2M19A

Solution structure of the haloferax volcanii hvo 2177 protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
106
structure length
106
Chain Sequence
GGGRDYKDDDDKGTMELELRFFATFREVVGQKSIYWRVDDDATVGDVLRSLEAEYDGLAGRLIEDGEVKPHVNVLKNGREVVHLDGMATALDDGDAVSVFPPVAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdopterin converting factor subunit 1
publication title Crystal structure of the ubiquitin-like small archaeal modifier protein 2 from Haloferax volcanii.
pubmed doi rcsb
source organism Haloferax volcanii
molecule tags Protein binding
total genus 17
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2m19A00
3NVYA 4N59A 1JRPA 1ZXIA 2PKOA 1FXIA 3HRDD 4P6VF 1V8CA 2PVGC 3AEGB 2MH7A 3AE5B 2BS3B 2WU5B 1VJKA 4WWMA 3W5UB 4A9AA 1FO4A 2DWQA 3B9JA 1JALA 2PVOD 4N58A 1QLBB 1FFVA 1N61A 1QOGA 1RWSA 4JWUC 3AE1B 4ZOHC 3VRBB 4C7ZA 3AB5A 3BIID 2CJOA 5G5GA 3HUIA 1TJEA 4HRSA 1XLQA 3AE7B 1N63A 1NI3A 5G5HA 2EKIA 1E10A 2PIAA 2WU2B 3FAHA 2K9XA 1RFKA 1JWAD 1DGJA 2W3SA 3VR9B 1FM0D 1GPXA 1PFDA 1N5WA 1QOAA 1FMAD 1NEKB 2KAJA 3P4PB 4YTNB 2MJEA 2WP9B 2N0SB 2K22A 2FBWB 1KF6B 3AV8A 3KWLA 3W9CB 2Q5WD 3P1MA 1JQ4A 1AWDA 5EE1A 1NVID 2AX5A 4N6EB 1SIJA 1XLPA 4YT0B 1FIQA 3AECB 5GXGB 1VLBA 4ZHOA 2W55A 3HVZA 1FRDA 1L6UA 1UWMA 4YSZB 3AE6B 3LB8C 1ZP0B 3AE2B 1QOBA 2MJ3A 3P4QB 5EE9A 1AYFA 1F0ZA 1N60A 1E7PB 2DBYA 1J7CA 2HTME 2OHFA 3DWGC 3P4RB 1N5XA 1WGKA 1WRIA 3AEEB 4JX1C 1TKGA 5AUKA 1PUTA 3AE9B 4LTUA 2JX5A 5MPOA 3P4SB 2G1EA 1OFFA 1QF6A 4YTMB 3NVVA 1YJIA 5C2TB 3AEFB 4KX6B 1DOYA 3AMZA 3AEDB 3SFEB 2WQYB 3NVWA 1NYQA 3VR8B 1FFUA 1XLOA 3W5VB 1YQ3B 4JWSC 1XLNA 3AE8B 5H92C 4ITKA 3NVZA 3DWMA 3RPFC 1RM6C 3B2GA 2WDQB 1R7SA 1L5PA 4WQMA 3AEBB 3AEAB 2BT6A 1E6EB 1TKEA 4USAA 1DOIA 1IUEA 1N62A 2QIEB 3ABVB 3ETRA 3NRZA 4C80A 4YSYB 1NYRA 2WLBA 3AE3B 3FC4A 2BS4B 1TKYA 2JQRB 1YJJA 3PO0A 4HROA 4YTPB 1NENB 1ROEA 3AH7A 1KRHA 1XO3A 3CIRB 3ZYYX 2L83A 3WCQA 1RYJA 2MJDA 5H8YE 3SR6A 1FRRA 1OQRA 3AM9A 2L52A 1L6VA 3L4PA 2H88B 1B9RA 1ZUD2 1ZOYB 1A70A 1WWTA 3AE4B 4YXDB 3AN1A 5C3JB 3B2FA 1TYGB 3P63A 4FXCA 1SF0A 1KFYB 1DOXA 1L0VB 1QOFA 2H89B 3EUB2 2Y5CA 4IDIA 4ZHPA 4US9A 2WDVB 3LXFA 1E0ZA 2W54A 2E3TA 3CWIA 2BS2B 2CU3A 1OQQA 1YQ4B 5EE0A 4YSXB 1V97A 4US8A 2WDRB 1SB3C 1T3QA 1E9MA 2M19A 1QT9A 2CJNA 1VDVA 2KMMA 1JWBD 2LEKA 5EE3A 1JROA 2ACZB 2M56B 1WYGA 1EWYC 1FXAA 2WS3B 3NS1A 3SFDB 1J7BA 1PDXA 1JW9D 2W3RA 4C7YA 1WXQA 5AUIA 3VRAB 2QJLA 2B76B 1CJEA 1I7HA 2K5PA 1CZPA 1J7AA 1GAQB
chains in the Genus database with same CATH superfamily
3PS6A 1ZXIA 1L2NA 2PVGC 2BS3B 2WU5B 1MHHE 3H7SA 4DHJD 1ACCA 4MELA 3AE1B 4P7IA 1E90A 1C3TA 1EWCA 3NS8A 4WJNA 2KNBA 2LVOA 2WX1A 3JSVA 1SEBD 1PFDA 1N5WA 1XD3B 3ZGZA 2WP9B 1JCKB 3AV8A 2INNE 1ZDXA 1YN3A 2Q5WD 5T8IA 1F1HA 2RDGA 2LRWA 1P98A 3HVDA 3DVNU 2J53A 3AECB 1C79A 4DDID 3ZDTA 4FHJA 2JRIB 2E6XA 3AEEB 3B1LX 4FHKA 2K8BA 2KFKA 2KOXA 4DQOC 1YJIA 5C2TB 3AEFB 4W9GA 4HKQA 3NVWA 5JZEB 4XZ4A 4NJ7A 4ITKA 3RPFC 1RLFA 1RM6C 1Q0WB 3CF6E 1UWXA 2Y5BB 1TTNA 3N30A 2NMQA 2KTRB 2M4NA 3ONSA 4DWFA 2G3QB 4HPPA 2KN4A 3B0AA 3APFA 1AN8A 3A9KB 1T0SC 2H88B 2GB1A 2WYQA 1ZUD2 2IGGA 3X0WA 2UWQA 1TZOA 2H89B 1MFWA 2LGYA 2QSDA 3ZJUA 4HDOA 1ENFA 4D2KA 1GNUA 2KANA 1T0YA 1EU3A 1JWBD 1FCCC 5HG2A 3ZQ4A 4XDCA 2JT4B 2PMVA 1T5XD 3IAM1 1WJNA 3KW5B 4LNIA 3GB1A 2WXMA 3QHTA 4XX5A 4MJSB 4N59A 3ZVVA 2PKOA 1KTKA 4RGOS 2CKHB 3GE3C 3RMKC 4LJOB 4RF1A 3NHEB 2ICIA 3BY4B 4LNKA 2MP2A 1P3QU 4C7ZA 3HUIA 5L83A 1DGJA 4J6IA 1NEKB 1T0RC 2KAJA 4K7SA 4FA6A 2XK5B 3A1QB 3P1MA 5EE1A 4NJ6A 4DXAB 2LZ6A 3N3KB 4GIVA 2L05A 3HVZA 2QEJC 4TMAB 2O6VD 2GBRA 1YIWA 1WRDB 1YN5A 2BWES 3E9SA 3OG5A 1EO6A 3AE9B 4IW0A 3VXWA 3ZKJC 3KUZA 4ICUA 3ZNID 4L23A 2KVZA 1EF5A 4S17A 1WX8A 2BT6A 2BPSA 1ZPSA 4DBGA 3AU4A 3L17A 5CHFA 5IAAC 2JQRB 2VH1A 2KTRA 2KKCA 3MC0B 4DHJB 1IPGA 4GOCA 4PS8A 2DENB 2XN9C 1UBIA 4OW0A 3IFWB 3V05A 4CYEA 4MDKE 3P63A 3Q2AC 4KKJA 1KFYB 1K8RB 3WA0A 3JVZX 1TS2A 2Y5PA 3OLMD 5C3JB 4US8A 1E7VA 1SSNA 2BW2A 1I4RA 2GI9A 2M56B 1WYGA 2IBIB 2KYWA 3TEYA 4EUTA 1IYFA 3Q14C 3PZ7A 4GGQA 3RZWC 2BYEA 3UIOB 3MHSD 5E6NA 3RFZB 1NI2A 1GG3A 5L95C 4ACFA 4AJWA 1MJDA 1NI3A 1E10A 4P1CC 2IZVB 1QKZA 2KFJA 4L1BA 2JZPA 4ANVA 2XK5A 3L08A 2RD0A 1EU4A 2MBBB 2WGSA 1FIQA 4JQWC 1WX9A 3OWEB 1KOTA 2G9HD 4EZJA 1CMXB 3LB8C 1YQBA 5IOIA 2MQJA 1F0ZA 2V1YA 4C00A 2HJ8A 3P4SB 2V4IB 2NBVB 2LGDA 1A5RA 4BKTA 2G4SA 3QARA 4M0WB 4WQOB 4EZLA 4WWNA 4WIPA 2IO0B 3C8YA 2KX3A 4DHZE 2QIEB 2CS4A 4RM8A 3W1YA 2KDEB 1XO3A 2PEAA 3EECA 3SDLC 3K9PB 2V0GA 2DYOA 1ZXHA 4W9HA 3I9V1 3ZJVA 3TIXA 3PT2B 4B6WA 3B2FA 2MSED 1L0VB 5FR6A 1OEYA 3GOEA 4MGYE 1MVKA 4YSXB 4W9LA 4P1BC 3VUYA 2KMMA 1T6BX 1D6EC 1V6EA 1SGHA 3FILA 3Q8CA 1D5ZC 1RFAA 3PSEB 2ONQA 3N9YC 3WAOA 3IAS1 2FAZA 3Q3JA 2L76A 2KN5A 2O6VB 1J7AA 3NVYA 2MX2A 2WXLA 1JALA 2CR5A 1N61A 1RWSA 2JY6A 4JWUC 1ET6A 3QQ8B 4IWPA 2EMTA 1D5MC 4WJQA 1TJEA 3BK1A 3VTVA 2IO2B 5CHVC 3GZNI 3UQAA 1FNWA 2K22A 2GBNA 2KHWB 5D3DA 2PW9A 3T3OA 2NTTA 2RDBC 1XCTL 2K3UA 2KC2A 4YT0B 3VTWA 3SHQA 1JMLA 2LMCA 3PRMB 4G50A 4BOZB 2DYMA 2JRHA 2WWZA 4WJPA 1CK1A 2RPQA 2BBCA 3HM6X 3HM3A 1K51A 4Q2JA 1WXMA 2N7DA 1FFUA 2YLMA 1GB1A 5AZGA 1V5TA 1FXTB 2K39A 4NAWB 4XDDA 1NDDA 3QJZA 2BB6A 2LXCA 4N9F4 2V3SA 3KUDB 4XGAB 1Q5WB 3ETRA 4C80A 1MG8A 4MGZE 1NYRA 4HROA 1YX6B 3DHGC 2D3BA 2NS5A 2RSUA 2MJDA 4W9JA 5H8YE 1VZ8A 2KT7A 1C76A 3SU8X 2DHZA 4KIKB 4A6QA 1PYWD 3N1YC 3Q3MC 2WX0A 4H2AA 2L3ZA 1D5XC 1QOFA 2YEPB 1STEA 3PRZA 2NTSA 3OJ4B 2KTFA 1C9FA 2KDFB 3PTFC 3MFGA 2BKRB 1VR9A 2R61A 1WZ3A 1J7BA 4ANXA 5IO9A 2B3AA 1YX5B 5J18A 1J8CA 1I4PA 3D32A 4K3BA 2D5GA 3NOBA 2DWQA 4GMVA 4BKSD 2CHXA 4FULA 1Z5SB 5BO4B 2GBKA 2WXQA 2I38A 1V1PB 5FKAC 