2M19A

Solution structure of the haloferax volcanii hvo 2177 protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
106
structure length
106
Chain Sequence
GGGRDYKDDDDKGTMELELRFFATFREVVGQKSIYWRVDDDATVGDVLRSLEAEYDGLAGRLIEDGEVKPHVNVLKNGREVVHLDGMATALDDGDAVSVFPPVAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ubiquitin-like small archaeal modifier protein 2 from Haloferax volcanii.
pubmed doi rcsb
source organism Haloferax volcanii
molecule tags Protein binding
molecule keywords Molybdopterin converting factor subunit 1
total genus 17
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2m19A00
1FM0D 1ZOYB 2BS2B 4A9AA 3LB8C 3VR9B 1YJIA 1FFUA 3NVVA 1N5XA 3ABVB 3P4RB 2PIAA 4US8A 1QOGA 1T3QA 2ACZB 2L52A 3AM9A 3NVYA 1A70A 4JWSC 1E0ZA 1GPXA 3WCQA 1TKEA 1QOFA 4N58A 2DWQA 2H88B 3L4PA 1B9RA 1N5WA 3BIID 4US9A 4YTNB 1RM6C 3AE9B 4ITKA 1TKGA 1KRHA 1JWBD 5EE0A 1DGJA 5G5HA 3RPFC 1L6UA 3VR8B 5C3JB 2WU5B 4IDIA 3ZYYX 1QLBB 5EE9A 4C7YA 2PVGC 3HUIA 2WS3B 1XLPA 3P1MA 1L5PA 1WRIA 2BS3B 1PUTA 3P4SB 3B2GA 5AUKA 1RYJA 1L0VB 3P63A 2KAJA 1R7SA 3AH7A 3SR6A 2PKOA 1PFDA 2B76B 1JALA 2JQRB 3AE2B 1FFVA 2HTME 3CIRB 1N61A 3KWLA 1F0ZA 2BS4B 2L83A 1QOBA 2CU3A 3PO0A 5EE1A 1E6EB 4WQMA 4JX1C 4YSZB 1SIJA 3AEAB 3P4QB 3VRBB 1YQ3B 4C80A 1NYQA 2PVOD 1KF6B 1JW9D 1DOIA 5GXGB 1FXIA 2K22A 1WWTA 1VJKA 2Y5CA 1NI3A 2KMMA 1FIQA 2WDRB 3EUB2 1EWYC 3NVZA 1J7BA 3W9CB 2K5PA 3AEGB 1QT9A 4USAA 3AMZA 4YT0B 1NEKB 2WDQB 1E9MA 4N59A 1PDXA 5G5GA 1N60A 1ROEA 1YQ4B 4WWMA 5EE3A 2MJEA 3AE5B 2EKIA 3NVWA 4FXCA 2E3TA 4HROA 3AEEB 3AEBB 4N6EB 3SFEB 4YXDB 2QJLA 1N62A 1RFKA 4YTPB 1GAQB 1XO3A 3VRAB 3DWMA 1KFYB 1L6VA 1OQRA 2MJDA 3AEDB 2MH7A 1TYGB 3AB5A 1WGKA 3FC4A 3HRDD 1TJEA 2AX5A 1WYGA 1WXQA 1JWAD 3AE1B 4YTMB 1NYRA 4LTUA 1CJEA 4P6VF 3AEFB 3B9JA 5MPOA 1XLQA 1AWDA 2MJ3A 1E10A 5H8YE 4YSXB 1IUEA 2G1EA 2Q5WD 2W54A 3SFDB 1NVID 1QF6A 2BT6A 1I7HA 4ZOHC 2M19A 1JQ4A 1ZXIA 1JRPA 1VDVA 2WDVB 2WP9B 2WQYB 3AE7B 4YSYB 3W5VB 1FXAA 2JX5A 1V97A 4JWUC 1QOAA 1SB3C 2DBYA 3FAHA 1FRDA 4KX6B 1CZPA 2W55A 1N63A 1AYFA 1J7AA 2WU2B 4ZHOA 3AE8B 1DOYA 2OHFA 1OQQA 3LXFA 1OFFA 3AN1A 4C7ZA 3NS1A 3CWIA 1JROA 2LEKA 3AE3B 1XLOA 3AV8A 2CJOA 1ZP0B 1V8CA 2N0SB 2QIEB 3P4PB 3W5UB 1TKYA 2W3SA 3B2FA 3DWGC 1FRRA 3HVZA 5H92C 5C2TB 4HRSA 1FO4A 4ZHPA 1UWMA 5AUIA 1VLBA 3AE6B 3AE4B 1J7CA 1E7PB 2W3RA 2FBWB 2CJNA 1SF0A 3AECB 2WLBA 1RWSA 1ZUD2 2M56B 1XLNA 2K9XA 1FMAD 3ETRA 1DOXA 1YJJA 2H89B 1NENB 3NRZA
chains in the Genus database with same CATH superfamily
1HZ5A 3A4RA 4WJQA 4US8A 3ENEA 3NUHB 4JE3B 2BB5A 3QARA 5FKAC 1QOFA 4LNNA 4IWOA 3Q3FA 2JXTA 2D3BA 3ZO5B 5C3JB 4W9FA 2XNAC 4W9KA 4RH6A 1XLPA 4GOCA 4A6QA 2C7NB 4JLCA 4LNOA 3PREA 2JQRB 1VZ7A 2N4FA 1E6EB 1C9FA 3A9KA 3AEAB 1UWXA 3BYYB 4OZAA 2L00B 2L0TA 3R8BA 2K22A 2WXPA 1EF5A 3SU8X 1SE4A 3ZKJC 4HLEA 1WGRA 4FJVB 3ZNID 1WFYA 1E5WA 1N60A 2J0MA 1T6BX 3V6CB 3TMPB 2MP2B 5JH5C 3LDZE 1EM7A 3MC8A 3VUYA 2MJDA 3AB5A 3MTNB 2NMQA 4P6VF 5MPOA 4BBNC 2WHIA 3ZNHB 2MCNB 1KLUD 3CSFA 2WXFA 3Q69A 3RNFC 3KUZA 3Q8AA 1E8YA 2LRUA 4RGNA 3ZVVA 2KWVB 1FRDA 4RGTA 4HPLB 1SIFA 1SEBD 3EC8A 3IT6B 4C7ZA 4LDTD 4MGIE 4DXFA 5FR3A 2NPTB 2LVOA 1XLOA 2WDTB 1NDDA 1JWSD 2N9LA 1TKYA 3OJ4B 1JRUA 2INDC 1RLFA 4FADA 3AI5A 1ENFA 4PT5A 1EF1A 1VRAB 2DYBA 2VZKB 2IO2B 3VVWB 1TS5A 3VR9B 1L7YA 1I35A 3DBHI 2L3ZA 4E74A 4MGZE 2N1VA 4GN1A 4EFOA 2LD9A 2QC8A 1WF9A 1YOVB 2LGDA 5EE9A 3WALA 4A3OA 1SJHD 2KFKA 1D5XC 2KDMA 1TIFA 2K25A 3GZNI 2LI5A 3AH7A 4KSKC 4ANVA 3JYUA 2I2YA 2B3AA 3RNGC 1BMLC 2EELA 5J2RA 2D3GA 4LNKA 3VRBB 1FNWA 3BYTB 5AZHA 3TEWA 3EUB2 3NVZA 2N7DA 2JXXA 4BKTA 4E71A 1SSNA 1PDXA 1AW7A 1Q1OA 2MBQA 1Q5WB 4N6EB 3N30A 4MSQB 1VZ8A 2Y3AA 5D2MB 1BXTA 1HEZE 1V2YA 4HDOA 3T3NA 1STEA 5BO4B 3VTWA 4GLSC 3WAPA 2JX5A 1V97A 1SB3C 2JRHA 2OJWA 3IFWB 4GGQA 2LUEA 3AXCA 3QK0A 2G3QB 4K7UA 3OG5A 3E9SA 2ON8A 2D5GA 2D10A 3RZFA 3Q8EA 4BKSD 4KZCA 4ZHPA 3GP7A 2UYZB 2D07B 2FIFA 4EZJA 1C78A 1HTQA 4NAMA 2KTFA 1WM2A 1F9JA 1YJIA 3NVVA 3ABVB 1QOGA 2L52A 3A4SC 4DK5A 1P98A 3UGBB 2H88B 1C4CA 4US9A 4HPPA 2N1WA 5BYQA 2DYMA 2D3AA 2V9HA 1OTRB 3NZSA 2RDBC 1L5PA 4DHJB 1ZKHA 1L0VB 3MP9A 2CS4A 4KSLC 1MG4A 3KWLA 1E7UA 2DLBA 3FILB 4WQMA 1LQBA 4LNIA 4OVVA 1PGAA 1HE8A 1ISNA 2LXCA 5GXGB 3N3KB 1WWTA 3VTUA 2KNBA 1V5OA 5LXHA 3RYTA 3HM3A 2KJRA 1ROEA 2GBMA 3AE5B 2CR5A 3GE3C 4NZLB 1GC6A 4HROA 1F2RC 3V05A 1V9JA 3QCAA 4CYEA 5IAAC 2AX5A 1ZDVA 3JSVA 3H7PB 1D3ZA 3ALBA 4ARCA 1K8RB 1P1AA 3AULA 2NCNA 2BKRB 4TKNA 3W5VB 1WY8A 2NTTA 1ESFA 1CZPA 3Q14C 3CSTA 1N63A 5FR6A 5J17A 2KC2A 2ZPYA 3PHXB 3R7RA 4MT5A 1JROA 2AYOB 1XT9B 2HD5B 3TUOA 4ZRKA 4A55A 1QILA 4FJZA 4NJ6A 1XD3B 1GJZA 2LASA 4NNJB 1WX8A 1UWMA 3LYYA 4J3OD 2LGSA 4CHKA 1M4VA 2UU7A 3QX1A 1F2RI 1SF0A 1XLNA 3ETRA 2H89B 4A90A 1EWCA 4EZLA 2IGDA 2KD0A 4P7IA 4XYCA 1T3QA 1WXMA 2R61A 1QZEA 1R4MI 2CHZA 3JSVB 3A9JA 1TKGA 3EGRA 4W9JA 1XEEA 3DVGX 4C56C 2VH1A 5AZFA 1ET9A 2K6QA 3V3XA 4ZRJA 1P3QU 2IJ0A 4BZAA 4GB9A 3AE2B 2KDFB 4EEWA 3H9DA 1F0ZA 5EE1A 4WWNA 4RM9A 2RDGA 