P1BC 2IGHA 4KSLC 4US9A 3QC8B 1HZ6A 3DBLI 3ONSA 4LNOA 1SEBD 1YQ4B 4BBNF 1K8RB 2BS3B 4MJSB 2D3CA 4OVUA 2CHWA 4C4VB 1XLPA 4BAXA 2O2VB 4FHKA 4XX5A 3PV1A 5IP4D 3NG0A 2I1JA 2MBQA 3P2BA 3W1SC 2C5LC 1E10A 1ZDVA 2C7HA 1GOZA 3DVNV 1FNWA 1YN3A 4HPPA 3ZNID 5DPTA 2KQ7A 2AL6A 3QIJA 2WYQA 4GDKB 5H8YE 3DHHC 2MP2B 4G50A 1NDDA 2NCNA 1YOVB 3AEGB 1UWMA 5D3DA 4JLCA 3P4QB 4CQNA 3TEXA 4NJ6A 3ZVVA 5AEKB 3IT6B 3R2TA 4ANXA 2H88B 2I1KA 4A90A 2WXOA 4IC7B 3VDZA 3QCAA 4NAWB 5DPRA 3ZJVA 1MG4A 4WJPA 4TMAB
chains in the Genus database with same CATH topology
4B0EA 1RM6C 1KLUD 1XCQL 3C8YA 3TUOA 4YSXB 1L0YB 1VRAB 3BWUD 1V1PB 2GB1A 3IAS1 3O13A 1BUIC 1VZ7A 1ZUD2 1FRRA 4RH6A 4MACA 4RF0A 1SJED 5HFYA 3OWEB 1FCLA 3U4EG 2KQ4X 4TQ1A 1FM0D 1DYQA 2WU5B 5H92C 1N5WA 2V4IB 3AH7A 1NVID 2PTLA 3GS2A 2LHDA 4YWGG 1TKEA 1UUPA 2VZKB 1YN4A 1SBBB 3WCQA 3BK1A 4LK0M 4HKQA 1I4HA 2NTSA 1E6EB 1SIJA 1V97A 1JCKB 1FXAA 2LEKA 4WWMA 1FFVA 2J53A 3W5UB 2KDMA 2MEKA 4M0WA 1L5PA 1C77A 3I57A 1I4QA 1JQ4A 2CU3A 2K22A 2G1EA 2PVGC 1ZXIA 4RF1A 2I2YA 4JWSC 4TSSA 3NUHB 4RNAA 1KF6B 3AE2B 4XWWA 2DWQA 3IAM1 3KWLA 2ZW1A 4TMAB 2BW2A 2L1AA 3VR9B 4ZRPA 2K5PA 4OW0A 1XLQA 2IGDA 1B9RA 2KWDA 1OQQA 2JU6X 2I38A 5AUKA 4C56C 3FC4A 2R61A 1V1OA 2G9HD 2WXJA 2L83A 4WURA 3T3OA 1DOIA 1HEZE 4HKZE 1CJEA 1AW7A 2WXGA 2KACA 1HXYD 1M4VA 1C9FA 3V3XA 2NMQA 1DGJA 3FAHA 1FNUA 5LNK1 1JWUD 1PGXA 2DYMA 4XWTA 4GLSC 3AE3B 4LLGM 3RFZB 1L6VA 1I7HA 1WRIA 3SFEB 2RDHA 2JYEA 2BTEA 3MJ5A 2PW9A 4WQMA 2N7JA 1J7AA 2YEPB 2GI9A 2KN4A 3W1SA 2WP9B 3ZJTA 4KGTA 3I9V1 1N61A 1VR9A 1JW9D 3DWGC 2V3PA 5C3JB 1HA5A 3E56A 4HROA 1MI0A 2HDEA 1VDVA 1D6EC 4YT0B 3BVZA 4OZAA 3BK2A 2WXRA 1BMLC 1ET9A 4KKJA 1MHHE 4L2YA 2WNMA 2JXTA 4L23A 2N9KA 2FUG1 3TEWA 3ZGZA 2TSSA 3AEBB 1ZXHA 1XF5L 1RFKA 3B2GA 1QOAA 1JMLA 1ZP0B 3SEBA 3Q8EA 2M0AA 3EUB2 5G5GA 1UNSA 3ABVB 1TYGB 5FR3A 5E6JA 4JX1C 1IGCA 2LJIA 2JWUA 1C4PA 1NYRA 3BIID 4ZOHC 1XLOA 1GB1A 1SE2A 4P16A 1JWBD 1KRHA 1D4BA 3IXSA 1QKZA 4DXFA 1ET6A 3W2DA 4RGOS 5EE3A 3H8HA 2MJDA 1L4DB 2NTTA 2PLPA 1N60A 1K52A 2XNAC 1I4RA 2JSVX 2X38A 1HQRD 4XDDA 1F0ZA 4RGMA 4WAFA 2E3TA 2ON8A 1C76A 1I4PA 4YTNB 1P7FA 4NZLB 5MPOA 1RYJA 3VQIA 4IKGA 3Q8FA 3AB5A 3BVMA 1D5MC 3R2IA 4JPSA 1SE4A 1GAQB 1YJJA 1TY0A 2IPKD 3EA6A 4IOIE 2WS3B 1B1ZA 1FEHA 2Y5CA 3AE4B 3MC0B 5HI1A 2V3NA 3HUIA 1KH0A 3MHZA 1UWXA 2WXHA 3BYTB 2QSDA 1N63A 2BS2B 5EE1A 1EWCA 2ONQA 2N9LA 3AE6B 2PMVA 2W82A 1PYWD 5BMGA 1N62A 2E6XA 2SAKA 3EGRA 2JZPA 1P7EA 3ZYYX 4YSYB 3PO0A 2CJOA 3P63A 3Q8CA 4Q2JA 1MPEA 1V1PA 3NRZA 1TY2A 1RWSA 1PFDA 3VRBB 2AQ2B 2LGIA 4XE0A 1A70A 1VZ8A 2CJNA 2M19A 3L4PA 4AS1A 4YXDB 1F77A 2B76B 2BB6A 2J4XA 4PT5A 2M56B 4RFBA 3V05A 3U52E 1SF0A 2OEDA 3GP7A 2WDRB 3NZ3A 1MVKA 3AE9B 1D5ZC 1WXQA 1BXTA 4ZYSA 2DYOA 1WGKA 3AV8A 2W55A 2JX5A 2KAJA 3BZDB 1PDXA 1ZE3D 1ACCA 1TKGA 1T5XD 3CIRB 2L52A 3FILB 4O1NA 2QIEB 2DLBA 3LXFA 2ZW0A 3RPFC 2W3SA 4DQOC 3KLSX 1E0ZA 3HVZA 1OFFA 2ACZB 3AEAB 1AN8A 4LTUA 4ITKA 1QOBA 4DXGA 4R3DA 1FCCC 2AQ3B 1WYGA 2LHEA 3W9CB 2HTME 1IBXB 3ZJUA 2Z8LA 5C2TB 5HG2A 3SFDB 1GB4A 1SE3A 2WXMA 1DOYA 3B2FA 1EU3A 2K0PA 1T6BX 1QT9A 4KKIA 2MJEA 1WWTA 1T3QA 1FNVA 1QOFA 2WU2B 4NAMA 2Y5PA 1QILA 2QILA 2K3UA 1ROEA 4B0MA 3HVDA 1Q10A 2BBCA 1YQ3B 4GDLB 1YJIA 4N58A 5T8IA 1EU4A 2BYTA 1JWAD 4WIPA 1OQRA 1VLBA 3AEDB 1I4GA 4OZCA 4C7YA 1QF6A 5I4DA 2EELA 3N9YC 4N6EB 3AE8B 2SEBD 3DWMA 1FRDA 3NVYA 2LUMA 1XCTL 1IGDA 3FILA 4HJGE 1VZ6A 2QMTA 1V8CA 3E9SA 1UGJA 2Y3AA 4ARCA 1CZPA 2FBWB 3U7ZA 2L32A 3SR6A 2YEPF 4UDUC 2GRIA 3P4PB 4RCOA 2XN9C 4OVZA 3AN1A 4RGNA 1FXIA 2IGGA 4D2KA 2QEJC 4OHJA 1C78A 1TS3A 3R8BA 3BVGA 5D3IB 3TEZA 1TS5A 4N59A 3VRAB 3VR8B 2WXLA 1NENB 3J9CA 3IT4B 1SXTA 1TS4A 2WDQB 4USAA 1HZ5A 2WDVB 3P42A 4JE3B 2JYTA 1N5XA 4TQ0A 1PUTA 4MH8A 2WXQA 4YSZB 3ZQ4A 1STEA 2RMMA 1AWDA 2D5GA 3B9JA 1R7SA 4YTPB 2OHFA 5HHDG 4HEA1 3NVVA 3KWVA 3MP9A 5GXGB 2WXNA 1IUEA 1CK1A 1QQRA 3PZ8A 1JROA 2PKOA 4JWUC 3AEFB 2BB5A 1E9MA 2H89B 4NJCA 3LYYA 1XLNA 1C4CA 3GB1A 2J42A 2J52A 4AQ7A 1I4XA 1EWYC 1KFYB 1SJHD 1L0XB 