4LDTD 2DZKA 2JVCA 3X23A 4C4VB 1OQYA 4HXDA 4FJZA 3N32A 3CSFA 2N0SB 4K3CA 4LLGM 3KWLA 4EKUA 3APDA 2G4DB 1QQRA 3VHTC 2AQ3B 2ZW1A 4ZHOA 3DPDA 3DVGX 1V9JA 2VRRB 3AI5A 1V49A 2MLBA 1FCLA 2JX5A 5LXHA 2MEKA 3DCGA 2KJRA 3RNEC 3R7RA 2C5LC 1NYQA 1HXYD 4NJCA 1R4MI 1WGRA 2LD9A 1WFYA 2N1VA 1SE9A 4NAWA 4A3PA 3V61A 3NRZA 2KDIA 4E74A 2OJWA 4NNJB 2IYDB 3FKYA 5LXIB 1KRHA 3CIRB 1RYJA 2LHDA 1L6VA 2BYFA 4JIOU 4KGTA 4I6NB 4IC7B 4GB9A 4KIKA 2D11A 2L32A 2WDVB 3ZW3A 2CU3A 2KLCA 1TT5B 1MPEA 4MH8A 2KMCA 2N9XA 2I1KA 4HLEA 3Q3NC 1OTRB 3JYUA 4BZAA 3DBHI 5AUIA 1Z2MA 2B76B 3HRDD 1YNTE 2MH7A 1WZ0A 4IM2A 3VVWB 2L0FA 4JL9A 3VRBB 4FN2A 2KDMA 1HZ5A 4A55A 3FAHA 2K9XA 3ZNGC 4FJYA 1KJTA 4NAMA 4YTNB 2MWSB 3PZDA 3MC9A 2K25A 5IA7A 2GLSA 2JXTA 1C4CA 3I5JC 4ZYNA 2L8JA 4TSSA 3TMPB 2BYVE 3PPAA 5CX3A 1N5XA 4OZAA 3L10B 5AUKA 4LTUA 1SJED 2ZZPB 2G1EA 2V3NA 4NQLB 4YTMB 2WXRA 3AMZA 4A3OA 1G6JA 2DLBA 1VCBA 1YQ3B 4MM3A 3NZSA 4WQMA 3ZXRA 4IOIE 5BYQA 2CHZA 3Q6BA 4OZCA 1N62A 3N20C 4ZRJA 5IN7A 4YSYB 1UF0A 1TY0A 4QAYA 3OAWA 3EFUA 1H8CA 2W9NA 3TEXA 4LDTB 4KGSA 2KMAA 4YXDB 2L1AA 4W9EA 1GC7A 2FCNA 1K50A 1TYGB 1WGGA 3URYA 2R2QA 3PV1A 1WE6A 2J0JA 1FD6A 3KH0A 1WH3A 1KLUD 1WIAA 1S1QB 4JPSA 3VTUA 4HWIB 1SE4A 4ZYSA 3SFDB 3VRAB 5C1ZA 1CJEA 1JWMD 3V6EB 4XYCA 3U7ZA 2IY1B 4WWMA 1GOZA 3APCA 1N6ZA 3KYCD 1KLGD 4W9FA 4FADA 2DZJA 4WURA 5LLIA 2J7QB 3R2IA 1GC6A 2BB5A 2WXFA 2M1MA 3QK0A 2LXAA 1AWDA 1WGYA 1I35A 1NVID 3BYTB 2L0TA 2IO1B 5BYRA 2LUEA 4YSZB 1L4ZB 5D6JB 3P4QB 5KHQA 3U8ZA 5AZHA 1XT9B 2VZKD 1QF6A 3EGRA 2BKFA 2QDFA 3M95A 1DOYA 1V86A 3IBEA 3SFEB 3VR8B 1GB4A 1XLOA 1JWUD 1C78A 5IKCM 2JXXA 3PGEA 2X8XX 2KC1A 4RGNA 4JLCA 2AQ1B 1LGRA 3B08A 5DPTA 3L16A 4USAA 3C19A 3DBLI 3KLSX 4TV3A 4ASWC 3KVFB 3U30A 1WXVA 1YJJA 3PLVA 3WAMA 3EC8A 1SE2A 2C7HA 4KZ0A 1HTQA 4DK5A 1Q1OA 3RN9C 2N9PC 1E8ZA 2E3TA 3VUWA 3KQ4A 1HA5A 5EE0A 2JYTA 1WX7A 5FR3A 3M62B 3QIJA 2ZVOA 3BYYB 4W9CA 3A9KA 4P6VF 1V8CA 4CHKA 2ZEQA 1WY8A 1R4NB 4GN1A 2C7NB 2QCZA 3AB5A 3IT6B 1FNVA 2LGSA 5G5HA 4AUQC 2SAKA 2ZVNA 1RFKA 2W3SA 3DVGY 2GBJA 2NPTB 2FCMA 1BT0A 2MJEA 1KF6B 1FNUA 3H9DA 1OGWA 1NBFC 1V5OA 4MJSA 1H4RA 4LJPB 1J19A 1ZP0B 2LGXA 3RNBC 2MJ3A 4GU2A 5JHBA 1J7CA 3Q69A 3VUXA 3ZO5B 4GSWA 4G0NB 4HJKA 2W82A 4B0MA 3ZNHB 1WJ6A 3NZUA 2Y3AA 3AE8B 3A1QA 1VRAB 1L0XB 1UNSA 1R7SA 1WGHA 3AEAB 4KGRA 4REZA 1TKEA 2BF8B 4PYZA 1TS4A 3ML8A 1LXDA 3ABVB 3PREA 2PE9A 2X38A 4II3B 3AH7A 3R3MA 2UYZB 3RCZA 3TUOA 2BGFA 1V80A 3H8HA 1PGBA 3KWVA 4KSKC 1E8XA 3DVNV 4IDIA 1TS5A 3WALA 1UGMA 3I57A 3QCAA 1E9MA 4CQNA 2CJNA 1VDVA 3R8BA 1BUIC 3L54A 3GP7A 1ZW7A 2INPE 4MEMA 1Y56A 5HKHA 1K52A 3DBRI 1I7HA 1XF5L 3AU5A 2DAFA 4IKGA 2MHJA 3BVMA 3EFCA 4S0RA 1FFVA 2A4ZA 2XBBC 4G11A 2K8CA 4KDLB 3QX1A 3TEWA 2WU2B 2WXKA 3VR9B 3Q3OC 1GJZA 3ZXVA 2PE6B 4LNOA 2DZMA 3H7PB 2L7RA 2D3AA 2N7EA 4HVBA 1EUVB 1QOBA 4C56C 3P42A 3DWGC 1VZ6A 4LNFA 1WGKA 2IY0B 2ZPNA 1PQSA 3SD5A 1BMLC 4WWPA 5MPOA 1WGDA 2MBEA 4P16A 2WQYB 3VQIA 3Q8BA 2KWVB 2LI5A 4OVVA 4TKNA 1MI0A 1MHXA 3MP9A 1WJUA 5D94A 1DOIA 2AQ2B 3RNGC 4CO7A 4ZDVA 3A4RA 3UIPB 2Z8LA 3FC4A 4YTPB 1UGJA 4A90A 4TQ1A 1B9RA 2M8SA 3AE4B 3AN1A 2G45B 1EF1A 4M0WA 2PPHA 3RYTA 4ARIA 1OQQA 2FUHB 4M8MA 2O2VB 1HZ6A 2KQSA 5BMGA 2NBWB 2ACZB 4YL8A 1F9JA 4OVUA 2IGHA 2QJLA 2NR2A 1WF9A 3RD2A 4MSQB 2HJ1A 2NVUI 2LJIA 2AL3A 1YOVB 2QC8A 1WMHB 4RMAA 4HRSA 1HTOA 2QHOA 2D2QA 4JGHB 3P4PB 1SIFA 3W9CB 4EEWA 4EOYA 3NJTA 1U4AA 1SIJA 1XLPA 1ET9A 2ZNVC 4WAAA 2O6VA 4GDLB 4KVGB 5GXGB 1VLBA 2NCNA 3RI7C 1FRDA 2J0MA 1C77A 1L6UA 1UWMA 3MTNB 2MBOA 1LO5D 1N60A 5CHWA 3P4RB 1WRIA 4XE0A 3ECIA 4R3DA 4L2YA 5J2RA 3O13A 3DWMA 4W9DA 4AOFA 5DPRA 3U52E 1M94A 2FIDA 3UQBA 2N4FA 4K81A 4KKIA 4BFRA 2BS4B 5E6PA 3Q8FA 4AS1A 5TSSA 4K7UA 4IUMB 4RH6A 3R66C 3V62A 4PS3A 2UU7A 4HCPB 3MJ5A 5TR5A 3GE8C 2K8HA 1SB3C 2GOWA 2RR9A 1SJHD 5JH5C 2R2OA 3JSVB 3TEZA 1JROA 1WSPA 2PTLA 4BBNF 4ANWA 2MCNB 1JW9D 2ZJDA 2INDC 1VZ7A 2WXJA 3LJ3A 4IM3A 1JRPA 2GBMA 1FXIA 4B9KA 3AEGB 1B1ZA 5C23A 3DBRB 3ENEA 1WM2A 2HE7A 3U7DA 4UDUC 5FK9C 4URKA 3W1SA 3H6NA 2KFKB 4RF0A 2IGDA 4MH0E 4DXFA 4OVZA 2IO3B 1QOAA 3PVLA 3RT3B 2FE8A 2FBWB 4KSLC 3IXSA 3AXCA 3JW0X 2WXIA 2C7MB 2ZPYA 4GDLA 2ZCCA 4RM9A 4ICVA 4M01A 2AEHA 1V1PA 1WM3A 3L13A 4JX1C 2LWPA 1GUAB 2MBQA 3IVFA 3PLUA 4C4VA 1HQRD 4HJGE 3LYYA 2GMIC 1RRBA 3W5VB 3GZNB 3BWUD 1L5PA 3PHWB 4EE2A 3RZFA 3A33B 4IM0A 2MRPA 3PO0A 4RGMA 2LRUA 4GDKB 3SR6A 4DHZB 1OQRA 3AM9A 3L4PA 1LFDA 1IGDA 2KWUB 1FEHA 3ZNZB 2DNFA 2JU6X 1SF0A 4B0EA 2MP2B 1V81A 5DPSA 1V2YA 1YQ4B 4IWOA 2LHEA 2DZIA 2MW5A 3TJPA 1FPYA 5HFYA 3VFKA 1F2RC 2J42A 1UUPA 3T3NA 2WXGA 2C9WB 2AYOB 3N1ZC 2BTEA 1VJKA 4A9AA 3UI3A 1TBEA 1QLBB 1I4GA 2Z0EB 4HDQA 1Y8RC 3ML9A 4I6PA 4J3OD 2IPKD 1F52A 2AL6A 5JHAA 4M00A 2ASQA 5EDSA 1JQ4A 1P1AA 4YWGG 3R7QA 3BVGA 2KQ7A 4IWQA 4WH4A 3DHIC 1TS3A 4B95A 1XQQA 3TSSA 3V60A 1YJ1A 4MGKE 4FBJB 1C4AA 4A20A 4F8CB 3KUCB 3WIMA 1XLNA 2WDTB 5H92C 3NVZA 1D4BA 2HTHA 2YEPF 4PK1A 1BXTA 2KX0A 1P0RA 1XEEA 2QMTA 2Z59B 1I4XA 4XWTA 3UINB 2I1JA 2JZZA 1SBBB 4GDKA 1UELA 1WWTA 3DDCB 4WJOA 4FXCA 3ZUNA 1DOXA 4ZHPA 2N9EB 4HEA1 1R4MB 2OEDA 3T9LA 2K6QA 4F1SA 2TSSA 1ZGUB 1UH6A 4BKSA 2K5PA 4O1NA 4GLSC 3AE5B 2JWZA 1QILA 1YD8U 3W5UB 1ZKHA 4N58A 2D3GA 3WAPA 2HD5B 2CHWA 1XLQA 4BVUC 4AQ7A 4IG7B 1WR6E 2D10A 2V4LA 3C0RB 1HE8A 1YMHE 3DBHB 2BQQA 1AARA 1KM7A 5EE9A 3ZTCA 2HTME 3VAWA 4AWJA 3IT4B 5E6JA 1WE7A 3S2AA 4LNNA 4TUUA 2RGFA 3DOWA 1ESFA 3UF8A 5J17A 4JWSC 3GS2A 2DYBA 1L7YA 1E6EB 4ARCA 1IUEA 2LUMA 3FILB 1KLVA 1IBXB 5LNK1 4WWOA 2JSVX 2M17A 5DCNA 4ZRKA 1E5WA 1P7FA 2KLGA 2ZW0A 3H1UA 1EM7A 3WCQA 1MG4A 1TZ1A 3CMMB 2LVPA 1YN4A 3P2BA 3QC8B 3ZRCA 1ZDVA 3ZLZA 4ANUA 3Q8AA 4KDIC 1XCQL 2Y5CA 1L4DB 2D3CA 2KWCA 2W54A 