2CHXA 1NYQA 1KTKA 2N9PC 1E7VA 2MEKA 3KVFB 3HVDA 4MGYE 2LZ6A 3I5JC 3IAM1 1KLGD 2O2VB 2KFJA 4MM3A 1YD8U 1C1YB 1P9DU 3FKYA 4S0RA 2GB1A 1CMXB 3VRAB 1KLVA 1SJED 1XF5L 1ZW7A 2MH7A 2YEPB 2C60A 3MHSD 3OWEB 3B08A 1WYGA 4BOZB 1JWAD 5J18A 3B9JA 3M95A 1MPEA 1P7FA 4MSMB 2BPSA 2KN5A 2KQ4X 2NVUI 4GMVA 1NVID 1HTOA 2N7EA 3H8HA 4DHJD 3IAS1 5CX3A 4WURA 2GBRA 2RD0A 2MX2A 2MW5A 2WU2B 1AYFA 1J7AA 4ICUA 2FUG1 1V81A 3A9KB 1OQQA 2A5UA 4WWPA 1WYWB 1TS2A 2QIEB 4CQNA 5C2TB 4NPNA 3AE6B 5D3IB 4M8NA 1PGXA 2GRIA 3AECB 2J7QB 2M56B 1YX5B 4HKQA 1VD2A 2XEWA 2MP2A 4OZBA 2M4NA 4OHJA 4A9AA 4XGAB 2W82A 2EKEC 4MH8A 3Q3MC 2L05A 4ITKA 3R2TA 2KTRA 3QJZA 3L16A 3KQ4A 2IPKD 4XE0A 2WU5B 4IDIA 1P0RA 3IVFA 1Y8RC 4LJOB 2K8CA 2V1YA 1K52A 1WMHA 2ONQA 1GB4A 1EUVB 4G3XB 2KLGA 3ZDTA 1LM8B 4M01A 4ACFA 2KZRA 1SIJA 2MWSB 2WXOA 4N9F4 1NI3A 2WDRB 3EFUA 3W9CB 3PZ7A 2DZIA 2A4ZA 2WDQB 5G5GA 4DBGA 3QQ8B 3NVWA 2BWES 1CQVA 2FNJB 2QJLA 1RAXA 1RFKA 4ZRIA 1XCQL 5AZGA 3ZQ4A 4KGSA 3AEFB 3ML8A 3X23A 4DQOC 2Q5WD 2KFKB 3AE7B 1WMHB 4WWOA 2BYFA 4HJKA 2W55A 1FPYA 3AE8B 1OFFA 3H1UA 3C19A 2QDFA 4O1NA 3EFCA 2N0SB 4HVBA 4AOFA 4BKSA 4AJYB 3MFGA 3IT4B 4HRSA 3KLSX 5BMIA 4NQLB 1K50A 2WLBA 3ZXRA 2N9KA 1YJJA 2KX0A 1XQQA 4DHZE 5JHAA 2BS2B 4WJOA 4G50A 3N1XC 2BKFA 2CHWA 4NAWA 4RF0A 5HFYA 1UUPA 2KO3A 2DWQA 4GDKB 1V1PB 5EE0A 2PW9A 2HDEA 4P1BC 2JRIB 2G9HD 2KXJA 2R2OA 1PUTA 1OEYJ 4REZA 5AUKA 1JALA 2CU1A 2SEBD 2GLSA 1WIAA 1V5TA 4LLGM 4TQ0A 4YSZB 3C8YA 1IGDA 1Q0WB 2NPTA 4K3BA 1KF6B 3VQIA 3DBLI 3KUDB 4K7SA 2BYEA 4D2KA 2JZPA 4ANWA 3L17A 1WXVA 2TSSA 2QCZA 3ZW3A 1ZPSA 2BYTA 4JGHB 4DDID 1YQ4B 2K39A 2L8JA 2N7JA 3AEEB 1VZ6A 1TS3A 3DWMA 3QA8A 4NJCA 3T3OA 3OAWA 2ZVOA 4KKJA 5AEKB 4DXAB 1WXQA 3D32A 1D5MC 4H2AA 3BINA 2FCSA 2HJ1A 2KVZA 2I1JA 3DHHC 2FAZA 2DNFA 3FAHA 2KYWA 1T0YA 1M94A 3DBHB 1WJUA 4S17A 2MBEA 2KDEB 3WIMA 3CWIA 2M0XA 2KQSA 3ZIMA 1GOZA 2PE9A 2KANA 2OEDA 3SHQA 2V3NA 2BVCA 3U30A 5DPRA 1SE9A 3WAMA 2WYQA 2CJNA 2JYTA 2OJRA 4FN2A 2KJHB 4E3CA 4WQOB 4AS1A 1DYQA 4BVUC 4WAAA 2QILA 4BAXA 1ZXHA 3L4PA 2Y5PA 2WWZA 3U7ZA 3RNAC 1N6ZA 4RNAA 1WE7A 1WRDB 2CKHB 3RZWC 4B0MA 2WX0A 2PLPA 3TSSA 2PKOA 1PFDA 2L1AA 2IO3B 4B9KA 1MG8A 2IGHA 2L83A 1QOBA 5T8IA 4OVZA 4RCOA 2NS5A 2JYEA 4ZYSA 2WXLA 1E8XA 4GDLA 1TZ1A 2YEPF 1E90A 1Z2MA 2Y5CA 1BUIC 4MGKE 3DPDA 3ZJTA 4EE2A 1TTNA 5BMGA 3AEGB 4KIKA 3U52E 3ZJUA 2AL3A 1I42A 1G6JA 2O6VB 3ZTDA 2VZKD 1C3TA 2HJ8A 1KFYB 5IO9A 1HQRD 2NBVB 1TJEA 3AE1B 1T0SC 1MHHE 4DHZB 3VXWA 1IPGA 4HDQA 5E6OA 4M0WB 2LWPA 2W9NA 2FUHB 3BZDB 2N9XA 4AWJA 2DAFA 3ZTCA 5CHFA 1Y56A 5DPSA 2ZCBA 2NR2A 3HVZA 1FRRA 3DDCB 4HJGE 1K53A 2EMTA 4KIKB 4FBJB 2LMCA 3TEZA 2FBWB 1RWSA 2C7MB 4MM3B 2MJ3A 2O6VA 3AU4A 4B6WA 4WIPA 2YVCA 1YN5A 2N9EB 1FFUA 3P4RB 4TSSA 2ACZB 3NVYA 3Q6BA 4EZKA 4JWSC 2ZW1A 1OGWA 3RULA 3AE9B 1I4HA 3H7PA 2KHWB 1AN8A 2ZJDA 2BF8B 4IWQA 4OZCA 3ZYYX 1MFWA 2AEHA 2WS3B 3P1MA 2ASQA 3DQVA 3U7DA 2M17A 3L08A 3RN9C 4FHJA 2MA9B 1WGDA 4BFRA 4MACA 1YQ3B 1MI0A 2JZZA 1JWMD 2DZMA 5JXVA 4ANUA 1EO6A 4FULA 3E56A 2INPE 4USAA 5EDSA 1E9MA 4X57B 3X0WA 2MHJA 3BY4B 4KGTA 1GAQB 3DVNU 4KGRA 1TY0A 3O65B 4A8XC 1F52A 2FCMA 4IUMB 2X8XX 1E10A 1A5RA 1Z5SB 3ONSA 1QF6A 1LO5D 2Z0DB 1FO4A 3V62A 2WQYB 4YSYB 5LXIB 1VCBA 2JY6A 1X1MA 2GOWA 1LGRA 1SE3A 4ZHOA 3PLVA 2REXA 3KWVA 1WJ4A 4HCPB 2V4LA 4C4VA 3BK2A 2K6DB 4EUTA 3N20C 2KMAA 1E8ZA 4PS8A 2W3RA 2IDYA 4TMAB 1JMLA 1F1HA 1WH3A 2WXQA 1TGZB 4DXGA 3VHTC 5BYSA 2DZKA 1RRBA 3N32A 4N58A 3ZGZA 1B9RA 2E6XA 4I6LB 4TUUA 3APDA 3VDZA 2PVGC 2LJIA 3A1QB 1D5ZC 4JQWC 2BS3B 4WJPA 2KDIA 2WXRA 3H6NA 3PVLA 2CU3A 4II2B 4PYZA 2R2QA 4YWGG 4EKUA 2LHDA 2KMMA 3NY5A 3ZUNA 1R4NB 2K5PA 3UIPB 4KV2A 2V4IB 4GSWA 1UH6A 1AARA 1T0RC 2D11A 3N9YC 1FNUA 3LJ3A 3BVZA 4F7ZA 2HE7A 3GS2A 4YTPB 4ZRQA 1XO3A 3NS8A 3MHZA 1OQRA 3AEDB 2WNMA 4GDKA 1V1PA 2KWCA 2AQ2B 2LGYA 4RGOS 2G1EA 4FHKA 3DBLB 1I7HA 3ECIA 5G2NA 2DZJA 2IYDB 4MDKE 1FXAA 4RM8A 2M0AA 3VH3B 1JCKB 2FCQA 4MJSB 3AE3B 3TJPA 3URYA 2XK5B 4RMAA 1TY2A 2QSDA 5AUIA 4K1RB 3AE4B 1J7CA 5JHBA 1C79A 4ZYNA 3QHTA 2L7RA 3NHEB 1L0XB 2BWFA 3L0WB 4F1SA 4J6IA 3AM9A 1E0ZA 2Z0EB 2KLCA 3Q2AC 1PGBA 4YTNB 3L13A 4XX5A 1KRHA 2YLMA 4LK0M 5G5HA 3L54A 5IKCM 1P7EA 2HTHA 2I38A 5KHOA 1E8WA 3MC0B 1B1ZA 3SR6A 3MC9A 1FFVA 1I4GA 4ARIA 2DHZA 2PPHA 3TBLD 4IKGA 1OEYA 4JX1C 4F8CB 2KX3A 2FE8A 3APFA 3C0RB 2J52A 1WE6A 4HKZE 1FD6A 1JWUD 4K3CA 2RR9A 5KHQA 1V49A 2M8SA 3RFZB 3DHIC 1QT9A 5HKHA 2QHOA 2BQQA 5CHWA 2EKIA 1UZXB 2VH2A 3NOBA 3KUCB 4RF1A 1HZ6A 5GMVA 5CHVC 1WX9A 4LTUA 1CJEA 2ICIA 1KOTA 2KVRA 4JIOU 3TEXA 1IUEA 2M19A 1JQ4A 3UINB 1ZXIA 5IP4D 2WP9B 2K8BA 3ZDMC 1UELA 3PTFC 4KX6B 4G0NB 4PS7A 5D6JB 1QQRA 2JVCA 1SXTA 3VTVA 4W9CA 3P4PB 4XC2A 1V86A 1WXAA 2MSED 2Z8LA 3B1LX 4ZDVA 1E7PB 3WANA 3BVMA 1DOXA 2O6VD 3NRZA 2BBCA 3UI3A 3ZLZA 3RCZA 2J53A 3Q8CA 1N5XA 2PIAA 1YMHE 5C23A 1TKEA 3VUXA 2KQ7A 3BIID 4BBNF 2KDBA 2FIDA 1SGHA 1ZGUB 3RPFC 1XXGA 2FCNA 3NG0A 3QAQA 2ZNVC 5BMHA 2WXMA 3OJ3A 1H4RA 3K9OB 2PJHA 1R7SA 1S3SG 2B76B 3CIRB 1Q10A 1D4BA 4HK2A 1IBXA 3Q8BA 3P42A 4NQKE 