2Q5WD 1FD6A 3P4SB 1FMAD 1YMHE 1EM7A 4ARIA 1FFUA 1KLGD 1TKYA 2WXKA 5BYSA 2WQYB 1L6UA 4FXCA 1ZPSA 2RDGA 5EE0A 1MHXA 3P4RB 3AEEB 3W5VB 1K50A 3AM9A 1JALA 3KQ4A 4KGRA 3NVWA 3AMZA 2ICIA 2INPE 1ENFA 2MJ3A 2KMMA 1K53A 3Q8AA 3TSSA 4MM3B 5FKAC 1JWSD 4ZHOA 2INNE 1K51A 3TEYA 1YNTE 4MT5A 4A6QA 1PGAA 1QLBB 1QOGA 3CWIA 4J3OD 4A8XC 2QJLA 1XXGA 1SSNA 3AE5B 3NS1A 3URYA 1C79A 1ZDXA 4A9AA 4KX6B 4OZBA 2WXFA 5D7GA 1D5XC 1JWMD 3MFGA 2DBYA 2LMCA 1J7CA 1FIQA 3P1MA 1XO3A 2IGHA 4IDIA 4US9A 1HZ6A 2VZKD 1L4ZB 1SEBD 1YQ4B 1J7BA 5FK9C 1XEEA 2BS3B 1YN5A 4C80A 2IDYA 2WLBA 1VJKA 1SB3C 4YTMB 5BYQA 4H2AA 1XLPA 1KTKA 2AX5A 4REZA 1C4AA 4HRSA 1NEKB 1E10A 1AYFA 1NI3A 1ZDVA 3LB8C 3ETRA 1GOZA 2BT6A 3U2SC 2V0GA 1TS2A 2W3RA 1IBXA 1FNWA 1F2RC 1YN3A 2RPVA 1E7PB 1LO5D 2JQRB 1ZOYB 5TSSA 5BMHA 3Q69A 4P6VF 1F2RI 2N0SB 4WH4A 4XDCA 3BYYB 4GDKB 5H8YE 1TJEA 2AQ1B 2FE8A 4US8A 1FO4A 3T3NA 1WSPA 1DOXA 5BMIA 3AEGB 4KGSA 2BS4B 2PIAA 1UWMA 5JXVA 3UI3A 5D3DA 4ZHPA 1ESFA 3P4QB 4A55A 4CQNA 1NYQA 2MH7A 1PGBA 4ZRQA 2WXPA 3AECB 2LFIA 3AE1B 1CQVA 2EKIA 4RGTA 1Y56A 3PZ7A 5BYRA 1JRPA 1TZOA 3NVZA 3TEXA 4EE2A 3Q8BA 3IT6B 4C7ZA 3R2TA 2H88B 2WXIA 2IJ0A 2PVOD 2W54A 3AE7B 4A90A 5AUIA 2WXOA 5G5HA 3HRDD 4NAWB 5EE9A 3ZJVA 1GPXA 2K9XA 4L1BA 1L0VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOY A;  3B2G A;  1RM6 C;  3B2F A;  1QOA A;  4ZHO A;  1QT9 A;  1ZP0 B;  4YSX B;  2MJE A;  1WWT A;  1T3Q A;  3EUB 2;  5G5G A;  3ABV B;  1QLB B;  1QOG A;  1QOF A;  1ZUD 2;  1FRR A;  2WU2 B;  3CWI A;  2QJL A;  1TYG B;  1ROE A;  3AE5 B;  3NS1 A;  1YQ3 B;  4JX1 C;  4KX6 B;  4A9A A;  1FM0 D;  1NYR A;  1YJI A;  1XLO A;  3BII D;  2WU5 B;  4N58 A;  4ZOH C;  5H92 C;  1JWB D;  1N5W A;  1KRH A;  1JWA D;  2DBY A;  3AH7 A;  1OQR A;  1VLB A;  3AED B;  1NVI D;  4C7Y A;  1FIQ A;  1J7C A;  1QF6 A;  3P1M A;  1XO3 A;  4N6E B;  5EE3 A;  3AE8 B;  2MJD A;  3DWM A;  4IDI A;  4US9 A;  1FRD A;  3NVY A;  1TKE A;  3WCQ A;  1N60 A;  1V8C A;  1CZP A;  2FBW B;  1E6E B;  1YQ4 B;  1SIJ A;  1V97 A;  3SR6 A;  1J7B A;  1FXA A;  2LEK A;  4WWM A;  1FFV A;  3P4P B;  2BS3 B;  1F0Z A;  3W5U B;  3AN1 A;  4C80 A;  1FXI A;  2E3T A;  2WLB A;  1L5P A;  4YTN B;  1VJK A;  1JQ4 A;  5MPO A;  1RYJ A;  1SB3 C;  4YTM B;  4N59 A;  3VRA B;  3VR8 B;  2CU3 A;  1NEN B;  2K22 A;  2G1E A;  2PVG C;  1ZXI A;  3AB5 A;  4JWS C;  2WDQ B;  1XLP A;  2AX5 A;  4USA A;  1KF6 B;  4HRS A;  1GAQ B;  1YJJ A;  2WDV B;  3AE2 B;  2WS3 B;  1N5X A;  2DWQ A;  2Y5C A;  3KWL A;  3AE4 B;  1PUT A;  3VR9 B;  1NEK B;  2K5P A;  3HUI A;  1E10 A;  1XLQ A;  4YSZ B;  1B9R A;  1AYF A;  1NI3 A;  3LB8 C;  5EE1 A;  1N63 A;  1OQQ A;  2BT6 A;  2BS2 B;  3ETR A;  5AUK A;  3FC4 A;  2W3R A;  1AWD A;  3B9J A;  4YTP B;  1R7S A;  2L83 A;  2OHF A;  3AE6 B;  1E7P B;  1DOI A;  2JQR B;  1ZOY B;  1N62 A;  3NVV A;  1CJE A;  3ZYY X;  4YSY B;  5GXG B;  3PO0 A;  1IUE A;  2CJO A;  3P63 A;  4P6V F;  1DGJ A;  2N0S B;  3FAH A;  3NRZ A;  1RWS A;  1JRO A;  1PFD A;  2PKO A;  3AEF B;  4JWU C;  3VRB B;  1E9M A;  1A70 A;  2CJN A;  2M19 A;  3AE3 B;  5H8Y E;  3L4P A;  1TJE A;  1L6V A;  2H89 B;  4US8 A;  4YXD B;  1FO4 A;  1I7H A;  1XLN A;  1DOX A;  2B76 B;  1WRI A;  3SFE B;  2M56 B;  3AEG B;  1SF0 A;  2BS4 B;  2PIA A;  2WDR B;  1UWM A;  3AE9 B;  1EWY C;  1KFY B;  2Q5W D;  4WQM A;  3P4S B;  1WXQ A;  4ZHP A;  1WGK A;  1FMA D;  3AV8 A;  3P4Q B;  1J7A A;  1FFU A;  2W55 A;  1NYQ A;  1TKY A;  2MH7 A;  2JX5 A;  2KAJ A;  1PDX A;  2WP9 B;  1GPX A;  1TKG A;  2WQY B;  3AEC B;  1N61 A;  1L6U A;  2L52 A;  3AE1 B;  2QIE B;  3CIR B;  3LXF A;  1JW9 D;  4FXC A;  3DWG C;  3RPF C;  2W3S A;  2EKI A;  5EE0 A;  1JRP A;  3HVZ A;  3P4R B;  1OFF A;  5C3J B;  2ACZ B;  1E0Z A;  3AEE B;  3AEA B;  3NVZ A;  4HRO A;  3W5V B;  4LTU A;  4ITK A;  1QOB A;  1VDV A;  4C7Z A;  4YT0 B;  2H88 B;  3AM9 A;  2PVO D;  1JAL A;  2W54 A;  3AE7 B;  1WYG A;  3NVW A;  3AMZ A;  5AUI A;  3W9C B;  2HTM E;  2MJ3 A;  5G5H A;  3HRD D;  5EE9 A;  5C2T B;  3AEB B;  2KMM A;  3SFD B;  2K9X A;  1RFK A;  1L0V B; 