4RNAA 1V97A 5HI1A 2WDRB 1T3QA 1QT9A 4MACA 2N9LA 4K7WA 4K1RB 3K9OB 1EWYC 3J9CA 2WS3B 3NS1A 4XC2A 2WXHA 3NY5A 5HHDG 2MBHA 2KO3A 1X1MA 2ZCBA 4HCNB 2REXA 3ZJTA 3BZDB 2KVRA 1HEZE 3TL5A 4F7ZA 3AULA 2N9KA 1K53A 5AEKB 2K6DB 4OHJA 3VH4B 1SXTA 4JE3B 3BIID 2KXJA 3MHZA 3NG0A 5G5GA 5BMHA 1F77A 1JWAD 2DX5B 4MGIE 3W2DA 5I4DA 1P9DU 5G2NA 1TGZB 4N6EB 2Z0DB 2VZKB 4EFOA 1WR1A 3EHVA 1CQVA 1V1OA 5KHOA 4HKZE 3MJWA 2K1FA 2RDHA 2DBYA 1WI0A 2OHFA 3T8MA 4BKGA 1PUTA 4WAFA 4EZKA 3PHXB 2KQ4X 1OFFA 2WXOA 1TY2A 4FLHA 2J52A 2NPTA 4BBNC 1F2RI 3M63B 3B2GA 3RNAC 5D2MB 1IGCA 4NQKE 1PGXA 3ZIMA 2A5UA 1P7EA 4RFBA 1J0GA 3RNCC 3BK2A 1TKYA 1IBXA 3BVZA 2FUG1 2XEWA 3Q3FA 2L83A 5E6OA 3A4SC 5JXVA 2EMSA 2CU1A 1WXAA 2L52A 3IHPC 2KDBA 1JWSD 3OJ3A 2BYTA 3PRPB 1ZOYB 2C60A 4E71A 2M0AA 4NY0A 4US9A 4MT5A 3QAQA 1E7UA 1E0ZA 1T0QC 2BS2B 2V3PA 3RUIB 3WANA 3E56A 3ALBA 1FXAA 1UZXB 2ZNVB 3DBLB 2KJHB 2JZ3B 3M3JA 5CTRC 2MA9B 2IJ0A 1AW7A 2PJHA 3QWZB 1LM8B 2K0PA 3B9JA 2PVOD 2KJ6A 1QOGA 2EKEC 3U4EG 3NZ3A 3HHMA 2LFIA 4LK0M 3AE7B 4E3CA 2EKIA 2RMMA 1FM0D 1GPXA 4X57B 2KACA 1FMAD 1S3SG 3L0WB 4W9IA 3CSTA 1PGAA 3A9JB 2AX5A 4MSMB 3ZDMC 3EA6A 3N1XC 2M0XA 2RPVA 1WJ4A 2INCC 2JYEA 2XNAC 4DDGD 1KH0A 4A8XC 2WHIA 1C4PA 1E7PB 3DQVA 5IP4D 3I63C 2QILA 2LGIA 2FNJB 2JWUA 4HK2A 4HPMB 4AJYB 3LDZE 5DPWA 3AEDB 1I4QA 4LCDE 3VH3B 1D3ZA 2NBUA 2D07B 1E8YA 3KYDD 2WDQB 3AEBB 4PYUA 4G3XB 2AWTA 3H7PA 3I3TB 3IG3A 2WLBA 2IDYA 3RULA 2KZRA 4RGTA 4HPLB 3DHHC 2LJ5A 1M4VA 3DBSA 1VD2A 1WXSA 2KD0A 4PS7A 2L00B 4TQ0A 2HDEA 3EUB2 1UBQA 3LXFA 1OEYJ 2DAJA 1RAXA 3CWIA 3UGBB 2ON8A 2M19A 2OJRA 3ZRFA 3RNFC 3O65B 4GXBA 3BINA 4FJVB 4PT5A 3V6CB 4XWWA 1PDXA 1DYQA 1L0YB 4C7YA 2FCQA 2I2YA 1CZPA 2WXNA 1UD7A 1XXGA 4I6LB 3SEBA 1WYWB 1E8WA 1JRUA 1FO4A 2N1WA 4ZOHC 1ISNA 2CJOA 2J0KA 1N63A 4RCOA 2O2VA 2PIAA 3W1SC 1ZE3D 3HIZA 1I4HA 2GRIA 4MM3B 2VH2A 2JUOA 5D3IB 2SEBD 2JPHA 4KV2A 5GMVA 4ZRPA 5AZFA 3V3XA 4NPNA 3U2SC 1QZEA 3A9JA 3TCAA 2W55A 3AE6B 4M8NA 3AE2B 1AYFA 4DXGA 4W9KA 2KK8A 1WMHA 5G55A 1TKGA 4ZRIA 3NVVA 1SE3A 4KX6B 4AP4C 3QA8A 3PZ8A 1TIFA 1IP9A 4BAXA 2YVCA 4II2B 1C1YB 2BWFA 3AE3B 2WXPA 4OZBA 1NENB 1ROEA 2LVQA 3ZYYX 2V9HA 1FRRA 3R2TA 1LQBA 2J4XA 3VDZA 1A70A 5BYSA 2FCSA 3TBLD 1R4NI 3NUHB 4M02A 2JF5A 3HK0A 2BVCA 2LASA 2PLPA 4NZLB 1I42A 2KWDA 2OOBB 2WNMA 1Q10A 4ZRQA 2LEKA 5EE3A 5BMIA 2N7JA 3MC8A 4KZCA 4BOSC 2FIFA 2W3RA 1WXQA 3ZTDA 2EELA 3Q8EA 5D7GA 1GAQB
chains in the Genus database with same CATH topology
1XF5L 1ZXIA 2PVGC 4GLSC 2D5GA 3AE5B 2BS3B 2WU5B 1QILA 3W5UB 1MHHE 2DWQA 4IKGA 3BVMA 4N58A 2WXQA 1FFVA 2I38A 1V1PB 1ACCA 5FKAC 3AE1B 1EWCA 3TEWA 1XLQA 4AQ7A 2WU2B 2WXKA 3VR9B 1SEBD 1PFDA 1N5WA 3ZGZA 2WP9B 1JCKB 2N0SB 3AV8A 3KWLA 2INNE 1ZDXA 1YMHE 4LLGM 1YN3A 2Q5WD 5T8IA 2RDGA 1QQRA 3HVDA 2AQ3B 2ZW1A 2J53A 3AECB 4ZHOA 1C79A 1QOBA 5EE9A 4C56C 2HTME 3P42A 3DWGC 2E6XA 1VZ6A 1WGKA 3IT4B 3AEEB 5E6JA 1FCLA 1BMLC 2JX5A 5MPOA 2MEKA 4DQOC 1YJIA 5C2TB 1ESFA 3AEFB 4HKQA 4P16A 2WQYB 3NVWA 1NYQA 1HXYD 3VQIA 3Q8BA 4NJCA 4JWSC 3GS2A 4ITKA 3RPFC 1MI0A 1RM6C 1MHXA 3MP9A 1E6EB 4ARCA 1UWXA 1DOIA 2AQ2B 1IUEA 2LUMA 3FILB 2NMQA 1IBXB 5LNK1 2JSVX 3NRZA 2Z8LA 3FC4A 2KN4A 4YTPB 1P7FA 1UGJA 1KRHA 2ZW0A 3CIRB 1EM7A 1AN8A 3WCQA 4A90A 1RYJA 2LHDA 4TQ1A 1L6VA 1B9RA 2H88B 1YN4A 2GB1A 4KGTA 1ZUD2 3AE4B 2IGGA 3AN1A 1ZDVA 3Q8AA 1TZOA 2H89B 1XCQL 2Y5CA 1L4DB 2QSDA 4M0WA 2L32A 2WDVB 3ZJUA 2W54A 1ENFA 2CU3A 4RNAA 1OQQA 4D2KA 4ARIA 1V97A 5HI1A 2WDRB 1HZ6A 1MPEA 1T3QA 4MH8A 4O1NA 1QT9A 4MACA 2N9LA 5BMGA 1EU3A 1JWBD 1FCCC 5HG2A 2ACZB 3ZQ4A 1EWYC 4XDCA 3J9CA 2PMVA 2WS3B 3NS1A 2WXHA 1T5XD 3IAM1 2IGHA 5HHDG 5AUIA 3GB1A 2WXMA 2QJLA 2B76B 3ZJTA 4N59A 3BZDB 2PKOA 1KTKA 3HRDD 1YNTE 4RGOS 1HEZE 2MH7A 4RF1A 2N9KA 2ICIA 1K53A 4OHJA 2LJIA 1SXTA 4JE3B 3VRBB 4C7ZA 3BIID 5G5GA 3MHZA 5BMHA 3HUIA 2KDMA 4HRSA 1HZ5A 4A55A 1F77A 3FAHA 2K9XA 1JWAD 1DGJA 1NEKB 2KAJA 3P4PB 4NAMA 4YTNB 3W2DA 5I4DA 3W9CB 3P1MA 5EE1A 4N6EB 1SIJA 1XLPA 1ET9A 2JXTA 2VZKB 4GDLB 1C4CA 5GXGB 1VLBA 3HVZA 1FRDA 1C77A 1L6UA 1UWMA 1CQVA 2QEJC 4TMAB 1V1OA 4TSSA 4HKZE 2RDHA 1LO5D 1N60A 2DBYA 3P4RB 2OHFA 1N5XA 4OZAA 1YN5A 3E9SA 1WRIA 4XE0A 5AUKA 1PUTA 3AE9B 4LTUA 4WAFA 1SJED 2KQ4X 2G1EA 1OFFA 2V3NA 4R3DA 4YTMB 2WXRA 4L2YA 3AMZA 2WXOA 2DLBA 1TY2A 3O13A 2J52A 1YQ3B 4L23A 3DWMA 1F2RI 3B2GA 1IGCA 4WQMA 3U52E 1PGXA 2BT6A 4IOIE 5BYQA 1P7EA 4OZCA 1ZPSA 1N62A 4RFBA 4YSYB 4KKIA 2BS4B 1TKYA 2JQRB 3BK2A 3BVZA 1IBXA 1TY0A 2FUG1 2L83A 3MC0B 5JXVA 2XN9C 3Q8FA 4AS1A 2L52A 3TEXA 5TSSA 4KGSA 1JWSD 2BYTA 4YXDB 1ZOYB 4OW0A 2L1AA 4RH6A 3V05A 1K50A 2M0AA 1TYGB 3P63A 4KKJA 3URYA 1KFYB 4US9A 4MT5A 1TS2A 2Y5PA 3MJ5A 1E0ZA 5C3JB 2BS2B 4US8A 1FD6A 2V3PA 1SB3C 1SSNA 1SJHD 1KLUD 2BW2A 4JPSA 1I4RA 2GI9A 3TEZA 1JROA 2M56B 1WSPA 3E56A 1WYGA 1FXAA 2PTLA 1SE4A 4ZYSA 3SFDB 1JW9D 3VRAB 3TEYA 1VZ7A 2WXJA 1CJEA 3PZ7A 1JWMD 1JRPA 2IJ0A 1FXIA 1AW7A 3AEGB 1B1ZA 3U7ZA 4WWMA 2K0PA 3B9JA 2PVOD 1GOZA 1QOGA 3U4EG 3RFZB 3NZ3A 4UDUC 5FK9C 3W1SA 2LFIA 1KLGD 4LK0M 4RF0A 2IGDA 1NI3A 3AE7B 4WURA 2EKIA 2RMMA 4DXFA 1E10A 4OVZA 3R2IA 2BB5A 1FM0D 1GPXA 1QKZA 2KACA 1QOAA 1FMAD 2WXFA 4L1BA 2FE8A 2JZPA 2FBWB 3IXSA 1AWDA 1PGAA 1NVID 2AX5A 3BYTB 1EU4A 3EA6A 1FIQA 2WXIA 2RPVA 3OWEB 5BYRA 2JYEA 2G9HD 2XNAC 4YSZB 1L4ZB 3LB8C 1KH0A 4A8XC 3P4QB 1C4PA 1F0ZA 1E7PB 1V1PA 2QILA 2VZKD 4JX1C 2LGIA 2JWUA 3P4SB 1QF6A 2V4IB 3EGRA 1HQRD 1DOYA 3AEDB 4HJGE 3SFEB 3VR8B 1I4QA 1GB4A 1XLOA 1JWUD 3LYYA 1C78A 3W5VB 4WIPA 4RGNA 3BWUD 3C8YA 2WDQB 1L5PA 2AQ1B 3AEBB 4EE2A 4USAA 2QIEB 3KLSX 2WLBA 1YJJA 3PO0A 2IDYA 1SE2A 1XO3A 4RGMA 4GDKB 4RGTA 2V0GA 3SR6A 2DYOA 1OQRA 3AM9A 1ZXHA 3I9V1 1M4VA 3L4PA 3ZJVA 1IGDA 1FEHA 3B2FA 4TQ0A 2JU6X 