1GG3A 3N1YC 3IG3A 5TR5A 1UGMA 1ZDXA 4HCNB 5G55A 1FEHA 2MBBB 2X38A 4YT0B 4IWPA 2QEJC 4DDGD 1L0YB 4FXCA 2E3TA 3EA6A 3HHMA 3IXSA 2JF5A 3NJTA 1L2NA 2UWQA 2BGFA 5E6PA 2BW2A 2LGIA 2J0KA 2M1MA 1L6VA 4L1BA 4RGMA 3RNBC 2RSUA 3UIOB 3P2BA 3TCAA 4CO7A 1XLQA 2DENB 3V61A 3I3TB 4QAYA 4W9HA 3I63C 2VRRB 4PK1A 3JVZX 1JRPA 4EOYA 2DBYA 3PT2B 1SE2A 4B95A 2LGXA 2WXIA 1C76A 3U2SC 4GDLB 5CTRC 3DBRB 4XWTA 3SDLC 3NZ3A 2GMIC 1YN4A 3RNCC 3W2DA 2LVPA 2BYVE 4W9IA 1FMAD 1NENB 3J9CA 2BTEA 1FM0D 1YN3A 3OLMD 1MHXA 4WJNA 3A33B 2JT4B 1DGJA 3PHWB 4I6PA 4M0WA 1L4DB 1WGYA 2PE6B 3P4SB 5DPTA 4PS3A 5LNK1 3TL5A 2KJ6A 3BVGA 1GC7A 4M8MA 1N61A 2KWUB 1EU4A 3I57A 4LDTB 3P4QB 4LJPB 1OQYA 1IP9A 1WGHA 1DOIA 3MJWA 5JZEB 1VJKA 4AJWA 1YNTE 1MJDA 1NBFC 5DCNA 3PV1A 1MVKA 3QC8B 2GBJA 2K0PA 3WA0A 4M02A 4YXDB 3PGEA 3IHPC 4UDUC 3BK1A 3GZNB 2G4SA 2KOXA 1U4AA 4M00A 1I4RA 3A9JB 4C00A 4IM2A 1AWDA 3ZNGC 2WGSA 4NY0A 2PEAA 3DBRI 3N1ZC 4URKA 1R4NI 2DAJA 2ZVNA 4BOSC 2WXNA 2AWTA 4ZOHC 3A1QA 3PS6A 2WDVB 4IM3A 3GB1A 5TSSA 3BWUD 4XDCA 1I4PA 1D6EC 1GB1A 4K7WA 3W1YA 2L32A 4JPSA 2Y5BB 1UBQA 3AN1A 4XWWA 1IGCA 2K3UA 4W9LA 1RFAA 1S1QB 4TV3A 1WJ6A 2JUOA 1V8CA 1KM7A 2W3SA 4IM0A 2JSVX 1VLBA 3DBSA 2NTSA 4OW0A 4HWIB 2NBUA 2O2VA 2K9XA 1K51A 2BS4B 1YJ1A 3LB8C 4LCDE 4HPMB 1HA5A 4XDDA 2LJ5A 4FLHA 2GBKA 4IOIE 3DOWA 1RM6C 1FNVA 1T5XD 1QLBB 1R4MB 3PZ8A 4KDLB 5FK9C 4IG7B 3T9LA 1WRIA 3B0AA 3B2GA 1TZOA 2J0JA 3PRZA 1LFDA 2JU6X 2KN4A 1F77A 3UQAA 3PRPB 5E6NA 2KT7A 4G11A 2KWDA 1WXSA 3Q8FA 3U8ZA 2C5LC 2MRPA 2V3PA 1KJTA 2LVQA 4MEMA 3W1SC 1GNUA 2IY0B 1J19A 1NEKB 2K1FA 2IZVB 2MLBA 3AEBB 3SFEB 3JW0X 1TT5B 1WSPA 3K9PB 4IC7B 5HG2A 4NAWB 2IY1B 3FC4A 1FCCC 1EU3A 5HI1A 3HIZA 2QMTA 4YTMB 2ZEQA 3L10B 3UF8A 4HXDA 1WI0A 3CF6E 3S2AA 3QWZB 4YSXB 4MELA 1L4ZB 3SFDB 2MBOA 1WJNA 2BT6A 1YQBA 2WXGA 4HEA1 4GXBA 4IW0A 1I4QA 4JWUC 2WXHA 3U4EG 1UD7A 3VUWA 2DX5B 3NS1A 2LEKA 3GE8C 4TQ1A 2INNE 3B2FA 2KK8A 2I1KA 3R7QA 4KDIC 3RNEC 1LXDA 1J0GA 2LRWA 4ASWC 3O13A 3DHGC 1V80A 4LNFA 2L0FA 3PZDA 2IBIB 5E6JA 2K8HA 3KW5B 3ZRFA 2WX1A 1V6EA 2LHEA 2IGGA 4P16A 1IYFA 3PRMB 2IO0B 4C7YA 4L2YA 3VFKA 4FA6A 2V3SA 1RYJA 3P63A 2KAJA 2XN9C 1UNSA 3AU5A 3PO0A 2PVOD 4MJSA 1TS4A 1JW9D 1ZE3D 4W9GA 2XK5A 2OOBB 5EE3A 2RPQA 5D3DA 5HHDG 4B0EA 1J8CA 5D7GA 2ZNVB 1N62A 4BKGA 1QKZA 1PQSA 2RPVA 3HRDD 3ML9A 3RUIB 3Q3OC 4MH0E 2L76A 3V60A 1YX6B 2BB6A 2AL6A 4GIVA 3QIJA 2WXKA 2RDHA 1NI2A 3UQBA 1VR9A 4W9DA 4L23A 2V0GA 1PYWD 1WR1A 3CMMB 3PPAA 3FILA 1DOYA 2PTLA 2JWZA 4A20A 2CJOA 3W5UB 2LFIA 1ACCA 1C4AA 5L95C 3ZNZB 1FIQA 2KMCA 1H8CA 5LLIA 2LXAA 2DYOA 2MQJA 1GPXA 3EECA 3WCQA 3R2IA 1N5WA 1WR6E 3M63B 3VR8B 4AUQC 1I4XA 4Q2JA 3V6EB 4P1CC 3EHVA 1HXYD 2Z59B 2JZ3B 4AP4C 4GU2A 4ZRPA 4KZ0A 1FXIA 2ZZPB 1GUAB 5I4DA 2RMMA 1EWYC 1J7BA 4OVUA 3SD5A 3T8MA 2EMSA 4WWMA 1WZ3A 3WAOA 2ZPNA 4WH4A 2XBBC 4I6NB 2J42A 4PYUA 1WGKA 3ZJVA 3NZUA 3TIXA 2G45B 2PMVA 5H8YE 3I9V1 3ZXVA 2INCC 2NBWB 5L83A 5IOIA 2SAKA 4ICVA 4K81A 4XZ4A 2AQ3B 1VDVA 1UF0A 2KKCA 4W9EA 1QOAA 3M3JA 4WAFA 5IN7A 1IBXB 3W1SA 2OHFA 3RT3B 1UBIA 3KYDD 1TBEA 3DWGC 5H92C 2LUMA 2AQ1B 1ZUD2 1V1OA 3DVNV 1WX7A 1ZOYB 1A70A 1C77A 3Q3JA 4NJ7A 1FXTB 2ZW0A 4II3B 3R3MA 1JWBD 1UGJA 4KKIA 3HK0A 1L6UA 2KACA 4FJYA 2KC1A 3HUIA 1T0QC 5D94A 2D3CA 4DWFA 1BT0A 2GBNA 3KH0A 2ZCCA 2HTME 1WZ0A 1ET6A 1C4PA 4RFBA 4C80A 1WGGA 3SEBA 4C4VB 3HM6X 3H7SA 3DCGA 3AMZA 2J4XA 3R66C 2C9WB 4N59A 1FCLA 2MJEA 3ZRCA 4YL8A 1KH0A 1TYGB 1CK1A 3RMKC 3VH4B 1NYRA 2D2QA 2KTRB 4JL9A 2G4DB 2W54A 4R3DA 3PSEB 2GI9A 3RI7C 3M62B 3GOEA 3TEYA 2C7HA 3DVGY 3MJ5A 1YIWA 4AQ7A 2JWUA 2JPHA 4A3PA 2MBHA 5BYRA 3PLUA 3LXFA 3IBEA 2IO1B 3AV8A 1ZP0B 2WXJA 3Q3NC 4KVGB 4ANXA 5DPWA 5IA7A 5C1ZA 3VAWA 3KYCD 1SBBB 1XCTL 2RGFA 3APCA 3RD2A 1WM3A
chains in the Genus database with same CATH topology
1HZ5A 4OZBA 2WXQA 4OHJA 4A9AA 3LB8C 4US8A 2W82A 4DXGA 1HA5A 3NUHB 4JE3B 2BB5A 4MH8A 5BYSA 5FKAC 4XDDA 4N58A 1QOFA 4IOIE 3ZGZA 1B9RA 2E6XA 2JXTA 1RM6C 4ITKA 3R2TA 1FNVA 3KQ4A 2IPKD 4XE0A 1T5XD 5C3JB 2WU5B 4IDIA 1QLBB 2PVGC 2LJIA 3PZ8A 2XNAC 4RH6A 5FK9C 1XLPA 1D5ZC 1K52A 1WRIA 2BS3B 4A6QA 3B2GA 1TZOA 2ONQA 1GB4A 2JQRB 2JU6X 1VZ7A 2KN4A 1F77A 2WXRA 2CU3A 1E6EB 1C9FA 1SIJA 2KWDA 3AEAB 1UWXA 3BYYB 2WXOA 3Q8FA 4OZAA 4YWGG 3R8BA 2K22A 2WXPA 2LHDA 1NI3A 2KMMA 2V3PA 2WDRB 1SE4A 3W9CB 2K5PA 3PZ7A 2V4IB 1NEKB 3N9YC 2WDQB 5G5GA 1FNUA 1N60A 3BVZA 3NVWA 1T6BX 3AEBB 3SFEB 1CQVA 3GS2A 2QJLA 1RFKA 4YTPB 1EM7A 1WSPA 4ZRQA 1XO3A 5HG2A 3MHZA 1XCQL 1OQRA 2MJDA 3AEDB 4NAWB 3AB5A 3FC4A 2NMQA 1FCCC 1EU3A 5HI1A 3ZQ4A 2QMTA 2WNMA 4YTMB 4KGSA 4P6VF 1V1PA 3AEFB 5MPOA 2AQ2B 4YSXB 1L4ZB 4RGOS 4DQOC 2G1EA 2Q5WD 3SFDB 2BT6A 2WXGA 1I7HA 1KLUD 2WXFA 3Q69A 4HEA1 3Q8AA 3AE7B 1I4QA 1FXAA 4RGNA 4JWUC 2WXHA 1FRDA 4RGTA 3U4EG 1K51A 1SEBD 2M0AA 2W55A 1JCKB 3AE8B 3IT6B 4C7ZA 1OFFA 4DXFA 5FR3A 3NS1A 2LEKA 4TQ1A 3AE3B 1XLOA 2INNE 4O1NA 1JWSD 2N0SB 2N9LA 3URYA 1TKYA 3B2FA 3MFGA 3IT4B 4HRSA 1TY2A 3KLSX 2QSDA 5AUIA 5BMIA 3AE4B 1J7CA 1ENFA 4PT5A 1K50A 2WLBA 1C79A 2N9KA 1YJJA 3O13A 