#chains in the Genus database with same CATH topology
 4W9F A;  3C8Y A;  2KJH B;  5D2M B;  2FAZ A;  4YSX B;  1L0Y B;  2GB1 A;  3O13 A;  4MAC A;  4RF0 A;  3OWE B;  1FCL A;  2V1Y A;  4TQ1 A;  2NS5 A;  2JVC A;  1DYQ A;  3N3K B;  1GG3 A;  3PHX B;  4S17 A;  4K81 A;  3DVG Y;  2ZPN A;  3QK0 A;  1NVI D;  1TKE A;  1UEL A;  1V2Y A;  1SBB B;  3WCQ A;  1E6E B;  1WXV A;  4N9F 4;  1FXA A;  2LEK A;  1FFV A;  1H4R A;  3W5U B;  2KDM A;  1RAX A;  2MEK A;  3I57 A;  3PGE A;  1ZXI A;  2I2Y A;  5E6P A;  4RNA A;  1TT5 B;  4BOZ B;  1GC6 A;  2MX2 A;  2QHO A;  3CSF A;  4OW0 A;  1XLQ A;  4WJO A;  1B9R A;  1OQQ A;  2JU6 X;  5AUK A;  2WXJ A;  4A20 A;  4HKZ E;  1AW7 A;  3DBH B;  1HXY D;  2NMQ A;  1S3S G;  4MSQ B;  2KK8 A;  2DYM A;  4XWT A;  4LLG M;  3ENE A;  1I7H A;  3PHW B;  3SFE B;  2RDH A;  2G45 B;  3UQB A;  2KX3 A;  2GI9 A;  2WP9 B;  3ZJT A;  2ZCB A;  4KGT A;  1WXA A;  4F8C B;  1UBQ A;  2L0F A;  1WX8 A;  4EOY A;  1X1M A;  5JHA A;  4YT0 B;  4OZA A;  3BK2 A;  2WNM A;  2JXT A;  2N9K A;  4KV2 A;  2FUG 1;  2FCS A;  3L16 A;  2TSS A;  4LCD E;  1RFK A;  3B2G A;  3MC8 A;  2LGX A;  3Q8E A;  2M0A A;  3EUB 2;  3WA0 A;  3ABV B;  2V4L A;  5E6O A;  4DXA B;  3RI7 C;  1V80 A;  3A9K A;  2WDT B;  5E6J A;  2LJI A;  5GMV A;  4ZOH C;  1GB1 A;  2D11 A;  1SE2 A;  4P16 A;  1JWB D;  3IXS A;  1KM7 A;  2MBH A;  1ET6 A;  3W2D A;  3H8H A;  2NTT A;  1K52 A;  4W9C A;  4K1R B;  2N4F A;  4K7U A;  3KH0 A;  3A9K B;  3PRE A;  2ZPY A;  4B95 A;  2E3T A;  1C76 A;  5MPO A;  2N9P C;  3VQI A;  4IKG A;  3HIZ A;  1V6E A;  4XZ4 A;  2REX A;  2WS3 B;  3VAW A;  1E8Z A;  5HI1 A;  2V3N A;  1R4N I;  1KH0 A;  2IY1 B;  3GOE A;  1CMX B;  1J8C A;  2BYE A;  3BIN A;  5BMG A;  2E6X A;  2D07 B;  4YSY B;  3M3J A;  1V1P A;  3H6N A;  3NRZ A;  1TY2 A;  3N1Z C;  2K1F A;  1PFD A;  2AQ2 B;  2CU1 A;  4AS1 A;  2KVZ A;  4NJ7 A;  2B76 B;  3X0W A;  3UGB B;  4G3X B;  1SF0 A;  3NZ3 A;  1Z5S B;  1WXQ A;  1QZE A;  1PDX A;  1ACC A;  1TKG A;  4O1N A;  3ECI A;  2QIE B;  2DLB A;  2MCN B;  3R7Q A;  3Q3J A;  2GMI C;  2DYB A;  4ITK A;  1LXD A;  2IO3 B;  3EHV A;  4R3D A;  1WXM A;  2OJW A;  4PYZ A;  1OTR B;  4A3O A;  2DZK A;  2LHE A;  3W9C B;  1F52 A;  3ZJU A;  2Z8L A;  4W9L A;  5C2T B;  2N7D A;  1BT0 A;  1DOY A;  3TMP B;  2L0T A;  1GC7 A;  3ZUN A;  4FJV B;  3JYU A;  1T3Q A;  3IBE A;  4FUL A;  3VUY A;  1F1H A;  2J0K A;  2KTR B;  4N58 A;  1EU4 A;  1OQY A;  4WIP A;  4OZC A;  4BOS C;  1QF6 A;  5I4D A;  2EEL A;  4N6E B;  2SEB D;  2UWQ A;  1XCT L;  4BKG A;  3JVZ X;  1V8C A;  2KO3 A;  2KT7 A;  2GBM A;  2FBW B;  3U7Z A;  4UDU C;  4RGN A;  2KYW A;  2IGG A;  4D2K A;  2QEJ C;  2NBU A;  1C78 A;  3BVG A;  2JWZ A;  2JT4 B;  3RUL A;  3TL5 A;  1TS5 A;  3VRA B;  2WXL A;  2WX1 A;  3IT4 B;  2IO0 B;  4NQK E;  3GE8 C;  3CST A;  5LLI A;  2RR9 A;  3FKY A;  3MTN B;  2WXQ A;  4FN2 A;  1EO6 A;  1STE A;  1I42 A;  2RMM A;  3AI5 A;  1AWD A;  2OHF A;  2V9H A;  4HEA 1;  5L83 A;  5GXG B;  3PVL A;  5HKH A;  4JWU C;  2PKO A;  2BB5 A;  1E9M A;  1C4C A;  3A9J A;  4AQ7 A;  2L8J A;  2JZ3 B;  1UH6 A;  2Q5W D;  1SJH D;  2WWZ A;  3P4S B;  1WM3 A;  5FR6 A;  1FMA D;  1EM7 A;  3PZD A;  4ARI A;  1KLG D;  1TKY A;  2WXK A;  5BYS A;  4XC2 A;  2EMT A;  2BQQ A;  4FXC A;  3KVF B;  1E90 A;  1ZPS A;  1OEY A;  5IA7 A;  3EFU A;  2LJ5 A;  5L95 C;  2O6V A;  3NVW A;  2MSE D;  3H1U A;  4DDI D;  1K53 A;  2W9N A;  1E8Y A;  5FKA C;  1JWS D;  1K51 A;  2LUE A;  3SU8 X;  1PGA A;  1WIA A;  4BVU C;  4J3O D;  1XXG A;  3NS1 A;  1C79 A;  2N9X A;  3RN9 C;  4A9A A;  2EKE C;  2O6V D;  2UYZ B;  4XYC A;  4BKS D;  2RPQ A;  3A4R A;  1E5W A;  1J7C A;  1FIQ A;  3P1M A;  3A1Q B;  3EEC A;  3K9O B;  4IDI A;  4HK2 A;  2VZK D;  4IM3 A;  3RUI B;  1L4Z B;  4HDQ A;  2A4Z A;  2HD5 B;  2BYV E;  4NNJ B;  4WWP A;  5C23 A;  5JZE B;  4S0R A;  1J7B A;  3DQV A;  5FK9 C;  1XEE A;  1YN5 A;  2FCQ A;  2WLB A;  4JL9 A;  3DBS A;  3APD A;  2G3Q B;  5JH5 C;  3ZXR A;  4CO7 