1SF0A 4B0EA 2HDEA 1L0VB 3EUB2 3LXFA 1MVKA 2E3TA 3CWIA 3KQ4A 1HA5A 5EE0A 1YQ4B 4YSXB 2JYTA 2ON8A 2M19A 2KMMA 1T6BX 2LHEA 1D6EC 4PT5A 3FILA 3Q8CA 1D5ZC 5FR3A 2ONQA 4XWWA 3N9YC 3IAS1 5HFYA 1PDXA 1DYQA 1L0YB 1F2RC 4C7YA 2J42A 1UUPA 3T3NA 2WXGA 3BYYB 1CZPA 1J7AA 2I2YA 2WXNA 3NVYA 1XXGA 3SEBA 4P6VF 1V8CA 2BTEA 1VJKA 2WXLA 4A9AA 1FO4A 3UI3A 1JALA 1QLBB 1I4GA 1N61A 1RWSA 4JWUC 4ZOHC 1ET6A 3AB5A 1D5MC 2CJOA 3IT6B 1FNVA 1TJEA 3BK1A 1N63A 4RCOA 5G5HA 2PIAA 2SAKA 1RFKA 1ZE3D 2W3SA 4J3OD 1FNWA 1I4HA 2IPKD 2MJEA 2GRIA 4MM3B 2K22A 5D3IB 1KF6B 1FNUA 2SEBD 5D3DA 4ZRPA 1JQ4A 2PW9A 3V3XA 3T3OA 2NTTA 1XCTL 2K3UA 4YWGG 3BVGA 3U2SC 4YT0B 4WH4A 2W55A 1TS3A 3AE6B 1JMLA 1ZP0B 2LMCA 3TSSA 3AE2B 2MJ3A 1AYFA 2DYMA 4DXGA 1J7CA 3Q69A 1TKGA 1CK1A 2BBCA 1C4AA 2W82A 3NVVA 1K51A 1SE3A 4KX6B 4Q2JA 4B0MA 1GB1A 1FFUA 3PZ8A 1XLNA 2Y3AA 3AE8B 5H92C 3NVZA 1D4BA 1L0XB 1VRAB 1UNSA 4NAWB 1R7SA 2YEPF 4XDDA 3AEAB 4KGRA 4REZA 1TKEA 2BB6A 1BXTA 1TS4A 3ABVB 3ETRA 4C80A 2X38A 1XEEA 1NYRA 3AE3B 4HROA 2QMTA 2WXPA 1I4XA 4OZBA 1NENB 1ROEA 3AH7A 4XWTA 3ZYYX 2MJDA 5H8YE 3TUOA 1VZ8A 1FRRA 3H8HA 1C76A 1SBBB 3R2TA 2J4XA 4A6QA 1A70A 1PYWD 1WWTA 1PGBA 5BYSA 3KWVA 3NUHB 4H2AA 4FXCA 2PLPA 4NZLB 1DOXA 1D5XC 1QOFA 2YEPB 1STEA 4IDIA 4ZHPA 2KWDA 2NTSA 1TS5A 1C9FA 4HEA1 3I57A 2OEDA 2WNMA 1E9MA 1Q10A 4CQNA 2CJNA 4ZRQA 1VDVA 3MFGA 3R8BA 2LEKA 5EE3A 5BMIA 2N7JA 1VR9A 2R61A 2TSSA 1BUIC 1J7BA 2W3RA 3GP7A 2INPE 1WXQA 1Y56A 1K52A 2EELA 3Q8EA 1I7HA 5D7GA 2K5PA 1I4PA 1GAQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVY A;  4N59 A;  1JRP A;  1ZXI A;  2PKO A;  1FXI A;  3HRD D;  4P6V F;  1V8C A;  2PVG C;  3AEG B;  2MH7 A;  3AE5 B;  2BS3 B;  2WU5 B;  1VJK A;  4WWM A;  3W5U B;  4A9A A;  1FO4 A;  2DWQ A;  3B9J A;  1JAL A;  2PVO D;  4N58 A;  1QLB B;  1FFV A;  1N61 A;  1QOG A;  1RWS A;  4JWU C;  3AE1 B;  4ZOH C;  3VRB B;  4C7Z A;  3AB5 A;  3BII D;  2CJO A;  5G5G A;  3HUI A;  1TJE A;  4HRS A;  1XLQ A;  3AE7 B;  1N63 A;  1NI3 A;  5G5H A;  2EKI A;  1E10 A;  2PIA A;  2WU2 B;  3FAH A;  2K9X A;  1RFK A;  1JWA D;  1DGJ A;  2W3S A;  3VR9 B;  1FM0 D;  1GPX A;  1PFD A;  1N5W A;  1QOA A;  1FMA D;  1NEK B;  2KAJ A;  3P4P B;  4YTN B;  2MJE A;  2WP9 B;  2N0S B;  2K22 A;  2FBW B;  1KF6 B;  3AV8 A;  3KWL A;  3W9C B;  2Q5W D;  3P1M A;  1JQ4 A;  1AWD A;  5EE1 A;  1NVI D;  2AX5 A;  4N6E B;  1SIJ A;  1XLP A;  4YT0 B;  1FIQ A;  3AEC B;  5GXG B;  1VLB A;  4ZHO A;  2W55 A;  3HVZ A;  1FRD A;  1L6U A;  1UWM A;  4YSZ B;  3AE6 B;  3LB8 C;  1ZP0 B;  3AE2 B;  1QOB A;  2MJ3 A;  3P4Q B;  5EE9 A;  1AYF A;  1F0Z A;  1N60 A;  1E7P B;  2DBY A;  1J7C A;  2HTM E;  2OHF A;  3DWG C;  3P4R B;  1N5X A;  1WGK A;  1WRI A;  3AEE B;  4JX1 C;  1TKG A;  5AUK A;  1PUT A;  3AE9 B;  4LTU A;  2JX5 A;  5MPO A;  3P4S B;  2G1E A;  1OFF A;  1QF6 A;  4YTM B;  3NVV A;  1YJI A;  5C2T B;  3AEF B;  4KX6 B;  1DOY A;  3AMZ A;  3AED B;  3SFE B;  2WQY B;  3NVW A;  1NYQ A;  3VR8 B;  1FFU A;  1XLO A;  3W5V B;  1YQ3 B;  4JWS C;  1XLN A;  3AE8 B;  5H92 C;  4ITK A;  3NVZ A;  3DWM A;  3RPF C;  1RM6 C;  3B2G A;  2WDQ B;  1R7S A;  1L5P A;  4WQM A;  3AEB B;  3AEA B;  2BT6 A;  1E6E B;  1TKE A;  4USA A;  1DOI A;  1IUE A;  1N62 A;  2QIE B;  3ABV B;  3ETR A;  3NRZ A;  4C80 A;  4YSY B;  1NYR A;  2WLB A;  3AE3 B;  3FC4 A;  2BS4 B;  1TKY A;  2JQR B;  1YJJ A;  3PO0 A;  4HRO A;  4YTP B;  1NEN B;  1ROE A;  3AH7 A;  1KRH A;  1XO3 A;  3CIR B;  3ZYY X;  2L83 A;  3WCQ A;  1RYJ A;  2MJD A;  5H8Y E;  3SR6 A;  1FRR A;  1OQR A;  3AM9 A;  2L52 A;  1L6V A;  3L4P A;  2H88 B;  1B9R A;  1ZUD 2;  1ZOY B;  1A70 A;  1WWT A;  3AE4 B;  4YXD B;  3AN1 A;  5C3J B;  3B2F A;  1TYG B;  3P63 A;  4FXC A;  1SF0 A;  1KFY B;  1DOX A;  1L0V B;  1QOF A;  2H89 B;  3EUB 2;  2Y5C A;  4IDI A;  4ZHP A;  4US9 A;  2WDV B;  3LXF A;  1E0Z A;  2W54 A;  2E3T A;  3CWI A;  2BS2 B;  2CU3 A;  1OQQ A;  1YQ4 B;  5EE0 A;  4YSX B;  1V97 A;  4US8 A;  2WDR B;  1SB3 C;  1T3Q A;  1E9M A;  2M19 A;  1QT9 A;  2CJN A;  1VDV A;  2KMM A;  1JWB D;  2LEK A;  5EE3 A;  1JRO A;  2ACZ B;  2M56 B;  1WYG A;  1EWY C;  1FXA A;  2WS3 B;  3NS1 A;  3SFD B;  1J7B A;  1PDX A;  1JW9 D;  2W3R A;  4C7Y A;  1WXQ A;  5AUI A;  3VRA B;  2QJL A;  2B76 B;  1CJE A;  1I7H A;  2K5P A;  1CZP A;  1J7A A;  1GAQ B; 
#chains in the Genus database with same CATH topology
 3PS6 A;  1ZXI A;  1L2N A;  2PVG C;  2BS3 B;  2WU5 B;  1MHH E;  3H7S A;  4DHJ D;  1ACC A;  4MEL A;  3AE1 B;  4P7I A;  1E90 A;  1C3T A;  1EWC A;  3NS8 A;  4WJN A;  2KNB A;  2LVO A;  2WX1 A;  3JSV A;  1SEB D;  1PFD A;  1N5W A;  1XD3 B;  3ZGZ A;  2WP9 B;  1JCK B;  3AV8 A;  2INN E;  1ZDX A;  1YN3 A;  2Q5W D;  5T8I A;  1F1H A;  2RDG A;  2LRW A;  1P98 A;  3HVD A;  3DVN U;  2J53 A;  3AEC B;  1C79 A;  4DDI D;  3ZDT A;  4FHJ A;  2JRI B;  2E6X A;  3AEE B;  3B1L X;  4FHK A;  2K8B A;  2KFK A;  2KOX A;  4DQO C;  1YJI A;  5C2T B;  3AEF B;  4W9G A;  4HKQ A;  3NVW A;  5JZE B;  4XZ4 A;  4NJ7 A;  4ITK A;  3RPF C;  1RLF A;  1RM6 C;  1Q0W B;  3CF6 E;  1UWX A;  2Y5B B;  1TTN A;  3N30 A;  2NMQ A;  2KTR B;  2M4N A;  3ONS A;  4DWF A;  2G3Q B;  4HPP A;  2KN4 A;  3B0A A;  3APF A;  1AN8 A;  3A9K B;  1T0S C;  2H88 B;  2GB1 A;  2WYQ A;  1ZUD 2;  2IGG A;  3X0W A;  2UWQ A;  1TZO A;  2H89 B;  1MFW A;  2LGY A;  2QSD A;  3ZJU A;  4HDO A;  1ENF A;  4D2K A;  1GNU A;  2KAN A;  1T0Y A;  1EU3 A;  1JWB D;  1FCC C;  5HG2 A;  3ZQ4 A;  4XDC A;  2JT4 B;  2PMV A;  1T5X D;  3IAM 1;  1WJN A;  3KW5 B;  4LNI A;  3GB1 A;  2WXM A;  3QHT A;  4XX5 A;  4MJS B;  4N59 A;  3ZVV A;  2PKO A;  1KTK A;  4RGO S;  2CKH B;  3GE3 C;  3RMK C;  4LJO B;  4RF1 A;  3NHE B;  