1VRAB 2VZKB 2BS2B 1L0XB 1TS5A 3VR9B 3AM9A 1E0ZA 4RF0A 5HFYA 1UUPA 2DWQA 5E6JA 1PGBA 4YTNB 4GDKB 1KRHA 1V1PB 5EE0A 2LHEA 2PW9A 2IGGA 4LK0M 4P16A 5G5HA 2HDEA 5EE9A 4C7YA 4L2YA 1SJHD 1P7EA 2I38A 1D5XC 2G9HD 1PUTA 2KDMA 3MC0B 4REZA 5AUKA 1RYJA 3P63A 1B1ZA 2KAJA 3AH7A 3SR6A 1JALA 1FFVA 1I4GA 4ARIA 2SEBD 1UNSA 2XN9C 3PO0A 2I2YA 4IKGA 1BMLC 2EELA 4LLGM 4JX1C 4TQ0A 4YSZB 3C8YA 1IGDA 1FNWA 2FE8A 3VRBB 2PVOD 3BYTB 1KF6B 1TS4A 1JW9D 2J52A 3VQIA 4HKZE 3TEWA 1JWUD 3EUB2 3NVZA 1FD6A 1ZE3D 4D2KA 2JZPA 3RFZB 1QT9A 2TSSA 2BYTA 1ZPSA 1SSNA 1PDXA 1AW7A 1YQ4B 5EE3A 2N7JA 2EKIA 5D3DA 4B0EA 5HHDG 3AEEB 5D7GA 4N6EB 1N62A 1VZ6A 1VZ8A 1QKZA 1TS3A 2Y3AA 4RF1A 3DWMA 1HZ6A 4NJCA 3T3OA 1BXTA 1HEZE 2RPVA 3HRDD 4KKJA 1WXQA 4LTUA 1CJEA 2BB6A 3T3NA 1STEA 2ICIA 3TEXA 1D5MC 4H2AA 2WXKA 2RDHA 1IUEA 1VR9A 4GLSC 4L23A 2V0GA 1PYWD 2M19A 1JQ4A 1ZXIA 2WP9B 2JX5A 1V97A 1SB3C 3FAHA 4KX6B 3FILA 1DOYA 1QQRA 3CWIA 1SXTA 3E9SA 2ON8A 2D5GA 2PTLA 1GOZA 3Q8EA 2CJOA 2OEDA 3P4PB 3W5UB 2LFIA 2V3NA 1ACCA 4ZHPA 2Z8LA 1C4AA 3GP7A 1E7PB 2CJNA 2JYTA 3BVMA 1DOXA 1C78A 1FIQA 3NRZA 4NAMA 2BBCA 3UI3A 2J53A 1YJIA 3Q8CA 4AS1A 3NVVA 1N5XA 3ABVB 1DYQA 2DYOA 2PIAA 1QOGA 2L52A 1GPXA 1YMHE 3WCQA 1TKEA 2QILA 1ZXHA 2H88B 3L4PA 2Y5PA 3R2IA 1C4CA 1N5WA 3BIID 4US9A 5BYQA 2DYMA 3U7ZA 4RNAA 3RPFC 1XXGA 3VR8B 4B0MA 5BMHA 1I4XA 2WXMA 2PLPA 4Q2JA 1L5PA 3TSSA 1L0VB 3MP9A 1R7SA 2PKOA 1PFDA 2B76B 3CIRB 2L1AA 1Q10A 2IGHA 1HXYD 3KWLA 1D4BA 1IBXA 3Q8BA 2L83A 1QOBA 5T8IA 2DLBA 3FILB 3P42A 4WQMA 4OVZA 4RCOA 1PGAA 2JYEA 4ZYSA 2WXLA 4ZRPA 2YEPF 5GXGB 1FXIA 1ZDXA 1WWTA 1BUIC 2Y5CA 5I4DA 3ZJTA 2RMMA 4EE2A 1EWYC 1J7BA 1FEHA 5BMGA 3AEGB 2X38A 3U52E 4YT0B 3ZJUA 2QEJC 1ROEA 1L0YB 4WWMA 3AE5B 4FXCA 2E3TA 4HROA 4NZLB 3EA6A 3IXSA 1F2RC 2VZKD 4WH4A 3V05A 2J42A 2BW2A 2LGIA 1KFYB 1L6VA 1HQRD 1WGKA 4L1BA 1TJEA 2AX5A 1ZDVA 4RGMA 3ZJVA 3AE1B 1XLQA 2PMVA 1MHHE 5H8YE 3I9V1 4ARCA 2SAKA 2AQ3B 1JRPA 1VDVA 3W5VB 3BZDB 2NTTA 1QOAA 2DBYA 1SE2A 4WAFA 1ESFA 1IBXB 1CZPA 3W1SA 1N63A 1Y56A 2WXIA 2OHFA 4MT5A 1JROA 1C76A 3U2SC 4GDLB 3TUOA 4A55A 1QILA 4XWTA 3NZ3A 3DWGC 3HVZA 1FRRA 5H92C 1YN4A 4HJGE 1K53A 3W2DA 1UWMA 3LYYA 4J3OD 1M4VA 2LUMA 2LMCA 1F2RI 2FBWB 2AQ1B 3TEZA 1SF0A 1RWSA 1ZUD2 4MM3B 1V1OA 1XLNA 1FMAD 3ETRA 2MJ3A 2H89B 1NENB 3J9CA 4WIPA 2BTEA 4A90A 1YN5A 1FM0D 1YN3A 1ZOYB 1EWCA 1FFUA 2IGDA 3P4RB 4TSSA 2ACZB 1T3QA 3NVYA 2R61A 4JWSC 1A70A 1C77A 1MHXA 2ZW1A 2ZW0A 3AE9B 1TKGA 1I4HA 1JWBD 1AN8A 1UGJA 3EGRA 1XEEA 4KKIA 1DGJA 1L6UA 2KACA 4OZCA 3ZYYX 4C56C 3HUIA 4M0WA 2WS3B 3P1MA 1ET9A 1L4DB 3P4SB 3V3XA 5LNK1 2IJ0A 3BVGA 3AE2B 2HTME 1N61A 1ET6A 1F0ZA 5EE1A 1C4PA 1EU4A 2RDGA 3I57A 4MACA 3P4QB 4RFBA 1YQ3B 4C80A 1NYQA 1KTKA 1MI0A 1DOIA 1VJKA 3SEBA 1JWMD 2MEKA 1YNTE 5JXVA 3HVDA 3E56A 2INPE 4USAA 3AMZA 2J4XA 3IAM1 1KLGD 1E9MA 4N59A 1FCLA 2MJEA 1MVKA 2K0PA 4KGTA 4YXDB 2GB1A 1GAQB 4KGRA 4UDUC 3BK1A 3VRAB 1KH0A 1SJED 1XF5L 1TY0A 1TYGB 2MH7A 1CK1A 2YEPB 3OWEB 1WYGA 1JWAD 1I4RA 1NYRA 4A8XC 3B9JA 1AWDA 1MPEA 1E10A 1P7FA 2KQ4X 1QF6A 2W54A 1LO5D 1NVID 2WXNA 4R3DA 4ZOHC 2GI9A 3H8HA 2WDVB 1FO4A 2WQYB 3IAS1 3MJ5A 4YSYB 3GB1A 3TEYA 5TSSA 3BWUD 2JWUA 4WURA 4XDCA 4AQ7A 1I4PA 1D6EC 1GB1A 2L32A 2WU2B 1AYFA 1J7AA 1SE3A 2FUG1 5BYRA 4ZHOA 1OQQA 3LXFA 3AN1A 4JPSA 4XWWA 1IGCA 2K3UA 3AV8A 3KWVA 1ZP0B 1TS2A 1V8CA 2QIEB 2WXJA 2W3SA 3BK2A 4CQNA 5C2TB 2JSVX 1VLBA 3AE6B 5D3IB 2NTSA 4OW0A 1PGXA 1SBBB 1XCTL 2GRIA 2W3RA 3AECB 2M56B 2K9XA 2IDYA 2BS4B 4TMAB 1JMLA 4HKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FM0 D;  1ZOY B;  2BS2 B;  4A9A A;  3LB8 C;  3VR9 B;  1YJI A;  1FFU A;  3NVV A;  1N5X A;  3ABV B;  3P4R B;  2PIA A;  4US8 A;  1QOG A;  1T3Q A;  2ACZ B;  2L52 A;  3AM9 A;  3NVY A;  1A70 A;  4JWS C;  1E0Z A;  1GPX A;  3WCQ A;  1TKE A;  1QOF A;  4N58 A;  2DWQ A;  2H88 B;  3L4P A;  1B9R A;  1N5W A;  3BII D;  4US9 A;  4YTN B;  1RM6 C;  3AE9 B;  4ITK A;  1TKG A;  1KRH A;  1JWB D;  5EE0 A;  1DGJ A;  5G5H A;  3RPF C;  1L6U A;  3VR8 B;  5C3J B;  2WU5 B;  4IDI A;  3ZYY X;  1QLB B;  5EE9 A;  4C7Y A;  2PVG C;  3HUI A;  2WS3 B;  1XLP A;  3P1M A;  1L5P A;  1WRI A;  2BS3 B;  1PUT A;  3P4S B;  3B2G A;  5AUK A;  1RYJ A;  1L0V B;  3P63 A;  2KAJ A;  1R7S A;  3AH7 A;  3SR6 A;  2PKO A;  1PFD A;  2B76 B;  1JAL A;  2JQR B;  3AE2 B;  1FFV A;  2HTM E;  3CIR B;  1N61 A;  3KWL A;  1F0Z A;  2BS4 B;  2L83 A;  1QOB A;  2CU3 A;  3PO0 A;  5EE1 A;  1E6E B;  4WQM A;  4JX1 C;  4YSZ B;  1SIJ A;  3AEA B;  3P4Q B;  3VRB B;  1YQ3 B;  4C80 A;  1NYQ A;  2PVO D;  1KF6 B;  1JW9 D;  1DOI A;  5GXG B;  1FXI A;  2K22 A;  1WWT A;  1VJK A;  2Y5C A;  1NI3 A;  2KMM A;  1FIQ A;  2WDR B;  3EUB 2;  1EWY C;  3NVZ A;  1J7B A;  3W9C B;  2K5P A;  3AEG B;  1QT9 A;  4USA A;  3AMZ A;  4YT0 B;  1NEK B;  2WDQ B;  1E9M A;  4N59 A;  1PDX A;  5G5G A;  1N60 A;  1ROE A;  1YQ4 B;  4WWM A;  5EE3 A;  2MJE A;  3AE5 B;  2EKI A;  3NVW A;  4FXC A;  2E3T A;  4HRO A;  3AEE B;  3AEB B;  4N6E B;  3SFE B;  4YXD B;  2QJL A;  1N62 A;  