A;  5BYQ A;  4REZ A;  1C4A A;  4HRS A;  2KDE B;  2JXX A;  2IO1 B;  3QHT A;  1NEK B;  1NI3 A;  2BT6 A;  3ZDM C;  2KWU B;  1IBX A;  1F2R C;  2N9E B;  2RPV A;  1E7P B;  1LO5 D;  4NY0 A;  5BMH A;  2PE6 B;  4ASW C;  1WM2 A;  4XDC A;  1TTN A;  2UU7 A;  3L08 A;  1YQB A;  3V62 A;  4LDT D;  5BMI A;  4BFR A;  2BS4 B;  3NY5 A;  5E6N A;  3AU4 A;  4ZHP A;  2N1V A;  2AL3 A;  1L2N A;  2WXP A;  3I5J C;  2KJR A;  2EKI A;  3DHI C;  1Y56 A;  3PZ7 A;  4RGT A;  2C7M B;  2KFK A;  3PRZ A;  4TUU A;  2L7R A;  2L00 B;  2IJ0 A;  4EUT A;  5AUI A;  1E7U A;  1M94 A;  3I63 C;  4L1B A;  4KDL B;  3APF A;  2BYF A;  3BWU D;  1ZUD 2;  5HFY A;  4MGY E;  2KQ4 X;  2BKF A;  2WU5 B;  2V4I B;  3Q3O C;  3AH7 A;  2CR5 A;  2PTL A;  2Z0D B;  3VFK A;  3V6C B;  2LHD A;  2INC C;  1V81 A;  1R4M I;  4LK0 M;  1I4H A;  4FAD A;  1SIJ A;  1V97 A;  2LXA A;  1U4A A;  2KWV B;  4WWM A;  3AUL A;  1L5P A;  1IP9 A;  3WAP A;  3KUZ A;  2CU3 A;  2K22 A;  3T9L A;  3DCG A;  4TKN A;  3RMK C;  3NUH B;  2BWF A;  5J2R A;  3AE2 B;  2Z59 B;  4KVG B;  3KWL A;  2ZW1 A;  2BW2 A;  3RNF C;  4ZRP A;  2K5P A;  4FBJ B;  3RT3 B;  1V1O A;  4WUR A;  4MM3 A;  2AEH A;  3OG5 A;  1M4V A;  2NVU I;  4LJP B;  5D6J B;  1JWU D;  3VVW B;  4GLS C;  3AE3 B;  1E8X A;  1L6V A;  2IO2 B;  5IOI A;  2JYE A;  1WMH A;  2PW9 A;  2N7J A;  1P1A A;  2BVC A;  2MWS B;  3ZKJ C;  2K8H A;  4HJK A;  4WWO A;  3H9D A;  4PS8 A;  1XD3 B;  3SHQ A;  4LNI A;  3HM3 A;  3BVZ A;  1V5T A;  1MHH E;  1RLF A;  2VRR B;  4C4V A;  1XF5 L;  3W1Y A;  1MFW A;  2J0J A;  1QOA A;  1JML A;  3IG3 A;  2OOB B;  5G5G A;  4B9K A;  2LVO A;  1JRU A;  2JWU A;  1NYR A;  4EEW A;  1XLO A;  3AXC A;  2KOX A;  4ZYN A;  4DXF A;  5EE3 A;  4E71 A;  2KDF B;  2PLP A;  1YD8 U;  1YJ1 A;  4NPN A;  2D3G A;  2JSV X;  3RNG C;  2KXJ A;  1F0Z A;  2KQS A;  4WAF A;  2XK5 B;  1P7F A;  1RYJ A;  3Q8F A;  3BVM A;  2EMS A;  1GAQ B;  1YJJ A;  3EA6 A;  4IOI E;  3V61 A;  1B1Z A;  1FEH A;  4GDK A;  4AWJ A;  1TGZ B;  3HUI A;  3Q14 C;  2MHJ A;  3DVG X;  2ZNV C;  5EE1 A;  1N63 A;  4IWO A;  2PPH A;  2QCZ A;  3AE6 B;  2IYD B;  3EGR A;  2KTF A;  3PO0 A;  4MH0 E;  3M95 A;  5C1Z A;  4XE0 A;  1A70 A;  4J6I A;  4ANV A;  4G0N B;  3PTF C;  3U7D A;  1F77 A;  2NBW B;  4PT5 A;  4PK1 A;  2M56 B;  2XK5 A;  4GN1 A;  3GP7 A;  4ICV A;  2JF5 A;  3AE9 B;  5J17 A;  1WGK A;  3CIR B;  3DVN U;  3RPF C;  2DZM A;  2K8C A;  1WX9 A;  4DQO C;  3KLS X;  3HVZ A;  3AEA B;  2RDB C;  1YX6 B;  3ZXV A;  1VD2 A;  2HTM E;  2DZJ A;  1GB4 A;  2WGS A;  1KJT A;  2BF8 B;  3B2F A;  1EU3 A;  2HTH A;  3DDC B;  1QT9 A;  2MJE A;  4KDI C;  3PRP B;  4NAM A;  5AZF A;  2K3U A;  4B0M A;  2MA9 B;  3HVD A;  4WQO B;  2BGF A;  3C0R B;  4WAA A;  2A5U A;  2BYT A;  1WYW B;  1JWA D;  3AED B;  1I4G A;  3KYC D;  2GLS A;  4MGZ E;  3L54 A;  2LUM A;  1IGD A;  4HJG E;  3E9S A;  1UGJ A;  3MC9 A;  1CZP A;  2CHZ A;  3A4S C;  1SGH A;  3EC8 A;  2GRI A;  3P4P B;  2KTR A;  2M4N A;  1XT9 B;  2XN9 C;  4LJO B;  3NZU A;  1FXI A;  3B08 A;  1HTO A;  3R8B A;  1IPG A;  4W9J A;  1Z2M A;  3J9C A;  3QJZ A;  1TS4 A;  4X57 B;  3SDL C;  2DHZ A;  2Y5B B;  2KKC A;  2WDV B;  2LGD A;  4F1S A;  1NBF C;  4TQ0 A;  2KZR A;  3JSV B;  4HCN B;  1P9D U;  1WJN A;  4JQW C;  1R7S A;  5HHD G;  2ZJD A;  2WXN A;  4TV3 A;  3PZ8 A;  1Q0W B;  4K3C A;  2J7Q B;  3AEF B;  3NJT A;  3M63 B;  4MSM B;  2H89 B;  2LZ6 A;  2JY6 A;  3GB1 A;  1FXT B;  4GSW A;  4AJW A;  1FD6 A;  2KMA A;  4IG7 B;  2KNB A;  3VXW A;  1F9J A;  2X8X X;  2WQY B;  1L6U A;  2RDG A;  4ANU A;  4BKT A;  2ZVN A;  3Q6B A;  4FA6 A;  2NBV B;  3AM9 A;  1JAL A;  2PE9 A;  4RMA A;  2KC1 A;  3AMZ A;  2ICI A;  1TIF A;  4OVV A;  4MDK E;  4DHJ B;  2BWE S;  4AOF A;  3IFW B;  4ZHO A;  3TEY A;  1YNT E;  4MT5 A;  3PLV A;  3RYT A;  4E3C A;  3URY A;  2KFJ A;  1ZDX A;  3R3M A;  3NHE B;  1WFY A;  3S2A A;  2AWT A;  3MFG A;  2DBY A;  3KYD D;  1XO3 A;  4DHJ D;  2GBK A;  2KVR A;  2R2O A;  3U8Z A;  3V6E B;  2PJH A;  3N20 C;  5J18 A;  2IDY A;  2FID