2ICI A;  3BY4 B;  4LNK A;  2MP2 A;  1P3Q U;  4C7Z A;  3HUI A;  5L83 A;  1DGJ A;  4J6I A;  1NEK B;  1T0R C;  2KAJ A;  4K7S A;  4FA6 A;  2XK5 B;  3A1Q B;  3P1M A;  5EE1 A;  4NJ6 A;  4DXA B;  2LZ6 A;  3N3K B;  4GIV A;  2L05 A;  3HVZ A;  2QEJ C;  4TMA B;  2O6V D;  2GBR A;  1YIW A;  1WRD B;  1YN5 A;  2BWE S;  3E9S A;  3OG5 A;  1EO6 A;  3AE9 B;  4IW0 A;  3VXW A;  3ZKJ C;  3KUZ A;  4ICU A;  3ZNI D;  4L23 A;  2KVZ A;  1EF5 A;  4S17 A;  1WX8 A;  2BT6 A;  2BPS A;  1ZPS A;  4DBG A;  3AU4 A;  3L17 A;  5CHF A;  5IAA C;  2JQR B;  2VH1 A;  2KTR A;  2KKC A;  3MC0 B;  4DHJ B;  1IPG A;  4GOC A;  4PS8 A;  2DEN B;  2XN9 C;  1UBI A;  4OW0 A;  3IFW B;  3V05 A;  4CYE A;  4MDK E;  3P63 A;  3Q2A C;  4KKJ A;  1KFY B;  1K8R B;  3WA0 A;  3JVZ X;  1TS2 A;  2Y5P A;  3OLM D;  5C3J B;  4US8 A;  1E7V A;  1SSN A;  2BW2 A;  1I4R A;  2GI9 A;  2M56 B;  1WYG A;  2IBI B;  2KYW A;  3TEY A;  4EUT A;  1IYF A;  3Q14 C;  3PZ7 A;  4GGQ A;  3RZW C;  2BYE A;  3UIO B;  3MHS D;  5E6N A;  3RFZ B;  1NI2 A;  1GG3 A;  5L95 C;  4ACF A;  4AJW A;  1MJD A;  1NI3 A;  1E10 A;  4P1C C;  2IZV B;  1QKZ A;  2KFJ A;  4L1B A;  2JZP A;  4ANV A;  2XK5 A;  3L08 A;  2RD0 A;  1EU4 A;  2MBB B;  2WGS A;  1FIQ A;  4JQW C;  1WX9 A;  3OWE B;  1KOT A;  2G9H D;  4EZJ A;  1CMX B;  3LB8 C;  1YQB A;  5IOI A;  2MQJ A;  1F0Z A;  2V1Y A;  4C00 A;  2HJ8 A;  3P4S B;  2V4I B;  2NBV B;  2LGD A;  1A5R A;  4BKT A;  2G4S A;  3QAR A;  4M0W B;  4WQO B;  4EZL A;  4WWN A;  4WIP A;  2IO0 B;  3C8Y A;  2KX3 A;  4DHZ E;  2QIE B;  2CS4 A;  4RM8 A;  3W1Y A;  2KDE B;  1XO3 A;  2PEA A;  3EEC A;  3SDL C;  3K9P B;  2V0G A;  2DYO A;  1ZXH A;  4W9H A;  3I9V 1;  3ZJV A;  3TIX A;  3PT2 B;  4B6W A;  3B2F A;  2MSE D;  1L0V B;  5FR6 A;  1OEY A;  3GOE A;  4MGY E;  1MVK A;  4YSX B;  4W9L A;  4P1B C;  3VUY A;  2KMM A;  1T6B X;  1D6E C;  1V6E A;  1SGH A;  3FIL A;  3Q8C A;  1D5Z C;  1RFA A;  3PSE B;  2ONQ A;  3N9Y C;  3WAO A;  3IAS 1;  2FAZ A;  3Q3J A;  2L76 A;  2KN5 A;  2O6V B;  1J7A A;  3NVY A;  2MX2 A;  2WXL A;  1JAL A;  2CR5 A;  1N61 A;  1RWS A;  2JY6 A;  4JWU C;  1ET6 A;  3QQ8 B;  4IWP A;  2EMT A;  1D5M C;  4WJQ A;  1TJE A;  3BK1 A;  3VTV A;  2IO2 B;  5CHV C;  3GZN I;  3UQA A;  1FNW A;  2K22 A;  2GBN A;  2KHW B;  5D3D A;  2PW9 A;  3T3O A;  2NTT A;  2RDB C;  1XCT L;  2K3U A;  2KC2 A;  4YT0 B;  3VTW A;  3SHQ A;  1JML A;  2LMC A;  3PRM B;  4G50 A;  4BOZ B;  2DYM A;  2JRH A;  2WWZ A;  4WJP A;  1CK1 A;  2RPQ A;  2BBC A;  3HM6 X;  3HM3 A;  1K51 A;  4Q2J A;  1WXM A;  2N7D A;  1FFU A;  2YLM A;  1GB1 A;  5AZG A;  1V5T A;  1FXT B;  2K39 A;  4NAW B;  4XDD A;  1NDD A;  3QJZ A;  2BB6 A;  2LXC A;  4N9F 4;  2V3S A;  3KUD B;  4XGA B;  1Q5W B;  3ETR A;  4C80 A;  1MG8 A;  4MGZ E;  1NYR A;  4HRO A;  1YX6 B;  3DHG C;  2D3B A;  2NS5 A;  2RSU A;  2MJD A;  4W9J A;  5H8Y E;  1VZ8 A;  2KT7 A;  1C76 A;  3SU8 X;  2DHZ A;  4KIK B;  4A6Q A;  1PYW D;  3N1Y C;  3Q3M C;  2WX0 A;  4H2A A;  2L3Z A;  1D5X C;  1QOF A;  2YEP B;  1STE A;  3PRZ A;  2NTS A;  3OJ4 B;  2KTF A;  1C9F A;  2KDF B;  3PTF C;  3MFG A;  2BKR B;  1VR9 A;  2R61 A;  1WZ3 A;  1J7B A;  4ANX A;  5IO9 A;  2B3A A;  1YX5 B;  5J18 A;  1J8C A;  1I4P A;  3D32 A;  4K3B A;  2D5G A;  3NOB A;  2DWQ A;  4GMV A;  4BKS D;  2CHX A;  4FUL A;  1Z5S B;  5BO4 B;  2GBK A;  2WXQ A;  2I38 A;  1V1P B;  5FKA C;  4LDT D;  2DZK A;  2JVC A;  3X23 A;  4C4V B;  1OQY A;  4HXD A;  4FJZ A;  3N32 A;  3CSF A;  2N0S B;  4K3C A;  4LLG M;  3KWL A;  4EKU A;  3APD A;  2G4D B;  1QQR A;  3VHT C;  2AQ3 B;  2ZW1 A;  4ZHO A;  3DPD A;  3DVG X;  1V9J A;  2VRR B;  3AI5 A;  1V49 A;  2MLB A;  1FCL A;  2JX5 A;  5LXH A;  2MEK A;  3DCG A;  2KJR A;  3RNE C;  3R7R A;  2C5L C;  1NYQ A;  1HXY D;  4NJC A;  1R4M I;  1WGR A;  2LD9 A;  1WFY A;  2N1V A;  1SE9 A;  4NAW A;  4A3P A;  3V61 A;  3NRZ A;  2KDI A;  4E74 A;  2OJW A;  4NNJ B;  2IYD B;  3FKY A;  5LXI B;  1KRH A;  3CIR B;  1RYJ A;  2LHD A;  1L6V A;  2BYF A;  4JIO U;  4KGT A;  4I6N B;  4IC7 B;  4GB9 A;  4KIK A;  2D11 A;  2L32 A;  2WDV B;  3ZW3 A;  2CU3 A;  2KLC A;  1TT5 B;  1MPE A;  4MH8 A;  2KMC A;  2N9X A;  2I1K A;  4HLE A;  3Q3N C;  1OTR B;  3JYU A;  4BZA A;  3DBH I;  5AUI A;  1Z2M A;  2B76 B;  3HRD D;  1YNT E;  2MH7 A;  1WZ0 A;  4IM2 A;  3VVW B;  2L0F A;  4JL9 A;  3VRB B;  4FN2 A;  2KDM A;  1HZ5 A;  4A55 A;  3FAH A;  2K9X A;  3ZNG C;  4FJY A;  1KJT A;  4NAM A;  4YTN B;  2MWS B;  3PZD A;  3MC9 A;  2K25 A;  5IA7 A;  2GLS A;  2JXT A;  1C4C A;  3I5J C;  4ZYN A;  2L8J A;  4TSS A;  3TMP B;  2BYV E;  3PPA A;  5CX3 A;  1N5X A;  4OZA A;  3L10 B;  5AUK A;  4LTU A;  1SJE D;  2ZZP B;  2G1E A;  2V3N A;  4NQL B;  4YTM B;  2WXR A;  3AMZ A;  4A3O A;  1G6J A;  2DLB A;  1VCB A;  1YQ3 B;  4MM3 A;  3NZS A;  4WQM A;  3ZXR A;  4IOI E;  5BYQ A;  2CHZ A;  3Q6B A;  4OZC A;  1N62 A;  3N20 C;  4ZRJ A;  5IN7 A;  4YSY B;  1UF0 A;  1TY0 A;  4QAY A;  3OAW A;  3EFU A;  1H8C A;  2W9N A;  3TEX A;  4LDT B;  4KGS A;  2KMA A;  4YXD B;  2L1A A;  4W9E A;  1GC7 A;  2FCN A;  1K50 A;  1TYG B;  1WGG A;  3URY A;  2R2Q A;  3PV1 A;  1WE6 A;  2J0J A;  1FD6 A;  3KH0 A;  1WH3 A;  1KLU D;  1WIA A;  1S1Q B;  4JPS A;  3VTU A;  4HWI B;  1SE4 A;  4ZYS A;  3SFD B;  3VRA B;  5C1Z A;  1CJE A;  1JWM D;  3V6E B;  4XYC A;  3U7Z A;  2IY1 B;  4WWM A;  1GOZ A;  3APC A;  1N6Z A;  3KYC D;  1KLG D;  4W9F A;  4FAD A;  2DZJ A;  4WUR A;  5LLI A;  2J7Q B;  3R2I A;  1GC6 A;  2BB5 A;  2WXF A;  2M1M A;  3QK0 A;  2LXA A;  1AWD A;  1WGY A;  1I35 A;  1NVI D;  3BYT B;  2L0T A;  2IO1 B;  5BYR A;  2LUE A;  4YSZ B;  1L4Z B;  5D6J B;  3P4Q B;  5KHQ A;  3U8Z A;  5AZH A;  1XT9 B;  2VZK D;  