1RFK A;  4YTP B;  1GAQ B;  1XO3 A;  3VRA B;  3DWM A;  1KFY B;  1L6V A;  1OQR A;  2MJD A;  3AED B;  2MH7 A;  1TYG B;  3AB5 A;  1WGK A;  3FC4 A;  3HRD D;  1TJE A;  2AX5 A;  1WYG A;  1WXQ A;  1JWA D;  3AE1 B;  4YTM B;  1NYR A;  4LTU A;  1CJE A;  4P6V F;  3AEF B;  3B9J A;  5MPO A;  1XLQ A;  1AWD A;  2MJ3 A;  1E10 A;  5H8Y E;  4YSX B;  1IUE A;  2G1E A;  2Q5W D;  2W54 A;  3SFD B;  1NVI D;  1QF6 A;  2BT6 A;  1I7H A;  4ZOH C;  2M19 A;  1JQ4 A;  1ZXI A;  1JRP A;  1VDV A;  2WDV B;  2WP9 B;  2WQY B;  3AE7 B;  4YSY B;  3W5V B;  1FXA A;  2JX5 A;  1V97 A;  4JWU C;  1QOA A;  1SB3 C;  2DBY A;  3FAH A;  1FRD A;  4KX6 B;  1CZP A;  2W55 A;  1N63 A;  1AYF A;  1J7A A;  2WU2 B;  4ZHO A;  3AE8 B;  1DOY A;  2OHF A;  1OQQ A;  3LXF A;  1OFF A;  3AN1 A;  4C7Z A;  3NS1 A;  3CWI A;  1JRO A;  2LEK A;  3AE3 B;  1XLO A;  3AV8 A;  2CJO A;  1ZP0 B;  1V8C A;  2N0S B;  2QIE B;  3P4P B;  3W5U B;  1TKY A;  2W3S A;  3B2F A;  3DWG C;  1FRR A;  3HVZ A;  5H92 C;  5C2T B;  4HRS A;  1FO4 A;  4ZHP A;  1UWM A;  5AUI A;  1VLB A;  3AE6 B;  3AE4 B;  1J7C A;  1E7P B;  2W3R A;  2FBW B;  2CJN A;  1SF0 A;  3AEC B;  2WLB A;  1RWS A;  1ZUD 2;  2M56 B;  1XLN A;  2K9X A;  1FMA D;  3ETR A;  1DOX A;  1YJJ A;  2H89 B;  1NEN B;  3NRZ A; 
#chains in the Genus database with same CATH topology
 1HZ5 A;  3A4R A;  4WJQ A;  4US8 A;  3ENE A;  3NUH B;  4JE3 B;  2BB5 A;  3QAR A;  5FKA C;  1QOF A;  4LNN A;  4IWO A;  3Q3F A;  2JXT A;  2D3B A;  3ZO5 B;  5C3J B;  4W9F A;  2XNA C;  4W9K A;  4RH6 A;  1XLP A;  4GOC A;  4A6Q A;  2C7N B;  4JLC A;  4LNO A;  3PRE A;  2JQR B;  1VZ7 A;  2N4F A;  1E6E B;  1C9F A;  3A9K A;  3AEA B;  1UWX A;  3BYY B;  4OZA A;  2L00 B;  2L0T A;  3R8B A;  2K22 A;  2WXP A;  1EF5 A;  3SU8 X;  1SE4 A;  3ZKJ C;  4HLE A;  1WGR A;  4FJV B;  3ZNI D;  1WFY A;  1E5W A;  1N60 A;  2J0M A;  1T6B X;  3V6C B;  3TMP B;  2MP2 B;  5JH5 C;  3LDZ E;  1EM7 A;  3MC8 A;  3VUY A;  2MJD A;  3AB5 A;  3MTN B;  2NMQ A;  4P6V F;  5MPO A;  4BBN C;  2WHI A;  3ZNH B;  2MCN B;  1KLU D;  3CSF A;  2WXF A;  3Q69 A;  3RNF C;  3KUZ A;  3Q8A A;  1E8Y A;  2LRU A;  4RGN A;  3ZVV A;  2KWV B;  1FRD A;  4RGT A;  4HPL B;  1SIF A;  1SEB D;  3EC8 A;  3IT6 B;  4C7Z A;  4LDT D;  4MGI E;  4DXF A;  5FR3 A;  2NPT B;  2LVO A;  1XLO A;  2WDT B;  1NDD A;  1JWS D;  2N9L A;  1TKY A;  3OJ4 B;  1JRU A;  2IND C;  1RLF A;  4FAD A;  3AI5 A;  1ENF A;  4PT5 A;  1EF1 A;  1VRA B;  2DYB A;  2VZK B;  2IO2 B;  3VVW B;  1TS5 A;  3VR9 B;  1L7Y A;  1I35 A;  3DBH I;  2L3Z A;  4E74 A;  4MGZ E;  2N1V A;  4GN1 A;  4EFO A;  2LD9 A;  2QC8 A;  1WF9 A;  1YOV B;  2LGD A;  5EE9 A;  3WAL A;  4A3O A;  1SJH D;  2KFK A;  1D5X C;  2KDM A;  1TIF A;  2K25 A;  3GZN I;  2LI5 A;  3AH7 A;  4KSK C;  4ANV A;  3JYU A;  2I2Y A;  2B3A A;  3RNG C;  1BML C;  2EEL A;  5J2R A;  2D3G A;  4LNK A;  3VRB B;  1FNW A;  3BYT B;  5AZH A;  3TEW A;  3EUB 2;  3NVZ A;  2N7D A;  2JXX A;  4BKT A;  4E71 A;  1SSN A;  1PDX A;  1AW7 A;  1Q1O A;  2MBQ A;  1Q5W B;  4N6E B;  3N30 A;  4MSQ B;  1VZ8 A;  2Y3A A;  5D2M B;  1BXT A;  1HEZ E;  1V2Y A;  4HDO A;  3T3N A;  1STE A;  5BO4 B;  3VTW A;  4GLS C;  3WAP A;  2JX5 A;  1V97 A;  1SB3 C;  2JRH A;  2OJW A;  3IFW B;  4GGQ A;  2LUE A;  3AXC A;  3QK0 A;  2G3Q B;  4K7U A;  3OG5 A;  3E9S A;  2ON8 A;  2D5G A;  2D10 A;  3RZF A;  3Q8E A;  4BKS D;  4KZC A;  4ZHP A;  3GP7 A;  2UYZ B;  2D07 B;  2FIF A;  4EZJ A;  1C78 A;  1HTQ A;  4NAM A;  2KTF A;  1WM2 A;  1F9J A;  1YJI A;  3NVV A;  3ABV B;  1QOG A;  2L52 A;  3A4S C;  4DK5 A;  1P98 A;  3UGB B;  2H88 B;  1C4C A;  4US9 A;  4HPP A;  2N1W A;  5BYQ A;  2DYM A;  2D3A A;  2V9H A;  1OTR B;  3NZS A;  2RDB C;  1L5P A;  4DHJ B;  1ZKH A;  1L0V B;  3MP9 A;  2CS4 A;  4KSL C;  1MG4 A;  3KWL A;  1E7U A;  2DLB A;  3FIL B;  4WQM A;  1LQB A;  4LNI A;  4OVV A;  1PGA A;  1HE8 A;  1ISN A;  2LXC A;  5GXG B;  3N3K B;  1WWT A;  3VTU A;  2KNB A;  1V5O A;  5LXH A;  3RYT A;  3HM3 A;  2KJR A;  1ROE A;  2GBM A;  3AE5 B;  2CR5 A;  3GE3 C;  4NZL B;  1GC6 A;  4HRO A;  1F2R C;  3V05 A;  1V9J A;  3QCA A;  4CYE A;  5IAA C;  2AX5 A;  1ZDV A;  3JSV A;  3H7P B;  1D3Z A;  3ALB A;  4ARC A;  1K8R B;  1P1A A;  3AUL A;  2NCN A;  2BKR B;  4TKN A;  3W5V B;  1WY8 A;  2NTT A;  1ESF A;  1CZP A;  3Q14 C;  3CST A;  1N63 A;  5FR6 A;  5J17 A;  2KC2 A;  2ZPY A;  3PHX B;  3R7R A;  4MT5 A;  1JRO A;  2AYO B;  1XT9 B;  2HD5 B;  3TUO A;  4ZRK A;  4A55 A;  1QIL A;  4FJZ A;  4NJ6 A;  1XD3 B;  1GJZ A;  2LAS A;  4NNJ B;  1WX8 A;  1UWM A;  3LYY A;  4J3O D;  2LGS A;  4CHK A;  1M4V A;  2UU7 A;  3QX1 A;  1F2R I;  1SF0 A;  1XLN A;  3ETR A;  2H89 B;  4A90 A;  1EWC A;  4EZL A;  2IGD A;  2KD0 A;  4P7I A;  4XYC A;  1T3Q A;  1WXM A;  2R61 A;  1QZE A;  1R4M I;  2CHZ A;  3JSV B;  3A9J A;  1TKG A;  3EGR A;  4W9J A;  1XEE A;  3DVG X;  4C56 C;  2VH1 A;  5AZF A;  1ET9 A;  2K6Q A;  3V3X A;  4ZRJ A;  1P3Q U;  2IJ0 A;  4BZA A;  4GB9 A;  3AE2 B;  2KDF B;  4EEW A;  3H9D A;  1F0Z A;  5EE1 