A;  2IZV B;  2O6V B;  2ZCC A;  1SB3 C;  4YTM B;  1T0R C;  4H2A A;  1AAR A;  2XBB C;  3N1Y C;  2Z0E B;  2KN5 A;  4MEL A;  4W9G A;  2HE7 A;  3LB8 C;  3ETR A;  2V0G A;  5KHO A;  2JQR B;  1UZX B;  1F2R I;  2D3A A;  2N0S B;  5G55 A;  3ZIM A;  3H7P B;  3BYY B;  4DWF A;  1TJE A;  2DEN B;  2AQ1 B;  2FE8 A;  4US8 A;  3ZDT A;  1FO4 A;  5KHQ A;  4KGS A;  2MBO A;  2PIA A;  1ESF A;  1Q5W B;  4A55 A;  2MH7 A;  3ZLZ A;  1PGB A;  4BZA A;  2LGY A;  4KZC A;  1WGR A;  3AEC B;  3AE1 B;  1CQV A;  4MGK E;  5BYR A;  2GOW A;  2D10 A;  3H7P A;  4EE2 A;  4GOC A;  4C7Z A;  3APC A;  2WXI A;  2PVO D;  2W54 A;  3AE7 B;  5G5H A;  3HRD D;  5EE9 A;  2KMC A;  4EFO A;  2K9X A;  1L0V B;  2PEA A;  3TUO A;  1V1P B;  4RH6 A;  3IAS 1;  1BUI C;  1FRR A;  4YL8 A;  3U4E G;  4RM9 A;  1WRD B;  1FM0 D;  2N7E A;  5H92 C;  1N5W A;  1WH3 A;  4YWG G;  3BK1 A;  4HKQ A;  2M0X A;  3UQA A;  1D3Z A;  1JCK B;  3M62 B;  2QDF A;  2K8B A;  4M0W A;  2ASQ A;  2FNJ B;  1C77 A;  1I4Q A;  1ISN A;  2G1E A;  2PVG C;  3V60 A;  2KHW B;  3EFC A;  3Q3F A;  4JWS C;  2VH2 A;  2LRW A;  1KF6 B;  3WIM A;  2DWQ A;  2CKH B;  4BKS A;  2KWD A;  4C56 C;  4EKU A;  2NPT B;  2L83 A;  3R66 C;  3T3O A;  4KIK A;  1CJE A;  4W9H A;  1C9F A;  3SD5 A;  1DGJ A;  3FAH A;  5LNK 1;  5IN7 A;  1PGX A;  1WX7 A;  3RZW C;  3NZS A;  1SIF A;  3RFZ B;  3VUW A;  4ACF A;  4K3B A;  2BTE A;  3ALB A;  4WQM A;  3WAL A;  3Q2A C;  2D2Q A;  2YEP B;  2KN4 A;  1N61 A;  1VR9 A;  3B1L X;  3DWG C;  1HA5 A;  3E56 A;  4AP4 C;  1MI0 A;  2HDE A;  4MEM A;  1VDV A;  2CHX A;  4HLE A;  4KKJ A;  4L2Y A;  1WZ3 A;  3IHP C;  2NPT A;  3TEW A;  4LNK A;  5CTR C;  4HDO A;  1ZP0 B;  3SEB A;  1UNS A;  5FR3 A;  2FUH B;  4JX1 C;  4HWI B;  4E74 A;  4M01 A;  2N1W A;  3BII D;  3PS6 A;  1EF1 A;  3A9J B;  3DBL B;  1QKZ A;  1LQB A;  4HPM B;  4RGO S;  4W9K A;  1ZW7 A;  2MJD A;  3RNE C;  1N60 A;  2LAS A;  1WY8 A;  4XDD A;  4RGM A;  4I6L B;  1H8C A;  1WXS A;  2ON8 A;  3N1X C;  4GMV A;  1WR6 E;  5BO4 B;  1RRB A;  3AB5 A;  4JGH B;  3N30 A;  3PLU A;  1D5M C;  3R2I A;  3ZTC A;  1SE4 A;  2KX0 A;  1WJU A;  2C9W B;  3AU5 A;  3ZNZ B;  4W9E A;  3RD2 A;  2C7N B;  2XEW A;  3AE4 B;  2DAJ A;  3MC0 B;  3OJ3 A;  3MHZ A;  1UWX A;  4CYE A;  2WXH A;  1WF9 A;  2BS2 B;  1WGH A;  1EWC A;  3D32 A;  2N9L A;  3JW0 X;  2W82 A;  2PMV A;  1VCB A;  1UGM A;  2JZZ A;  1N62 A;  2SAK A;  4WJN A;  2MQJ A;  3ML8 A;  2ZZP B;  1WZ0 A;  1RFA A;  4ZRI A;  4GB9 A;  2MBE A;  1A5R A;  4GGQ A;  1VZ8 A;  2CJN A;  2M19 A;  3RNA C;  3L4P A;  2RSU A;  2V3S A;  1N6Z A;  2BB6 A;  2J4X A;  3ZGZ A;  3U52 E;  2OED A;  1D5Z C;  1BXT A;  3AV8 A;  2W55 A;  2JX5 A;  4EZK A;  1ZE3 D;  2L3Z A;  1C3T A;  2ZW0 A;  1OFF A;  3CMM B;  1AN8 A;  1KLV A;  1E7V A;  4DXG A;  1WJ6 A;  3UIO B;  3RCZ A;  1IBX B;  5CHW A;  2WX0 A;  5HG2 A;  3H7S A;  1SE3 A;  2WXM A;  3T8M A;  2G4D B;  1WWT A;  2L76 A;  1SE9 A;  2WU2 B;  4HVB A;  2Y5P A;  2IY0 B;  3QA8 A;  2JRI B;  1Q10 A;  4GDL B;  4M0W B;  2DNF A;  5T8I A;  5DPW A;  2D3B A;  1J0G A;  2KC2 A;  4IW0 A;  1VLB A;  3WAN A;  3N9Y C;  2M17 A;  3AE8 B;  1WGG A;  1VZ6 A;  2QMT A;  1TZ1 A;  4M00 A;  4OVZ A;  3AN1 A;  4N59 A;  4W9D A;  4KIK B;  1NEN B;  2KAN A;  2ZNV B;  2HJ1 A;  1SXT A;  3L10 B;  2WDQ B;  3L13 A;  3BY4 B;  1KOT A;  1WJ4 A;  2QC8 A;  3P42 A;  2YVC A;  4JE3 B;  3VTV A;  4MH8 A;  2K6Q A;  4FJZ A;  4GDL A;  3QAR A;  4YSZ B;  1P98 A;  4JIO U;  3NS8 A;  2FIF A;  3B9J A;  4YTP B;  3KUD B;  3DOW A;  1J19 A;  1HE8 A;  1V49 A;  1LGR A;  1XLN A;  4QAY A;  2J42 A;  2J52 A;  4GIV A;  1I4X A;  1EWY C;  1L0X B;  3NOB A;  2LXC A;  1P0R A;  2RGF A;  3RZF A;  1WI0 A;  2HJ8 A;  5EE0 A;  3P4R B;  1K50 A;  1WE6 A;  2MW5 A;  3OLM D;  1UF0 A;  4MJS A;  3KQ4 A;  4KGR A;  1GNU A;  2YLM A;  1ENF A;  2KMM A;  3DBH I;  2O2V A;  2INN E;  1QLB B;  1QOG A;  3CWI A;  1L7Y A;  1T0S C;  1SSN A;  3AE5 B;  5LXH A;  3K9P B;  4KX6 B;  4OZB A;  2WXF A;  3HM6 X;  3ZO5 B;  3ZW3 A;  1T0Y A;  5D7G