1QF6 A;  3EGR A;  2BKF A;  2QDF A;  3M95 A;  1DOY A;  1V86 A;  3IBE A;  3SFE B;  3VR8 B;  1GB4 A;  1XLO A;  1JWU D;  1C78 A;  5IKC M;  2JXX A;  3PGE A;  2X8X X;  2KC1 A;  4RGN A;  4JLC A;  2AQ1 B;  1LGR A;  3B08 A;  5DPT A;  3L16 A;  4USA A;  3C19 A;  3DBL I;  3KLS X;  4TV3 A;  4ASW C;  3KVF B;  3U30 A;  1WXV A;  1YJJ A;  3PLV A;  3WAM A;  3EC8 A;  1SE2 A;  2C7H A;  4KZ0 A;  1HTQ A;  4DK5 A;  1Q1O A;  3RN9 C;  2N9P C;  1E8Z A;  2E3T A;  3VUW A;  3KQ4 A;  1HA5 A;  5EE0 A;  2JYT A;  1WX7 A;  5FR3 A;  3M62 B;  3QIJ A;  2ZVO A;  3BYY B;  4W9C A;  3A9K A;  4P6V F;  1V8C A;  4CHK A;  2ZEQ A;  1WY8 A;  1R4N B;  4GN1 A;  2C7N B;  2QCZ A;  3AB5 A;  3IT6 B;  1FNV A;  2LGS A;  5G5H A;  4AUQ C;  2SAK A;  2ZVN A;  1RFK A;  2W3S A;  3DVG Y;  2GBJ A;  2NPT B;  2FCM A;  1BT0 A;  2MJE A;  1KF6 B;  1FNU A;  3H9D A;  1OGW A;  1NBF C;  1V5O A;  4MJS A;  1H4R A;  4LJP B;  1J19 A;  1ZP0 B;  2LGX A;  3RNB C;  2MJ3 A;  4GU2 A;  5JHB A;  1J7C A;  3Q69 A;  3VUX A;  3ZO5 B;  4GSW A;  4G0N B;  4HJK A;  2W82 A;  4B0M A;  3ZNH B;  1WJ6 A;  3NZU A;  2Y3A A;  3AE8 B;  3A1Q A;  1VRA B;  1L0X B;  1UNS A;  1R7S A;  1WGH A;  3AEA B;  4KGR A;  4REZ A;  1TKE A;  2BF8 B;  4PYZ A;  1TS4 A;  3ML8 A;  1LXD A;  3ABV B;  3PRE A;  2PE9 A;  2X38 A;  4II3 B;  3AH7 A;  3R3M A;  2UYZ B;  3RCZ A;  3TUO A;  2BGF A;  1V80 A;  3H8H A;  1PGB A;  3KWV A;  4KSK C;  1E8X A;  3DVN V;  4IDI A;  1TS5 A;  3WAL A;  1UGM A;  3I57 A;  3QCA A;  1E9M A;  4CQN A;  2CJN A;  1VDV A;  3R8B A;  1BUI C;  3L54 A;  3GP7 A;  1ZW7 A;  2INP E;  4MEM A;  1Y56 A;  5HKH A;  1K52 A;  3DBR I;  1I7H A;  1XF5 L;  3AU5 A;  2DAF A;  4IKG A;  2MHJ A;  3BVM A;  3EFC A;  4S0R A;  1FFV A;  2A4Z A;  2XBB C;  4G11 A;  2K8C A;  4KDL B;  3QX1 A;  3TEW A;  2WU2 B;  2WXK A;  3VR9 B;  3Q3O C;  1GJZ A;  3ZXV A;  2PE6 B;  4LNO A;  2DZM A;  3H7P B;  2L7R A;  2D3A A;  2N7E A;  4HVB A;  1EUV B;  1QOB A;  4C56 C;  3P42 A;  3DWG C;  1VZ6 A;  4LNF A;  1WGK A;  2IY0 B;  2ZPN A;  1PQS A;  3SD5 A;  1BML C;  4WWP A;  5MPO A;  1WGD A;  2MBE A;  4P16 A;  2WQY B;  3VQI A;  3Q8B A;  2KWV B;  2LI5 A;  4OVV A;  4TKN A;  1MI0 A;  1MHX A;  3MP9 A;  1WJU A;  5D94 A;  1DOI A;  2AQ2 B;  3RNG C;  4CO7 A;  4ZDV A;  3A4R A;  3UIP B;  2Z8L A;  3FC4 A;  4YTP B;  1UGJ A;  4A90 A;  4TQ1 A;  1B9R A;  2M8S A;  3AE4 B;  3AN1 A;  2G45 B;  1EF1 A;  4M0W A;  2PPH A;  3RYT A;  4ARI A;  1OQQ A;  2FUH B;  4M8M A;  2O2V B;  1HZ6 A;  2KQS A;  5BMG A;  2NBW B;  2ACZ B;  4YL8 A;  1F9J A;  4OVU A;  2IGH A;  2QJL A;  2NR2 A;  1WF9 A;  3RD2 A;  4MSQ B;  2HJ1 A;  2NVU I;  2LJI A;  2AL3 A;  1YOV B;  2QC8 A;  1WMH B;  4RMA A;  4HRS A;  1HTO A;  2QHO A;  2D2Q A;  4JGH B;  3P4P B;  1SIF A;  3W9C B;  4EEW A;  4EOY A;  3NJT A;  1U4A A;  1SIJ A;  1XLP A;  1ET9 A;  2ZNV C;  4WAA A;  2O6V A;  4GDL B;  4KVG B;  5GXG B;  1VLB A;  2NCN A;  3RI7 C;  1FRD A;  2J0M A;  1C77 A;  1L6U A;  1UWM A;  3MTN B;  2MBO A;  1LO5 D;  1N60 A;  5CHW A;  3P4R B;  1WRI A;  4XE0 A;  3ECI A;  4R3D A;  4L2Y A;  5J2R A;  3O13 A;  3DWM A;  4W9D A;  4AOF A;  5DPR A;  3U52 E;  1M94 A;  2FID A;  3UQB A;  2N4F A;  4K81 A;  4KKI A;  4BFR A;  2BS4 B;  5E6P A;  3Q8F A;  4AS1 A;  5TSS A;  4K7U A;  4IUM B;  4RH6 A;  3R66 C;  3V62 A;  4PS3 A;  2UU7 A;  4HCP B;  3MJ5 A;  5TR5 A;  3GE8 C;  2K8H A;  1SB3 C;  2GOW A;  2RR9 A;  1SJH D;  5JH5 C;  2R2O A;  3JSV B;  3TEZ A;  1JRO A;  1WSP A;  2PTL A;  4BBN F;  4ANW A;  2MCN B;  1JW9 D;  2ZJD A;  2IND C;  1VZ7 A;  2WXJ A;  3LJ3 A;  4IM3 A;  1JRP A;  2GBM A;  1FXI A;  4B9K A;  3AEG B;  1B1Z A;  5C23 A;  3DBR B;  3ENE A;  1WM2 A;  2HE7 A;  3U7D A;  4UDU C;  5FK9 C;  4URK A;  3W1S A;  3H6N A;  2KFK B;  4RF0 A;  2IGD A;  4MH0 E;  4DXF A;  4OVZ A;  2IO3 B;  1QOA A;  3PVL A;  3RT3 B;  2FE8 A;  2FBW B;  4KSL C;  3IXS A;  3AXC A;  3JW0 X;  2WXI A;  2C7M B;  2ZPY A;  4GDL A;  2ZCC A;  4RM9 A;  4ICV A;  4M01 A;  2AEH A;  1V1P A;  1WM3 A;  3L13 A;  4JX1 C;  2LWP A;  1GUA B;  2MBQ A;  3IVF A;  3PLU A;  4C4V A;  1HQR D;  4HJG E;  3LYY A;  2GMI C;  1RRB A;  3W5V B;  3GZN B;  3BWU D;  1L5P A;  3PHW B;  4EE2 A;  3RZF A;  3A33 B;  4IM0 A;  2MRP A;  3PO0 A;  4RGM A;  2LRU A;  4GDK B;  3SR6 A;  4DHZ B;  1OQR A;  3AM9 A;  3L4P A;  1LFD A;  1IGD A;  2KWU B;  1FEH A;  3ZNZ B;  2DNF A;  2JU6 X;  1SF0 A;  4B0E A;  2MP2 B;  1V81 A;  5DPS A;  1V2Y A;  1YQ4 B;  4IWO A;  2LHE A;  2DZI A;  2MW5 A;  3TJP A;  1FPY A;  5HFY A;  3VFK A;  1F2R C;  2J42 A;  1UUP A;  3T3N A;  2WXG A;  2C9W B;  2AYO B;  3N1Z C;  2BTE A;  1VJK A;  4A9A A;  3UI3 A;  1TBE A;  1QLB B;  1I4G A;  2Z0E B;  4HDQ A;  1Y8R C;  3ML9 A;  4I6P A;  4J3O D;  2IPK D;  1F52 A;  2AL6 A;  5JHA A;  4M00 A;  2ASQ A;  5EDS A;  1JQ4 A;  1P1A A;  4YWG G;  3R7Q A;  3BVG A;  2KQ7 A;  4IWQ A;  4WH4 A;  3DHI C;  1TS3 A;  4B95 A;  1XQQ A;  3TSS A;  3V60 A;  1YJ1 A;  4MGK E;  4FBJ B;  1C4A A;  4A20 A;  4F8C B;  3KUC B;  3WIM A;  1XLN A;  2WDT B;  5H92 C;  3NVZ A;  1D4B A;  2HTH A;  2YEP F;  4PK1 A;  1BXT A;  2KX0 A;  1P0R A;  1XEE A;  2QMT A;  2Z59 B;  1I4X A;  4XWT A;  3UIN B;  2I1J A;  2JZZ A;  1SBB B;  4GDK A;  1UEL A;  1WWT A;  3DDC B;  4WJO A;  4FXC A;  3ZUN A;  1DOX A;  4ZHP A;  2N9E B;  4HEA 1;  1R4M B;  2OED A;  3T9L A;  2K6Q A;  4F1S A;  2TSS A;  1ZGU B;  1UH6 A;  4BKS A;  2K5P A;  4O1N A;  4GLS C;  3AE5 B;  2JWZ A;  1QIL A;  1YD8 U;  3W5U B;  1ZKH A;  4N58 A;  2D3G A;  3WAP A;  2HD5 B;  2CHW A;  1XLQ A;  4BVU C;  4AQ7 A;  4IG7 B;  1WR6 E;  2D10 A;  2V4L A;  3C0R B;  1HE8 A;  1YMH E;  3DBH B;  2BQQ A;  1AAR A;  1KM7 A;  5EE9 A;  3ZTC A;  2HTM E;  