A;  4WWN A;  4RM9 A;  2RDG A;  2CHX A;  1NYQ A;  1KTK A;  2N9P C;  1E7V A;  2MEK A;  3KVF B;  3HVD A;  4MGY E;  2LZ6 A;  3I5J C;  3IAM 1;  1KLG D;  2O2V B;  2KFJ A;  4MM3 A;  1YD8 U;  1C1Y B;  1P9D U;  3FKY A;  4S0R A;  2GB1 A;  1CMX B;  3VRA B;  1KLV A;  1SJE D;  1XF5 L;  1ZW7 A;  2MH7 A;  2YEP B;  2C60 A;  3MHS D;  3OWE B;  3B08 A;  1WYG A;  4BOZ B;  1JWA D;  5J18 A;  3B9J A;  3M95 A;  1MPE A;  1P7F A;  4MSM B;  2BPS A;  2KN5 A;  2KQ4 X;  2NVU I;  4GMV A;  1NVI D;  1HTO A;  2N7E A;  3H8H A;  4DHJ D;  3IAS 1;  5CX3 A;  4WUR A;  2GBR A;  2RD0 A;  2MX2 A;  2MW5 A;  2WU2 B;  1AYF A;  1J7A A;  4ICU A;  2FUG 1;  1V81 A;  3A9K B;  1OQQ A;  2A5U A;  4WWP A;  1WYW B;  1TS2 A;  2QIE B;  4CQN A;  5C2T B;  4NPN A;  3AE6 B;  5D3I B;  4M8N A;  1PGX A;  2GRI A;  3AEC B;  2J7Q B;  2M56 B;  1YX5 B;  4HKQ A;  1VD2 A;  2XEW A;  2MP2 A;  4OZB A;  2M4N A;  4OHJ A;  4A9A A;  4XGA B;  2W82 A;  2EKE C;  4MH8 A;  3Q3M C;  2L05 A;  4ITK A;  3R2T A;  2KTR A;  3QJZ A;  3L16 A;  3KQ4 A;  2IPK D;  4XE0 A;  2WU5 B;  4IDI A;  1P0R A;  3IVF A;  1Y8R C;  4LJO B;  2K8C A;  2V1Y A;  1K52 A;  1WMH A;  2ONQ A;  1GB4 A;  1EUV B;  4G3X B;  2KLG A;  3ZDT A;  1LM8 B;  4M01 A;  4ACF A;  2KZR A;  1SIJ A;  2MWS B;  2WXO A;  4N9F 4;  1NI3 A;  2WDR B;  3EFU A;  3W9C B;  3PZ7 A;  2DZI A;  2A4Z A;  2WDQ B;  5G5G A;  4DBG A;  3QQ8 B;  3NVW A;  2BWE S;  1CQV A;  2FNJ B;  2QJL A;  1RAX A;  1RFK A;  4ZRI A;  1XCQ L;  5AZG A;  3ZQ4 A;  4KGS A;  3AEF B;  3ML8 A;  3X23 A;  4DQO C;  2Q5W D;  2KFK B;  3AE7 B;  1WMH B;  4WWO A;  2BYF A;  4HJK A;  2W55 A;  1FPY A;  3AE8 B;  1OFF A;  3H1U A;  3C19 A;  2QDF A;  4O1N A;  3EFC A;  2N0S B;  4HVB A;  4AOF A;  4BKS A;  4AJY B;  3MFG A;  3IT4 B;  4HRS A;  3KLS X;  5BMI A;  4NQL B;  1K50 A;  2WLB A;  3ZXR A;  2N9K A;  1YJJ A;  2KX0 A;  1XQQ A;  4DHZ E;  5JHA A;  2BS2 B;  4WJO A;  4G50 A;  3N1X C;  2BKF A;  2CHW A;  4NAW A;  4RF0 A;  5HFY A;  1UUP A;  2KO3 A;  2DWQ A;  4GDK B;  1V1P B;  5EE0 A;  2PW9 A;  2HDE A;  4P1B C;  2JRI B;  2G9H D;  2KXJ A;  2R2O A;  1PUT A;  1OEY J;  4REZ A;  5AUK A;  1JAL A;  2CU1 A;  2SEB D;  2GLS A;  1WIA A;  1V5T A;  4LLG M;  4TQ0 A;  4YSZ B;  3C8Y A;  1IGD A;  1Q0W B;  2NPT A;  4K3B A;  1KF6 B;  3VQI A;  3DBL I;  3KUD B;  4K7S A;  2BYE A;  4D2K A;  2JZP A;  4ANW A;  3L17 A;  1WXV A;  2TSS A;  2QCZ A;  3ZW3 A;  1ZPS A;  2BYT A;  4JGH B;  4DDI D;  1YQ4 B;  2K39 A;  2L8J A;  2N7J A;  3AEE B;  1VZ6 A;  1TS3 A;  3DWM A;  3QA8 A;  4NJC A;  3T3O A;  3OAW A;  2ZVO A;  4KKJ A;  5AEK B;  4DXA B;  1WXQ A;  3D32 A;  1D5M C;  4H2A A;  3BIN A;  2FCS A;  2HJ1 A;  2KVZ A;  2I1J A;  3DHH C;  2FAZ A;  2DNF A;  3FAH A;  2KYW A;  1T0Y A;  1M94 A;  3DBH B;  1WJU A;  4S17 A;  2MBE A;  2KDE B;  3WIM A;  3CWI A;  2M0X A;  2KQS A;  3ZIM A;  1GOZ A;  2PE9 A;  2KAN A;  2OED A;  3SHQ A;  2V3N A;  2BVC A;  3U30 A;  5DPR A;  1SE9 A;  3WAM A;  2WYQ A;  2CJN A;  2JYT A;  2OJR A;  4FN2 A;  2KJH B;  4E3C A;  4WQO B;  4AS1 A;  1DYQ A;  4BVU C;  4WAA A;  2QIL A;  4BAX A;  1ZXH A;  3L4P A;  2Y5P A;  2WWZ A;  3U7Z A;  3RNA C;  1N6Z A;  4RNA A;  1WE7 A;  1WRD B;  2CKH B;  3RZW C;  4B0M A;  2WX0 A;  2PLP A;  3TSS A;  2PKO A;  1PFD A;  2L1A A;  2IO3 B;  4B9K A;  1MG8 A;  2IGH A;  2L83 A;  1QOB A;  5T8I A;  4OVZ A;  4RCO A;  2NS5 A;  2JYE A;  4ZYS A;  2WXL A;  1E8X A;  4GDL A;  1TZ1 A;  2YEP F;  1E90 A;  1Z2M A;  2Y5C A;  1BUI C;  4MGK E;  3DPD A;  3ZJT A;  4EE2 A;  1TTN A;  5BMG A;  3AEG B;  4KIK A;  3U52 E;  3ZJU A;  2AL3 A;  1I42 A;  1G6J A;  2O6V B;  3ZTD A;  2VZK D;  1C3T A;  2HJ8 A;  1KFY B;  5IO9 A;  1HQR D;  2NBV B;  1TJE A;  3AE1 B;  1T0S C;  1MHH E;  4DHZ B;  3VXW A;  1IPG A;  4HDQ A;  5E6O A;  4M0W B;  2LWP A;  2W9N A;  2FUH B;  3BZD B;  2N9X A;  4AWJ A;  2DAF A;  3ZTC A;  5CHF A;  1Y56 A;  5DPS A;  2ZCB A;  2NR2 A;  3HVZ A;  1FRR A;  3DDC B;  4HJG E;  1K53 A;  2EMT A;  4KIK B;  4FBJ B;  2LMC A;  3TEZ A;  2FBW B;  1RWS A;  2C7M B;  4MM3 B;  2MJ3 A;  2O6V A;  3AU4 A;  4B6W A;  4WIP A;  2YVC A;  1YN5 A;  2N9E B;  1FFU A;  3P4R B;  4TSS A;  2ACZ B;  3NVY A;  3Q6B A;  4EZK A;  4JWS C;  2ZW1 A;  1OGW A;  3RUL A;  3AE9 B;  1I4H A;  3H7P A;  2KHW B;  1AN8 A;  2ZJD A;  2BF8 B;  4IWQ A;  4OZC A;  3ZYY X;  1MFW A;  2AEH A;  2WS3 B;  3P1M A;  2ASQ A;  3DQV A;  3U7D A;  2M17 A;  3L08 A;  3RN9 C;  4FHJ A;  2MA9 B;  1WGD A;  4BFR A;  4MAC A;  1YQ3 B;  1MI0 A;  2JZZ A;  1JWM D;  2DZM A;  5JXV A;  4ANU A;  1EO6 A;  4FUL A;  3E56 A;  2INP E;  4USA A;  5EDS A;  1E9M A;  4X57 B;  3X0W A;  2MHJ A;  3BY4 B;  4KGT A;  1GAQ B;  3DVN U;  4KGR A;  1TY0 A;  3O65 B;  4A8X C;  1F52 A;  2FCM A;  4IUM B;  2X8X X;  1E10 A;  1A5R A;  1Z5S B;  3ONS A;  1QF6 A;  1LO5 D;  2Z0D B;  1FO4 A;  3V62 A;  2WQY B;  4YSY B;  5LXI B;  1VCB A;  2JY6 A;  1X1M A;  2GOW A;  1LGR A;  1SE3 A;  4ZHO A;  3PLV A;  2REX A;  3KWV A;  1WJ4 A;  4HCP B;  2V4L A;  4C4V A;  3BK2 A;  2K6D B;  