A;  3IVF A;  4NQL B;  2RD0 A;  5AZG A;  1Y8R C;  3ZNH B;  4W9I A;  3GZN B;  3LJ3 A;  3OAW A;  3OJ4 B;  4PYU A;  4EZJ A;  3UIP B;  3PPA A;  2JPH A;  4C80 A;  4K7S A;  1VJK A;  4IWQ A;  3C19 A;  1MJD A;  4I6N B;  2MBB B;  3ML9 A;  2LVQ A;  1KTK A;  2AX5 A;  3QAQ A;  1C1Y B;  2MP2 A;  4DDG D;  5CX3 A;  3QQ8 B;  1AYF A;  3U2S C;  1TS2 A;  2W3R A;  4NAW A;  2WHI A;  1HTQ A;  1ZOY B;  5TSS A;  5DCN A;  1OGW A;  3Q69 A;  4P6V F;  4WH4 A;  1OEY J;  3T3N A;  1WSP A;  2MLB A;  1DOX A;  2FCN A;  5JXV A;  3UI3 A;  3WAO A;  1NYQ A;  4ZRQ A;  3HHM A;  2LFI A;  3MJW A;  2KLC A;  1JRP A;  2KD0 A;  1TZO A;  3NVZ A;  3Q8B A;  2AYO B;  4PS7 A;  2LGS A;  2K25 A;  1GPX A;  4B0E A;  1RM6 C;  4ZRK A;  1KLU D;  1XCQ L;  4II2 B;  1VRA B;  3I3T B;  1VZ7 A;  1SJE D;  4GU2 A;  3DBR I;  4EZL A;  1ZKH A;  3GS2 A;  2C60 A;  4C00 A;  1UUP A;  2VZK B;  2LI5 A;  1YN4 A;  3VHT C;  2NTS A;  1WR1 A;  1EUV B;  2KJ6 A;  4DHZ B;  2J53 A;  4RM8 A;  4ANW A;  1JQ4 A;  4ZRJ A;  2BKR B;  4RF1 A;  2LWP A;  5G2N A;  4P1C C;  4BBN C;  4TSS A;  2G4S A;  3B0A A;  3KW5 B;  4XWW A;  1LFD A;  3N32 A;  2DZI A;  3IAM 1;  2M8S A;  4WJQ A;  2L1A A;  3VR9 B;  3DBR B;  2IGD A;  1Q1O A;  3TBL D;  2I38 A;  3FC4 A;  2R61 A;  2G9H D;  5IAA C;  1DOI A;  2DAF A;  1HEZ E;  3ZRF A;  4F7Z A;  2WXG A;  2KAC A;  2JRH A;  5AZH A;  3R7R A;  2KDB A;  3V3X A;  3Q3N C;  1FNU A;  3DHG C;  3LDZ E;  2M1M A;  1S1Q B;  1WRI A;  3GZN I;  4LDT B;  4K7W A;  3MJ5 A;  1J7A A;  3VUX A;  3W1S A;  4G11 A;  3TJP A;  3I9V 1;  4HPL B;  3RNC C;  1JW9 D;  2V3P A;  4ICU A;  5C3J B;  1GUA B;  4HRO A;  2CS4 A;  3JSV A;  4DBG A;  1D6E C;  2NR2 A;  4ZDV A;  1EF5 A;  2WXR A;  1BML C;  1ET9 A;  3VH3 B;  4L23 A;  4KZ0 A;  3AEB B;  1ZXH A;  3PSE B;  5DPS A;  2LRU A;  2L05 A;  1TYG B;  1IGC A;  1C4P A;  3ZTD A;  1YX5 B;  2KDI A;  1KRH A;  1D4B A;  3MHS D;  5IO9 A;  4DK5 A;  1PQS A;  1L4D B;  4A3P A;  2OJR A;  4HCP B;  4AUQ C;  2XNA C;  1I4R A;  4KSK C;  2JUO A;  2X38 A;  1HQR D;  1V86 A;  1NI2 A;  1I4P A;  4YTN B;  2GBR A;  4NZL B;  5D94 A;  4FHJ A;  4JPS A;  4II3 B;  1TY0 A;  2IPK D;  3VTW A;  4AJY B;  2Y5C A;  5CHV C;  4B6W A;  1ZGU B;  1V5O A;  1V9J A;  3BYT B;  2QSD A;  2ONQ A;  2K6D B;  1PYW D;  2JZP A;  1P7E A;  3ZYY X;  2CJO A;  3P63 A;  3Q8C A;  4Q2J A;  3Q3M C;  1MPE A;  1RWS A;  3VRB B;  2LGI A;  3VTU A;  4XGA B;  3ZNG C;  2KLG A;  4YXD B;  5LXI B;  1WGY A;  4RFB A;  3V05 A;  2WDR B;  1MVK A;  3U30 A;  1MG8 A;  4ZYS A;  2DYO A;  2LD9 A;  2KAJ A;  3BZD B;  3TCA A;  1T5X D;  2L52 A;  3FIL B;  3LXF A;  3O65 B;  2W3S A;  3ZRC A;  1E0Z A;  2ACZ B;  2FCM A;  4LTU A;  1QOB A;  1FCC C;  2AQ3 B;  1WYG A;  1WGD A;  4LNF A;  4P7I A;  3SFD B;  2ZVO A;  2K0P A;  1T6B X;  4KKI A;  1FNV A;  1QOF A;  3PT2 B;  5EDS A;  1QIL A;  2QIL A;  1ROE A;  2BBC A;  1YQ3 B;  2GBJ A;  1YJI A;  3UF8 A;  4I6P A;  4WWN A;  1OQR A;  4C7Y A;  3HK0 A;  4M8N A;  3DWM A;  3L17 A;  1FRD A;  3NVY A;  3FIL A;  1IYF A;  2Y3A A;  4ARC A;  3CF6 E;  5JHB A;  3QX1 A;  2L32 A;  2GBN A;  3SR6 A;  2KFK B;  2YEP F;  4IUM B;  4RCO A;  1P3Q U;  1WE7 A;  1I35 A;  4OHJ A;  1TS3 A;  1R4N B;  5D3I B;  1WMH B;  5TR5 A;  3TEZ A;  3UIN B;  3VR8 B;  4CHK A;  2KWC A;  1TBE A;  4USA A;  1HZ5 A;  4M02 A;  3KUC B;  3VH4 B;  4FJY A;  2IBI B;  2JYT A;  1N5X A;  3DPD A;  1PUT A;  3ZQ4 A;  2D5G A;  4GXB A;  2IND C;  3NVV A;  3GE3 C;  3KWV A;  3MP9 A;  4URK A;  1IUE A;  1CK1 A;  1R4M B;  2R2Q A;  4LNN A;  1QQR A;  2K39 A;  1JRO A;  1UD7 A;  4IM2 A;  4MGI E;  5IKC M;  3PRM B;  1XQQ A;  2ZEQ A;  4NJC A;  3WAM A;  3LYY A;  2DX5 B;  4M8M A;  2B3A A;  1FPY A;  2MRP A;  1E8W A;  4PS3 A;  1KFY B;  1YMH E;  1FFU A;  1LM8 B;  1G6J A;  2LVP A;  3A33 B;  1MHX A;  3TIX A;  1UBI A;  3AEE B;  3W5V B;  4DHZ E;  5CHF A;  1YIW A;  1GJZ A;  4IM0 A;  2BPS A;  2INP E;  2MJ3 A;  3X23 A;  3A1Q A;  3Q8A A;  3TSS A;  4MM3 B;  3QWZ B;  3RNB C;  4A6Q A;  4FLH A;  4A8X C;  2QJL A;  2J0M