3VAW A;  4AWJ A;  3IT4 B;  5E6J A;  1WE7 A;  3S2A A;  4LNN A;  4TUU A;  2RGF A;  3DOW A;  1ESF A;  3UF8 A;  5J17 A;  4JWS C;  3GS2 A;  2DYB A;  1L7Y A;  1E6E B;  4ARC A;  1IUE A;  2LUM A;  3FIL B;  1KLV A;  1IBX B;  5LNK 1;  4WWO A;  2JSV X;  2M17 A;  5DCN A;  4ZRK A;  1E5W A;  1P7F A;  2KLG A;  2ZW0 A;  3H1U A;  1EM7 A;  3WCQ A;  1MG4 A;  1TZ1 A;  3CMM B;  2LVP A;  1YN4 A;  3P2B A;  3QC8 B;  3ZRC A;  1ZDV A;  3ZLZ A;  4ANU A;  3Q8A A;  4KDI C;  1XCQ L;  2Y5C A;  1L4D B;  2D3C A;  2KWC A;  2W54 A;  4RNA A;  1V97 A;  5HI1 A;  2WDR B;  1T3Q A;  1QT9 A;  4MAC A;  2N9L A;  4K7W A;  4K1R B;  3K9O B;  1EWY C;  3J9C A;  2WS3 B;  3NS1 A;  4XC2 A;  2WXH A;  3NY5 A;  5HHD G;  2MBH A;  2KO3 A;  1X1M A;  2ZCB A;  4HCN B;  2REX A;  3ZJT A;  3BZD B;  2KVR A;  1HEZ E;  3TL5 A;  4F7Z A;  3AUL A;  2N9K A;  1K53 A;  5AEK B;  2K6D B;  4OHJ A;  3VH4 B;  1SXT A;  4JE3 B;  3BII D;  2KXJ A;  3MHZ A;  3NG0 A;  5G5G A;  5BMH A;  1F77 A;  1JWA D;  2DX5 B;  4MGI E;  3W2D A;  5I4D A;  1P9D U;  5G2N A;  1TGZ B;  4N6E B;  2Z0D B;  2VZK B;  4EFO A;  1WR1 A;  3EHV A;  1CQV A;  1V1O A;  5KHO A;  4HKZ E;  3MJW A;  2K1F A;  2RDH A;  2DBY A;  1WI0 A;  2OHF A;  3T8M A;  4BKG A;  1PUT A;  4WAF A;  4EZK A;  3PHX B;  2KQ4 X;  1OFF A;  2WXO A;  1TY2 A;  4FLH A;  2J52 A;  2NPT A;  4BBN C;  1F2R I;  3M63 B;  3B2G A;  3RNA C;  5D2M B;  1IGC A;  4NQK E;  1PGX A;  3ZIM A;  2A5U A;  1P7E A;  4RFB A;  1J0G A;  3RNC C;  3BK2 A;  1TKY A;  1IBX A;  3BVZ A;  2FUG 1;  2XEW A;  3Q3F A;  2L83 A;  5E6O A;  3A4S C;  5JXV A;  2EMS A;  2CU1 A;  1WXA A;  2L52 A;  3IHP C;  2KDB A;  1JWS D;  3OJ3 A;  2BYT A;  3PRP B;  1ZOY B;  2C60 A;  4E71 A;  2M0A A;  4NY0 A;  4US9 A;  4MT5 A;  3QAQ A;  1E7U A;  1E0Z A;  1T0Q C;  2BS2 B;  2V3P A;  3RUI B;  3WAN A;  3E56 A;  3ALB A;  1FXA A;  1UZX B;  2ZNV B;  3DBL B;  2KJH B;  2JZ3 B;  3M3J A;  5CTR C;  2MA9 B;  2IJ0 A;  1AW7 A;  2PJH A;  3QWZ B;  1LM8 B;  2K0P A;  3B9J A;  2PVO D;  2KJ6 A;  1QOG A;  2EKE C;  3U4E G;  3NZ3 A;  3HHM A;  2LFI A;  4LK0 M;  3AE7 B;  4E3C A;  2EKI A;  2RMM A;  1FM0 D;  1GPX A;  4X57 B;  2KAC A;  1FMA D;  1S3S G;  3L0W B;  4W9I A;  3CST A;  1PGA A;  3A9J B;  2AX5 A;  4MSM B;  3ZDM C;  3EA6 A;  3N1X C;  2M0X A;  2RPV A;  1WJ4 A;  2INC C;  2JYE A;  2XNA C;  4DDG D;  1KH0 A;  4A8X C;  2WHI A;  1C4P A;  1E7P B;  3DQV A;  5IP4 D;  3I63 C;  2QIL A;  2LGI A;  2FNJ B;  2JWU A;  4HK2 A;  4HPM B;  4AJY B;  3LDZ E;  5DPW A;  3AED B;  1I4Q A;  4LCD E;  3VH3 B;  1D3Z A;  2NBU A;  2D07 B;  1E8Y A;  3KYD D;  2WDQ B;  3AEB B;  4PYU A;  4G3X B;  2AWT A;  3H7P A;  3I3T B;  3IG3 A;  2WLB A;  2IDY A;  3RUL A;  2KZR A;  4RGT A;  4HPL B;  3DHH C;  2LJ5 A;  1M4V A;  3DBS A;  1VD2 A;  1WXS A;  2KD0 A;  4PS7 A;  2L00 B;  4TQ0 A;  2HDE A;  3EUB 2;  1UBQ A;  3LXF A;  1OEY J;  2DAJ A;  1RAX A;  3CWI A;  3UGB B;  2ON8 A;  2M19 A;  2OJR A;  3ZRF A;  3RNF C;  3O65 B;  4GXB A;  3BIN A;  4FJV B;  4PT5 A;  3V6C B;  4XWW A;  1PDX A;  1DYQ A;  1L0Y B;  4C7Y A;  2FCQ A;  2I2Y A;  1CZP A;  2WXN A;  1UD7 A;  1XXG A;  4I6L B;  3SEB A;  1WYW B;  1E8W A;  1JRU A;  1FO4 A;  2N1W A;  4ZOH C;  1ISN A;  2CJO A;  2J0K A;  1N63 A;  4RCO A;  2O2V A;  2PIA A;  3W1S C;  1ZE3 D;  3HIZ A;  1I4H A;  2GRI A;  4MM3 B;  2VH2 A;  2JUO A;  5D3I B;  2SEB D;  2JPH A;  4KV2 A;  5GMV A;  4ZRP A;  5AZF A;  3V3X A;  4NPN A;  3U2S C;  1QZE A;  3A9J A;  3TCA A;  2W55 A;  3AE6 B;  4M8N A;  3AE2 B;  1AYF A;  4DXG A;  4W9K A;  2KK8 A;  1WMH A;  5G55 A;  1TKG A;  4ZRI A;  3NVV A;  1SE3 A;  4KX6 B;  4AP4 C;  3QA8 A;  3PZ8 A;  1TIF A;  1IP9 A;  4BAX A;  2YVC A;  4II2 B;  1C1Y B;  2BWF A;  3AE3 B;  2WXP A;  4OZB A;  1NEN B;  1ROE A;  2LVQ A;  3ZYY X;  2V9H A;  1FRR A;  3R2T A;  1LQB A;  2J4X A;  3VDZ A;  1A70 A;  5BYS A;  2FCS A;  3TBL D;  1R4N I;  3NUH B;  4M02 A;  2JF5 A;  3HK0 A;  2BVC A;  2LAS A;  2PLP A;  4NZL B;  1I42 A;  2KWD A;  2OOB B;  2WNM A;  1Q10 A;  4ZRQ A;  2LEK A;  5EE3 A;  5BMI A;  2N7J A;  3MC8 A;  4KZC A;  4BOS C;  2FIF A;  2W3R A;  1WXQ A;  3ZTD A;  2EEL A;  3Q8E A;  5D7G A;  1GAQ B; 
#chains in the Genus database with same CATH homology
 1XF5 L;  1ZXI A;  2PVG C;  4GLS C;  2D5G A;  3AE5 B;  2BS3 B;  2WU5 B;  1QIL A;  3W5U B;  1MHH E;  2DWQ A;  4IKG A;  3BVM A;  4N58 A;  2WXQ A;  1FFV A;  2I38 A;  1V1P B;  1ACC A;  5FKA C;  3AE1 B;  1EWC A;  3TEW A;  1XLQ A;  4AQ7 A;  2WU2 B;  2WXK A;  3VR9 B;  1SEB D;  1PFD A;  1N5W A;  3ZGZ A;  2WP9 B;  1JCK B;  2N0S B;  3AV8 A;  3KWL A;  2INN E;  1ZDX A;  1YMH E;  4LLG M;  1YN3 A;  2Q5W D;  5T8I A;  2RDG A;  1QQR A;  3HVD A;  2AQ3 B;  2ZW1 A;  2J53 A;  3AEC B;  4ZHO A;  1C79 A;  1QOB A;  5EE9 A;  4C56 C;  2HTM E;  3P42 A;  3DWG C;  2E6X A;  1VZ6 A;  1WGK A;  3IT4 B;  3AEE B;  5E6J A;  1FCL A;  1BML C;  2JX5 A;  5MPO A;  2MEK A;  4DQO C;  1YJI A;  5C2T B;  1ESF A;  3AEF B;  4HKQ A;  4P16 A;  2WQY B;  3NVW A;  1NYQ A;  1HXY D;  3VQI A;  3Q8B A;  4NJC A;  4JWS C;  3GS2 A;  4ITK A;  3RPF C;  1MI0 A;  1RM6 C;  1MHX A;  3MP9 A;  1E6E B;  4ARC A;  1UWX A;  1DOI A;  2AQ2 B;  1IUE A;  2LUM A;  3FIL B;  2NMQ A;  1IBX B;  5LNK 1;  2JSV X;  3NRZ A;  2Z8L A;  3FC4 A;  2KN4 A;  4YTP B;  1P7F A;  1UGJ A;  1KRH A;  2ZW0 A;  3CIR B;  1EM7 A;  1AN8 A;  3WCQ A;  4A90 A;  1RYJ A;  2LHD A;  4TQ1 A;  1L6V A;  1B9R A;  2H88 B;  1YN4 A;  2GB1 A;  4KGT A;  1ZUD 2;  3AE4 B;  2IGG A;  3AN1 A;  1ZDV A;  3Q8A A;  1TZO A;  2H89 B;  1XCQ L;  2Y5C A;  1L4D B;  2QSD A;  4M0W A;  2L32 A;  2WDV B;  3ZJU A;  2W54 A;  1ENF A;  2CU3 A;  4RNA A;  1OQQ A;  4D2K A;  4ARI A;  1V97 