4EUT A;  3N20 C;  2KMA A;  1E8Z A;  4PS8 A;  2W3R A;  2IDY A;  4TMA B;  1JML A;  1F1H A;  1WH3 A;  2WXQ A;  1TGZ B;  4DXG A;  3VHT C;  5BYS A;  2DZK A;  1RRB A;  3N32 A;  4N58 A;  3ZGZ A;  1B9R A;  2E6X A;  4I6L B;  4TUU A;  3APD A;  3VDZ A;  2PVG C;  2LJI A;  3A1Q B;  1D5Z C;  4JQW C;  2BS3 B;  4WJP A;  2KDI A;  2WXR A;  3H6N A;  3PVL A;  2CU3 A;  4II2 B;  4PYZ A;  2R2Q A;  4YWG G;  4EKU A;  2LHD A;  2KMM A;  3NY5 A;  3ZUN A;  1R4N B;  2K5P A;  3UIP B;  4KV2 A;  2V4I B;  4GSW A;  1UH6 A;  1AAR A;  1T0R C;  2D11 A;  3N9Y C;  1FNU A;  3LJ3 A;  3BVZ A;  4F7Z A;  2HE7 A;  3GS2 A;  4YTP B;  4ZRQ A;  1XO3 A;  3NS8 A;  3MHZ A;  1OQR A;  3AED B;  2WNM A;  4GDK A;  1V1P A;  2KWC A;  2AQ2 B;  2LGY A;  4RGO S;  2G1E A;  4FHK A;  3DBL B;  1I7H A;  3ECI A;  5G2N A;  2DZJ A;  2IYD B;  4MDK E;  1FXA A;  4RM8 A;  2M0A A;  3VH3 B;  1JCK B;  2FCQ A;  4MJS B;  3AE3 B;  3TJP A;  3URY A;  2XK5 B;  4RMA A;  1TY2 A;  2QSD A;  5AUI A;  4K1R B;  3AE4 B;  1J7C A;  5JHB A;  1C79 A;  4ZYN A;  3QHT A;  2L7R A;  3NHE B;  1L0X B;  2BWF A;  3L0W B;  4F1S A;  4J6I A;  3AM9 A;  1E0Z A;  2Z0E B;  2KLC A;  3Q2A C;  1PGB A;  4YTN B;  3L13 A;  4XX5 A;  1KRH A;  2YLM A;  4LK0 M;  5G5H A;  3L54 A;  5IKC M;  1P7E A;  2HTH A;  2I38 A;  5KHO A;  1E8W A;  3MC0 B;  1B1Z A;  3SR6 A;  3MC9 A;  1FFV A;  1I4G A;  4ARI A;  2DHZ A;  2PPH A;  3TBL D;  4IKG A;  1OEY A;  4JX1 C;  4F8C B;  2KX3 A;  2FE8 A;  3APF A;  3C0R B;  2J52 A;  1WE6 A;  4HKZ E;  1FD6 A;  1JWU D;  4K3C A;  2RR9 A;  5KHQ A;  1V49 A;  2M8S A;  3RFZ B;  3DHI C;  1QT9 A;  5HKH A;  2QHO A;  2BQQ A;  5CHW A;  2EKI A;  1UZX B;  2VH2 A;  3NOB A;  3KUC B;  4RF1 A;  1HZ6 A;  5GMV A;  5CHV C;  1WX9 A;  4LTU A;  1CJE A;  2ICI A;  1KOT A;  2KVR A;  4JIO U;  3TEX A;  1IUE A;  2M19 A;  1JQ4 A;  3UIN B;  1ZXI A;  5IP4 D;  2WP9 B;  2K8B A;  3ZDM C;  1UEL A;  3PTF C;  4KX6 B;  4G0N B;  4PS7 A;  5D6J B;  1QQR A;  2JVC A;  1SXT A;  3VTV A;  4W9C A;  3P4P B;  4XC2 A;  1V86 A;  1WXA A;  2MSE D;  2Z8L A;  3B1L X;  4ZDV A;  1E7P B;  3WAN A;  3BVM A;  1DOX A;  2O6V D;  3NRZ A;  2BBC A;  3UI3 A;  3ZLZ A;  3RCZ A;  2J53 A;  3Q8C A;  1N5X A;  2PIA A;  1YMH E;  5C23 A;  1TKE A;  3VUX A;  2KQ7 A;  3BII D;  4BBN F;  2KDB A;  2FID A;  1SGH A;  1ZGU B;  3RPF C;  1XXG A;  2FCN A;  3NG0 A;  3QAQ A;  2ZNV C;  5BMH A;  2WXM A;  3OJ3 A;  1H4R A;  3K9O B;  2PJH A;  1R7S A;  1S3S G;  2B76 B;  3CIR B;  1Q10 A;  1D4B A;  4HK2 A;  1IBX A;  3Q8B A;  3P42 A;  4NQK E;  1GG3 A;  3N1Y C;  3IG3 A;  5TR5 A;  1UGM A;  1ZDX A;  4HCN B;  5G55 A;  1FEH A;  2MBB B;  2X38 A;  4YT0 B;  4IWP A;  2QEJ C;  4DDG D;  1L0Y B;  4FXC A;  2E3T A;  3EA6 A;  3HHM A;  3IXS A;  2JF5 A;  3NJT A;  1L2N A;  2UWQ A;  2BGF A;  5E6P A;  2BW2 A;  2LGI A;  2J0K A;  2M1M A;  1L6V A;  4L1B A;  4RGM A;  3RNB C;  2RSU A;  3UIO B;  3P2B A;  3TCA A;  4CO7 A;  1XLQ A;  2DEN B;  3V61 A;  3I3T B;  4QAY A;  4W9H A;  3I63 C;  2VRR B;  4PK1 A;  3JVZ X;  1JRP A;  4EOY A;  2DBY A;  3PT2 B;  1SE2 A;  4B95 A;  2LGX A;  2WXI A;  1C76 A;  3U2S C;  4GDL B;  5CTR C;  3DBR B;  4XWT A;  3SDL C;  3NZ3 A;  2GMI C;  1YN4 A;  3RNC C;  3W2D A;  2LVP A;  2BYV E;  4W9I A;  1FMA D;  1NEN B;  3J9C A;  2BTE A;  1FM0 D;  1YN3 A;  3OLM D;  1MHX A;  4WJN A;  3A33 B;  2JT4 B;  1DGJ A;  3PHW B;  4I6P A;  4M0W A;  1L4D B;  1WGY A;  2PE6 B;  3P4S B;  5DPT A;  4PS3 A;  5LNK 1;  3TL5 A;  2KJ6 A;  3BVG A;  1GC7 A;  4M8M A;  1N61 A;  2KWU B;  1EU4 A;  3I57 A;  4LDT B;  3P4Q B;  4LJP B;  1OQY A;  1IP9 A;  1WGH A;  1DOI A;  3MJW A;  5JZE B;  1VJK A;  4AJW A;  1YNT E;  1MJD A;  1NBF C;  5DCN A;  3PV1 A;  1MVK A;  3QC8 B;  2GBJ A;  2K0P A;  3WA0 A;  4M02 A;  4YXD B;  3PGE A;  3IHP C;  4UDU C;  3BK1 A;  3GZN B;  2G4S A;  2KOX A;  1U4A A;  4M00 A;  1I4R A;  3A9J B;  4C00 A;  4IM2 A;  1AWD A;  3ZNG C;  2WGS A;  4NY0 A;  2PEA A;  3DBR I;  3N1Z C;  4URK A;  1R4N I;  2DAJ A;  2ZVN A;  4BOS C;  2WXN A;  2AWT A;  4ZOH C;  3A1Q A;  3PS6 A;  2WDV B;  4IM3 A;  3GB1 A;  5TSS A;  3BWU D;  4XDC A;  1I4P A;  1D6E C;  1GB1 A;  4K7W A;  3W1Y A;  2L32 A;  4JPS A;  2Y5B B;  1UBQ A;  3AN1 A;  4XWW A;  1IGC A;  2K3U A;  4W9L A;  1RFA A;  1S1Q B;  4TV3 A;  1WJ6 A;  2JUO A;  1V8C A;  1KM7 A;  2W3S A;  4IM0 A;  2JSV X;  1VLB A;  3DBS A;  2NTS A;  4OW0 A;  4HWI B;  2NBU A;  2O2V A;  2K9X A;  1K51 A;  2BS4 B;  1YJ1 A;  3LB8 C;  4LCD E;  4HPM B;  1HA5 A;  4XDD A;  2LJ5 A;  4FLH A;  2GBK A;  4IOI E;  3DOW A;  1RM6 C;  1FNV A;  1T5X D;  1QLB B;  1R4M B;  3PZ8 A;  4KDL B;  5FK9 C;  4IG7 B;  3T9L A;  1WRI A;  3B0A A;  3B2G A;  1TZO A;  2J0J A;  3PRZ A;  1LFD A;  2JU6 X;  2KN4 A;  1F77 A;  3UQA A;  3PRP B;  5E6N A;  2KT7 A;  4G11 A;  2KWD A;  1WXS A;  3Q8F A;  3U8Z A;  2C5L C;  2MRP A;  2V3P A;  1KJT A;  2LVQ A;  4MEM A;  3W1S C;  1GNU A;  2IY0 B;  1J19 A;  1NEK B;  2K1F A;  2IZV B;  2MLB A;  3AEB B;  3SFE B;  3JW0 X;  1TT5 B;  1WSP A;  3K9P B;  4IC7 