A;  1D5X C;  4HXD A;  2VH1 A;  1JWM D;  2LMC A;  1T0Q C;  4IWP A;  3L0W B;  4P1B C;  2IGH A;  4KSL C;  4US9 A;  3QC8 B;  1HZ6 A;  3DBL I;  3ONS A;  4LNO A;  1SEB D;  1YQ4 B;  4BBN F;  1K8R B;  2BS3 B;  4MJS B;  2D3C A;  4OVU A;  2CHW A;  4C4V B;  1XLP A;  4BAX A;  2O2V B;  4FHK A;  4XX5 A;  3PV1 A;  5IP4 D;  3NG0 A;  2I1J A;  2MBQ A;  3P2B A;  3W1S C;  2C5L C;  1E10 A;  1ZDV A;  2C7H A;  1GOZ A;  3DVN V;  1FNW A;  1YN3 A;  4HPP A;  3ZNI D;  5DPT A;  2KQ7 A;  2AL6 A;  3QIJ A;  2WYQ A;  4GDK B;  5H8Y E;  3DHH C;  2MP2 B;  4G50 A;  1NDD A;  2NCN A;  1YOV B;  3AEG B;  1UWM A;  5D3D A;  4JLC A;  3P4Q B;  4CQN A;  3TEX A;  4NJ6 A;  3ZVV A;  5AEK B;  3IT6 B;  3R2T A;  4ANX A;  2H88 B;  2I1K A;  4A90 A;  2WXO A;  4IC7 B;  3VDZ A;  3QCA A;  4NAW B;  5DPR A;  3ZJV A;  1MG4 A;  4WJP A;  4TMA B; 
#chains in the Genus database with same CATH homology
 4B0E A;  1RM6 C;  1KLU D;  1XCQ L;  3C8Y A;  3TUO A;  4YSX B;  1L0Y B;  1VRA B;  3BWU D;  1V1P B;  2GB1 A;  3IAS 1;  3O13 A;  1BUI C;  1VZ7 A;  1ZUD 2;  1FRR A;  4RH6 A;  4MAC A;  4RF0 A;  1SJE D;  5HFY A;  3OWE B;  1FCL A;  3U4E G;  2KQ4 X;  4TQ1 A;  1FM0 D;  1DYQ A;  2WU5 B;  5H92 C;  1N5W A;  2V4I B;  3AH7 A;  1NVI D;  2PTL A;  3GS2 A;  2LHD A;  4YWG G;  1TKE A;  1UUP A;  2VZK B;  1YN4 A;  1SBB B;  3WCQ A;  3BK1 A;  4LK0 M;  4HKQ A;  1I4H A;  2NTS A;  1E6E B;  1SIJ A;  1V97 A;  1JCK B;  1FXA A;  2LEK A;  4WWM A;  1FFV A;  2J53 A;  3W5U B;  2KDM A;  2MEK A;  4M0W A;  1L5P A;  1C77 A;  3I57 A;  1I4Q A;  1JQ4 A;  2CU3 A;  2K22 A;  2G1E A;  2PVG C;  1ZXI A;  4RF1 A;  2I2Y A;  4JWS C;  4TSS A;  3NUH B;  4RNA A;  1KF6 B;  3AE2 B;  4XWW A;  2DWQ A;  3IAM 1;  3KWL A;  2ZW1 A;  4TMA B;  2BW2 A;  2L1A A;  3VR9 B;  4ZRP A;  2K5P A;  4OW0 A;  1XLQ A;  2IGD A;  1B9R A;  2KWD A;  1OQQ A;  2JU6 X;  2I38 A;  5AUK A;  4C56 C;  3FC4 A;  2R61 A;  1V1O A;  2G9H D;  2WXJ A;  2L83 A;  4WUR A;  3T3O A;  1DOI A;  1HEZ E;  4HKZ E;  1CJE A;  1AW7 A;  2WXG A;  2KAC A;  1HXY D;  1M4V A;  1C9F A;  3V3X A;  2NMQ A;  1DGJ A;  3FAH A;  1FNU A;  5LNK 1;  1JWU D;  1PGX A;  2DYM A;  4XWT A;  4GLS C;  3AE3 B;  4LLG M;  3RFZ B;  1L6V A;  1I7H A;  1WRI A;  3SFE B;  2RDH A;  2JYE A;  2BTE A;  3MJ5 A;  2PW9 A;  4WQM A;  2N7J A;  1J7A A;  2YEP B;  2GI9 A;  2KN4 A;  3W1S A;  2WP9 B;  3ZJT A;  4KGT A;  3I9V 1;  1N61 A;  1VR9 A;  1JW9 D;  3DWG C;  2V3P A;  5C3J B;  1HA5 A;  3E56 A;  4HRO A;  1MI0 A;  2HDE A;  1VDV A;  1D6E C;  4YT0 B;  3BVZ A;  4OZA A;  3BK2 A;  2WXR A;  1BML C;  1ET9 A;  4KKJ A;  1MHH E;  4L2Y A;  2WNM A;  2JXT A;  4L23 A;  2N9K A;  2FUG 1;  3TEW A;  3ZGZ A;  2TSS A;  3AEB B;  1ZXH A;  1XF5 L;  1RFK A;  3B2G A;  1QOA A;  1JML A;  1ZP0 B;  3SEB A;  3Q8E A;  2M0A A;  3EUB 2;  5G5G A;  1UNS A;  3ABV B;  1TYG B;  5FR3 A;  5E6J A;  4JX1 C;  1IGC A;  2LJI A;  2JWU A;  1C4P A;  1NYR A;  3BII D;  4ZOH C;  1XLO A;  1GB1 A;  1SE2 A;  4P16 A;  1JWB D;  1KRH A;  1D4B A;  3IXS A;  1QKZ A;  4DXF A;  1ET6 A;  3W2D A;  4RGO S;  5EE3 A;  3H8H A;  2MJD A;  1L4D B;  2NTT A;  2PLP A;  1N60 A;  1K52 A;  2XNA C;  1I4R A;  2JSV X;  2X38 A;  1HQR D;  4XDD A;  1F0Z A;  4RGM A;  4WAF A;  2E3T A;  2ON8 A;  1C76 A;  1I4P A;  4YTN B;  1P7F A;  4NZL B;  5MPO A;  1RYJ A;  3VQI A;  4IKG A;  3Q8F A;  3AB5 A;  3BVM A;  1D5M C;  3R2I A;  4JPS A;  1SE4 A;  1GAQ B;  1YJJ A;  1TY0 A;  2IPK D;  3EA6 A;  4IOI E;  2WS3 B;  1B1Z A;  1FEH A;  2Y5C A;  3AE4 B;  3MC0 B;  5HI1 A;  2V3N A;  3HUI A;  1KH0 A;  3MHZ A;  1UWX A;  2WXH A;  3BYT B;  2QSD A;  1N63 A;  2BS2 B;  5EE1 A;  1EWC A;  2ONQ A;  2N9L A;  3AE6 B;  2PMV A;  2W82 A;  1PYW D;  5BMG A;  1N62 A;  2E6X A;  2SAK A;  3EGR A;  2JZP A;  1P7E A;  3ZYY X;  4YSY B;  3PO0 A;  2CJO A;  3P63 A;  3Q8C A;  4Q2J A;  1MPE A;  1V1P A;  3NRZ A;  1TY2 A;  1RWS A;  1PFD A;  3VRB B;  2AQ2 B;  2LGI A;  4XE0 A;  1A70 A;  1VZ8 A;  2CJN A;  2M19 A;  3L4P A;  4AS1 A;  4YXD B;  1F77 A;  2B76 B;  2BB6 