A;  5HI1 A;  2WDR B;  1HZ6 A;  1MPE A;  1T3Q A;  4MH8 A;  4O1N A;  1QT9 A;  4MAC A;  2N9L A;  5BMG A;  1EU3 A;  1JWB D;  1FCC C;  5HG2 A;  2ACZ B;  3ZQ4 A;  1EWY C;  4XDC A;  3J9C A;  2PMV A;  2WS3 B;  3NS1 A;  2WXH A;  1T5X D;  3IAM 1;  2IGH A;  5HHD G;  5AUI A;  3GB1 A;  2WXM A;  2QJL A;  2B76 B;  3ZJT A;  4N59 A;  3BZD B;  2PKO A;  1KTK A;  3HRD D;  1YNT E;  4RGO S;  1HEZ E;  2MH7 A;  4RF1 A;  2N9K A;  2ICI A;  1K53 A;  4OHJ A;  2LJI A;  1SXT A;  4JE3 B;  3VRB B;  4C7Z A;  3BII D;  5G5G A;  3MHZ A;  5BMH A;  3HUI A;  2KDM A;  4HRS A;  1HZ5 A;  4A55 A;  1F77 A;  3FAH A;  2K9X A;  1JWA D;  1DGJ A;  1NEK B;  2KAJ A;  3P4P B;  4NAM A;  4YTN B;  3W2D A;  5I4D A;  3W9C B;  3P1M A;  5EE1 A;  4N6E B;  1SIJ A;  1XLP A;  1ET9 A;  2JXT A;  2VZK B;  4GDL B;  1C4C A;  5GXG B;  1VLB A;  3HVZ A;  1FRD A;  1C77 A;  1L6U A;  1UWM A;  1CQV A;  2QEJ C;  4TMA B;  1V1O A;  4TSS A;  4HKZ E;  2RDH A;  1LO5 D;  1N60 A;  2DBY A;  3P4R B;  2OHF A;  1N5X A;  4OZA A;  1YN5 A;  3E9S A;  1WRI A;  4XE0 A;  5AUK A;  1PUT A;  3AE9 B;  4LTU A;  4WAF A;  1SJE D;  2KQ4 X;  2G1E A;  1OFF A;  2V3N A;  4R3D A;  4YTM B;  2WXR A;  4L2Y A;  3AMZ A;  2WXO A;  2DLB A;  1TY2 A;  3O13 A;  2J52 A;  1YQ3 B;  4L23 A;  3DWM A;  1F2R I;  3B2G A;  1IGC A;  4WQM A;  3U52 E;  1PGX A;  2BT6 A;  4IOI E;  5BYQ A;  1P7E A;  4OZC A;  1ZPS A;  1N62 A;  4RFB A;  4YSY B;  4KKI A;  2BS4 B;  1TKY A;  2JQR B;  3BK2 A;  3BVZ A;  1IBX A;  1TY0 A;  2FUG 1;  2L83 A;  3MC0 B;  5JXV A;  2XN9 C;  3Q8F A;  4AS1 A;  2L52 A;  3TEX A;  5TSS A;  4KGS A;  1JWS D;  2BYT A;  4YXD B;  1ZOY B;  4OW0 A;  2L1A A;  4RH6 A;  3V05 A;  1K50 A;  2M0A A;  1TYG B;  3P63 A;  4KKJ A;  3URY A;  1KFY B;  4US9 A;  4MT5 A;  1TS2 A;  2Y5P A;  3MJ5 A;  1E0Z A;  5C3J B;  2BS2 B;  4US8 A;  1FD6 A;  2V3P A;  1SB3 C;  1SSN A;  1SJH D;  1KLU D;  2BW2 A;  4JPS A;  1I4R A;  2GI9 A;  3TEZ A;  1JRO A;  2M56 B;  1WSP A;  3E56 A;  1WYG A;  1FXA A;  2PTL A;  1SE4 A;  4ZYS A;  3SFD B;  1JW9 D;  3VRA B;  3TEY A;  1VZ7 A;  2WXJ A;  1CJE A;  3PZ7 A;  1JWM D;  1JRP A;  2IJ0 A;  1FXI A;  1AW7 A;  3AEG B;  1B1Z A;  3U7Z A;  4WWM A;  2K0P A;  3B9J A;  2PVO D;  1GOZ A;  1QOG A;  3U4E G;  3RFZ B;  3NZ3 A;  4UDU C;  5FK9 C;  3W1S A;  2LFI A;  1KLG D;  4LK0 M;  4RF0 A;  2IGD A;  1NI3 A;  3AE7 B;  4WUR A;  2EKI A;  2RMM A;  4DXF A;  1E10 A;  4OVZ A;  3R2I A;  2BB5 A;  1FM0 D;  1GPX A;  1QKZ A;  2KAC A;  1QOA A;  1FMA D;  2WXF A;  4L1B A;  2FE8 A;  2JZP A;  2FBW B;  3IXS A;  1AWD A;  1PGA A;  1NVI D;  2AX5 A;  3BYT B;  1EU4 A;  3EA6 A;  1FIQ A;  2WXI A;  2RPV A;  3OWE B;  5BYR A;  2JYE A;  2G9H D;  2XNA C;  4YSZ B;  1L4Z B;  3LB8 C;  1KH0 A;  4A8X C;  3P4Q B;  1C4P A;  1F0Z A;  1E7P B;  1V1P A;  2QIL A;  2VZK D;  4JX1 C;  2LGI A;  2JWU A;  3P4S B;  1QF6 A;  2V4I B;  3EGR A;  1HQR D;  1DOY A;  3AED B;  4HJG E;  3SFE B;  3VR8 B;  1I4Q A;  1GB4 A;  1XLO A;  1JWU D;  3LYY A;  1C78 A;  3W5V B;  4WIP A;  4RGN A;  3BWU D;  3C8Y A;  2WDQ B;  1L5P A;  2AQ1 B;  3AEB B;  4EE2 A;  4USA A;  2QIE B;  3KLS X;  2WLB A;  1YJJ A;  3PO0 A;  2IDY A;  1SE2 A;  1XO3 A;  4RGM A;  4GDK B;  4RGT A;  2V0G A;  3SR6 A;  2DYO A;  1OQR A;  3AM9 A;  1ZXH A;  3I9V 1;  1M4V A;  3L4P A;  3ZJV A;  1IGD A;  1FEH A;  3B2F A;  4TQ0 A;  2JU6 X;  1SF0 A;  4B0E A;  2HDE A;  1L0V B;  3EUB 2;  3LXF A;  1MVK A;  2E3T A;  3CWI A;  3KQ4 A;  1HA5 A;  5EE0 A;  1YQ4 B;  4YSX B;  2JYT A;  2ON8 A;  2M19 A;  2KMM A;  1T6B X;  2LHE A;  1D6E C;  4PT5 A;  3FIL A;  3Q8C A;  1D5Z C;  5FR3 A;  2ONQ A;  4XWW A;  3N9Y C;  3IAS 1;  5HFY A;  1PDX A;  1DYQ A;  1L0Y B;  1F2R C;  4C7Y A;  2J42 A;  1UUP A;  3T3N A;  2WXG A;  3BYY B;  1CZP A;  1J7A A;  2I2Y A;  2WXN A;  3NVY A;  1XXG A;  3SEB A;  4P6V F;  1V8C A;  2BTE A;  1VJK A;  2WXL A;  4A9A A;  1FO4 A;  3UI3 A;  1JAL A;  1QLB B;  1I4G A;  1N61 A;  1RWS A;  4JWU C;  4ZOH C;  1ET6 A;  3AB5 A;  1D5M C;  2CJO A;  3IT6 B;  1FNV A;  1TJE A;  3BK1 A;  1N63 A;  4RCO A;  5G5H A;  2PIA A;  2SAK A;  1RFK A;  1ZE3 D;  2W3S A;  4J3O D;  1FNW A;  1I4H A;  2IPK D;  2MJE A;  2GRI A;  4MM3 B;  2K22 A;  5D3I B;  1KF6 B;  1FNU A;  2SEB D;  5D3D A;  4ZRP A;  1JQ4 A;  2PW9 A;  3V3X A;  3T3O A;  2NTT A;  1XCT L;  2K3U A;  4YWG G;  3BVG A;  3U2S C;  4YT0 B;  4WH4 A;  2W55 A;  1TS3 A;  3AE6 B;  1JML A;  1ZP0 B;  2LMC A;  3TSS A;  3AE2 B;  2MJ3 A;  1AYF A;  2DYM A;  4DXG A;  1J7C A;  3Q69 A;  1TKG A;  1CK1 A;  2BBC A;  1C4A A;  2W82 A;  3NVV A;  1K51 A;  1SE3 A;  4KX6 B;  4Q2J A;  4B0M A;  1GB1 A;  1FFU A;  3PZ8 A;  1XLN A;  2Y3A A;  3AE8 B;  5H92 C;  3NVZ A;  1D4B A;  1L0X B;  1VRA B;  1UNS A;  4NAW B;  1R7S A;  2YEP F;  4XDD A;  3AEA B;  4KGR A;  4REZ A;  1TKE A;  2BB6 A;  1BXT A;  1TS4 A;  3ABV B;  3ETR A;  4C80 A;  2X38 A;  1XEE A;  1NYR A;  3AE3 B;  4HRO A;  2QMT A;  2WXP A;  1I4X A;  4OZB A;  1NEN B;  1ROE A;  3AH7 A;  4XWT A;  3ZYY X;  2MJD A;  5H8Y E;  3TUO A;  1VZ8 A;  1FRR A;  3H8H A;  1C76 A;  1SBB B;  3R2T A;  2J4X A;  4A6Q A;  1A70 A;  1PYW D;  1WWT A;  1PGB A;  5BYS A;  3KWV A;  3NUH B;  4H2A A;  4FXC A;  2PLP A;  4NZL B;  1DOX A;  1D5X C;  1QOF A;  2YEP B;  1STE A;  4IDI A;  4ZHP A;  2KWD A;  2NTS A;  1TS5 A;  1C9F A;  4HEA 1;  3I57 A;  2OED A;  2WNM A;  1E9M A;  1Q10 A;  4CQN A;  2CJN A;  4ZRQ A;  1VDV A;  3MFG A;  3R8B A;  2LEK A;  5EE3 A;  5BMI A;  2N7J A;  1VR9 A;  2R61 A;  2TSS A;  1BUI C;  1J7B A;  2W3R A;  3GP7 A;  2INP E;  1WXQ A;  1Y56 A;  1K52 A;  2EEL A;  3Q8E A;  1I7H A;  5D7G A;  2K5P A;  1I4P A;  1GAQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...