A;  2J4X A;  4PT5 A;  2M56 B;  4RFB A;  3V05 A;  3U52 E;  1SF0 A;  2OED A;  3GP7 A;  2WDR B;  3NZ3 A;  1MVK A;  3AE9 B;  1D5Z C;  1WXQ A;  1BXT A;  4ZYS A;  2DYO A;  1WGK A;  3AV8 A;  2W55 A;  2JX5 A;  2KAJ A;  3BZD B;  1PDX A;  1ZE3 D;  1ACC A;  1TKG A;  1T5X D;  3CIR B;  2L52 A;  3FIL B;  4O1N A;  2QIE B;  2DLB A;  3LXF A;  2ZW0 A;  3RPF C;  2W3S A;  4DQO C;  3KLS X;  1E0Z A;  3HVZ A;  1OFF A;  2ACZ B;  3AEA B;  1AN8 A;  4LTU A;  4ITK A;  1QOB A;  4DXG A;  4R3D A;  1FCC C;  2AQ3 B;  1WYG A;  2LHE A;  3W9C B;  2HTM E;  1IBX B;  3ZJU A;  2Z8L A;  5C2T B;  5HG2 A;  3SFD B;  1GB4 A;  1SE3 A;  2WXM A;  1DOY A;  3B2F A;  1EU3 A;  2K0P A;  1T6B X;  1QT9 A;  4KKI A;  2MJE A;  1WWT A;  1T3Q A;  1FNV A;  1QOF A;  2WU2 B;  4NAM A;  2Y5P A;  1QIL A;  2QIL A;  2K3U A;  1ROE A;  4B0M A;  3HVD A;  1Q10 A;  2BBC A;  1YQ3 B;  4GDL B;  1YJI A;  4N58 A;  5T8I A;  1EU4 A;  2BYT A;  1JWA D;  4WIP A;  1OQR A;  1VLB A;  3AED B;  1I4G A;  4OZC A;  4C7Y A;  1QF6 A;  5I4D A;  2EEL A;  3N9Y C;  4N6E B;  3AE8 B;  2SEB D;  3DWM A;  1FRD A;  3NVY A;  2LUM A;  1XCT L;  1IGD A;  3FIL A;  4HJG E;  1VZ6 A;  2QMT A;  1V8C A;  3E9S A;  1UGJ A;  2Y3A A;  4ARC A;  1CZP A;  2FBW B;  3U7Z A;  2L32 A;  3SR6 A;  2YEP F;  4UDU C;  2GRI A;  3P4P B;  4RCO A;  2XN9 C;  4OVZ A;  3AN1 A;  4RGN A;  1FXI A;  2IGG A;  4D2K A;  2QEJ C;  4OHJ A;  1C78 A;  1TS3 A;  3R8B A;  3BVG A;  5D3I B;  3TEZ A;  1TS5 A;  4N59 A;  3VRA B;  3VR8 B;  2WXL A;  1NEN B;  3J9C A;  3IT4 B;  1SXT A;  1TS4 A;  2WDQ B;  4USA A;  1HZ5 A;  2WDV B;  3P42 A;  4JE3 B;  2JYT A;  1N5X A;  4TQ0 A;  1PUT A;  4MH8 A;  2WXQ A;  4YSZ B;  3ZQ4 A;  1STE A;  2RMM A;  1AWD A;  2D5G A;  3B9J A;  1R7S A;  4YTP B;  2OHF A;  5HHD G;  4HEA 1;  3NVV A;  3KWV A;  3MP9 A;  5GXG B;  2WXN A;  1IUE A;  1CK1 A;  1QQR A;  3PZ8 A;  1JRO A;  2PKO A;  4JWU C;  3AEF B;  2BB5 A;  1E9M A;  2H89 B;  4NJC A;  3LYY A;  1XLN A;  1C4C A;  3GB1 A;  2J42 A;  2J52 A;  4AQ7 A;  1I4X A;  1EWY C;  1KFY B;  1SJH D;  1L0X B;  2Q5W D;  1FD6 A;  3P4S B;  1FMA D;  1YMH E;  1EM7 A;  4ARI A;  1FFU A;  1KLG D;  1TKY A;  2WXK A;  5BYS A;  2WQY B;  1L6U A;  4FXC A;  1ZPS A;  2RDG A;  5EE0 A;  1MHX A;  3P4R B;  3AEE B;  3W5V B;  1K50 A;  3AM9 A;  1JAL A;  3KQ4 A;  4KGR A;  3NVW A;  3AMZ A;  2ICI A;  2INP E;  1ENF A;  2MJ3 A;  2KMM A;  1K53 A;  3Q8A A;  3TSS A;  4MM3 B;  5FKA C;  1JWS D;  4ZHO A;  2INN E;  1K51 A;  3TEY A;  1YNT E;  4MT5 A;  4A6Q A;  1PGA A;  1QLB B;  1QOG A;  3CWI A;  4J3O D;  4A8X C;  2QJL A;  1XXG A;  1SSN A;  3AE5 B;  3NS1 A;  3URY A;  1C79 A;  1ZDX A;  4A9A A;  4KX6 B;  4OZB A;  2WXF A;  5D7G A;  1D5X C;  1JWM D;  3MFG A;  2DBY A;  2LMC A;  1J7C A;  1FIQ A;  3P1M A;  1XO3 A;  2IGH A;  4IDI A;  4US9 A;  1HZ6 A;  2VZK D;  1L4Z B;  1SEB D;  1YQ4 B;  1J7B A;  5FK9 C;  1XEE A;  2BS3 B;  1YN5 A;  4C80 A;  2IDY A;  2WLB A;  1VJK A;  1SB3 C;  4YTM B;  5BYQ A;  4H2A A;  1XLP A;  1KTK A;  2AX5 A;  4REZ A;  1C4A A;  4HRS A;  1NEK B;  1E10 A;  1AYF A;  1NI3 A;  1ZDV A;  3LB8 C;  3ETR A;  1GOZ A;  2BT6 A;  3U2S C;  2V0G A;  1TS2 A;  2W3R A;  1IBX A;  1FNW A;  1F2R C;  1YN3 A;  2RPV A;  1E7P B;  1LO5 D;  2JQR B;  1ZOY B;  5TSS A;  5BMH A;  3Q69 A;  4P6V F;  1F2R I;  2N0S B;  4WH4 A;  4XDC A;  3BYY B;  4GDK B;  5H8Y E;  1TJE A;  2AQ1 B;  2FE8 A;  4US8 A;  1FO4 A;  3T3N A;  1WSP A;  1DOX A;  5BMI A;  3AEG B;  4KGS A;  2BS4 B;  2PIA A;  1UWM A;  5JXV A;  3UI3 A;  5D3D A;  4ZHP A;  1ESF A;  3P4Q B;  4A55 A;  4CQN A;  1NYQ A;  2MH7 A;  1PGB A;  4ZRQ A;  2WXP A;  3AEC B;  2LFI A;  3AE1 B;  1CQV A;  2EKI A;  4RGT A;  1Y56 A;  3PZ7 A;  5BYR A;  1JRP A;  1TZO A;  3NVZ A;  3TEX A;  4EE2 A;  3Q8B A;  3IT6 B;  4C7Z A;  3R2T A;  2H88 B;  2WXI A;  2IJ0 A;  2PVO D;  2W54 A;  3AE7 B;  4A90 A;  5AUI A;  2WXO A;  5G5H A;  3HRD D;  4NAW B;  5EE9 A;  3ZJV A;  1GPX A;  2K9X A;  4L1B A;  1L0V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...