B;  5HG2 A;  4NAW B;  2IY1 B;  3FC4 A;  1FCC C;  1EU3 A;  5HI1 A;  3HIZ A;  2QMT A;  4YTM B;  2ZEQ A;  3L10 B;  3UF8 A;  4HXD A;  1WI0 A;  3CF6 E;  3S2A A;  3QWZ B;  4YSX B;  4MEL A;  1L4Z B;  3SFD B;  2MBO A;  1WJN A;  2BT6 A;  1YQB A;  2WXG A;  4HEA 1;  4GXB A;  4IW0 A;  1I4Q A;  4JWU C;  2WXH A;  3U4E G;  1UD7 A;  3VUW A;  2DX5 B;  3NS1 A;  2LEK A;  3GE8 C;  4TQ1 A;  2INN E;  3B2F A;  2KK8 A;  2I1K A;  3R7Q A;  4KDI C;  3RNE C;  1LXD A;  1J0G A;  2LRW A;  4ASW C;  3O13 A;  3DHG C;  1V80 A;  4LNF A;  2L0F A;  3PZD A;  2IBI B;  5E6J A;  2K8H A;  3KW5 B;  3ZRF A;  2WX1 A;  1V6E A;  2LHE A;  2IGG A;  4P16 A;  1IYF A;  3PRM B;  2IO0 B;  4C7Y A;  4L2Y A;  3VFK A;  4FA6 A;  2V3S A;  1RYJ A;  3P63 A;  2KAJ A;  2XN9 C;  1UNS A;  3AU5 A;  3PO0 A;  2PVO D;  4MJS A;  1TS4 A;  1JW9 D;  1ZE3 D;  4W9G A;  2XK5 A;  2OOB B;  5EE3 A;  2RPQ A;  5D3D A;  5HHD G;  4B0E A;  1J8C A;  5D7G A;  2ZNV B;  1N62 A;  4BKG A;  1QKZ A;  1PQS A;  2RPV A;  3HRD D;  3ML9 A;  3RUI B;  3Q3O C;  4MH0 E;  2L76 A;  3V60 A;  1YX6 B;  2BB6 A;  2AL6 A;  4GIV A;  3QIJ A;  2WXK A;  2RDH A;  1NI2 A;  3UQB A;  1VR9 A;  4W9D A;  4L23 A;  2V0G A;  1PYW D;  1WR1 A;  3CMM B;  3PPA A;  3FIL A;  1DOY A;  2PTL A;  2JWZ A;  4A20 A;  2CJO A;  3W5U B;  2LFI A;  1ACC A;  1C4A A;  5L95 C;  3ZNZ B;  1FIQ A;  2KMC A;  1H8C A;  5LLI A;  2LXA A;  2DYO A;  2MQJ A;  1GPX A;  3EEC A;  3WCQ A;  3R2I A;  1N5W A;  1WR6 E;  3M63 B;  3VR8 B;  4AUQ C;  1I4X A;  4Q2J A;  3V6E B;  4P1C C;  3EHV A;  1HXY D;  2Z59 B;  2JZ3 B;  4AP4 C;  4GU2 A;  4ZRP A;  4KZ0 A;  1FXI A;  2ZZP B;  1GUA B;  5I4D A;  2RMM A;  1EWY C;  1J7B A;  4OVU A;  3SD5 A;  3T8M A;  2EMS A;  4WWM A;  1WZ3 A;  3WAO A;  2ZPN A;  4WH4 A;  2XBB C;  4I6N B;  2J42 A;  4PYU A;  1WGK A;  3ZJV A;  3NZU A;  3TIX A;  2G45 B;  2PMV A;  5H8Y E;  3I9V 1;  3ZXV A;  2INC C;  2NBW B;  5L83 A;  5IOI A;  2SAK A;  4ICV A;  4K81 A;  4XZ4 A;  2AQ3 B;  1VDV A;  1UF0 A;  2KKC A;  4W9E A;  1QOA A;  3M3J A;  4WAF A;  5IN7 A;  1IBX B;  3W1S A;  2OHF A;  3RT3 B;  1UBI A;  3KYD D;  1TBE A;  3DWG C;  5H92 C;  2LUM A;  2AQ1 B;  1ZUD 2;  1V1O A;  3DVN V;  1WX7 A;  1ZOY B;  1A70 A;  1C77 A;  3Q3J A;  4NJ7 A;  1FXT B;  2ZW0 A;  4II3 B;  3R3M A;  1JWB D;  1UGJ A;  4KKI A;  3HK0 A;  1L6U A;  2KAC A;  4FJY A;  2KC1 A;  3HUI A;  1T0Q C;  5D94 A;  2D3C A;  4DWF A;  1BT0 A;  2GBN A;  3KH0 A;  2ZCC A;  2HTM E;  1WZ0 A;  1ET6 A;  1C4P A;  4RFB A;  4C80 A;  1WGG A;  3SEB A;  4C4V B;  3HM6 X;  3H7S A;  3DCG A;  3AMZ A;  2J4X A;  3R66 C;  2C9W B;  4N59 A;  1FCL A;  2MJE A;  3ZRC A;  4YL8 A;  1KH0 A;  1TYG B;  1CK1 A;  3RMK C;  3VH4 B;  1NYR A;  2D2Q A;  2KTR B;  4JL9 A;  2G4D B;  2W54 A;  4R3D A;  3PSE B;  2GI9 A;  3RI7 C;  3M62 B;  3GOE A;  3TEY A;  2C7H A;  3DVG Y;  3MJ5 A;  1YIW A;  4AQ7 A;  2JWU A;  2JPH A;  4A3P A;  2MBH A;  5BYR A;  3PLU A;  3LXF A;  3IBE A;  2IO1 B;  3AV8 A;  1ZP0 B;  2WXJ A;  3Q3N C;  4KVG B;  4ANX A;  5DPW A;  5IA7 A;  5C1Z A;  3VAW A;  3KYC D;  1SBB B;  1XCT L;  2RGF A;  3APC A;  3RD2 A;  1WM3 A; 
#chains in the Genus database with same CATH homology
 1HZ5 A;  4OZB A;  2WXQ A;  4OHJ A;  4A9A A;  3LB8 C;  4US8 A;  2W82 A;  4DXG A;  1HA5 A;  3NUH B;  4JE3 B;  2BB5 A;  4MH8 A;  5BYS A;  5FKA C;  4XDD A;  4N58 A;  1QOF A;  4IOI E;  3ZGZ A;  1B9R A;  2E6X A;  2JXT A;  1RM6 C;  4ITK A;  3R2T A;  1FNV A;  3KQ4 A;  2IPK D;  4XE0 A;  1T5X D;  5C3J B;  2WU5 B;  4IDI A;  1QLB B;  2PVG C;  2LJI A;  3PZ8 A;  2XNA C;  4RH6 A;  5FK9 C;  1XLP A;  1D5Z C;  1K52 A;  1WRI A;  2BS3 B;  4A6Q A;  3B2G A;  1TZO A;  2ONQ A;  1GB4 A;  2JQR B;  2JU6 X;  1VZ7 A;  2KN4 A;  1F77 A;  2WXR A;  2CU3 A;  1E6E B;  1C9F A;  1SIJ A;  2KWD A;  3AEA B;  1UWX A;  3BYY B;  2WXO A;  3Q8F A;  4OZA A;  4YWG G;  3R8B A;  2K22 A;  2WXP A;  2LHD A;  1NI3 A;  2KMM A;  2V3P A;  2WDR B;  1SE4 A;  3W9C B;  2K5P A;  3PZ7 A;  2V4I B;  1NEK B;  3N9Y C;  2WDQ B;  5G5G A;  1FNU A;  1N60 A;  3BVZ A;  3NVW A;  1T6B X;  3AEB B;  3SFE B;  1CQV A;  3GS2 A;  2QJL A;  1RFK A;  4YTP B;  1EM7 A;  1WSP A;  4ZRQ A;  1XO3 A;  5HG2 A;  3MHZ A;  1XCQ L;  1OQR A;  2MJD A;  3AED B;  4NAW B;  3AB5 A;  3FC4 A;  2NMQ A;  1FCC C;  1EU3 A;  5HI1 A;  3ZQ4 A;  2QMT A;  2WNM A;  4YTM B;  4KGS A;  4P6V F;  1V1P A;  3AEF B;  5MPO A;  2AQ2 B;  4YSX B;  1L4Z B;  4RGO S;  4DQO C;  2G1E A;  2Q5W D;  3SFD B;  2BT6 A;  2WXG A;  1I7H A;  1KLU D;  2WXF A;  3Q69 A;  4HEA 1;  3Q8A A;  3AE7 B;  1I4Q A;  1FXA A;  4RGN A;  4JWU C;  2WXH A;  1FRD A;  4RGT A;  3U4E G;  1K51 A;  1SEB D;  2M0A A;  2W55 A;  1JCK B;  3AE8 B;  3IT6 B;  4C7Z A;  1OFF A;  4DXF A;  5FR3 A;  3NS1 A;  2LEK A;  4TQ1 A;  3AE3 B;  1XLO A;  2INN E;  4O1N A;  1JWS D;  2N0S B;  2N9L A;  3URY A;  1TKY A;  3B2F A;  3MFG A;  3IT4 B;  4HRS A;  1TY2 A;  3KLS X;  2QSD A;  5AUI A;  5BMI A;  3AE4 B;  1J7C A;  1ENF A;  4PT5 A;  1K50 A;  2WLB A;  1C79 A;  2N9K A;  1YJJ A;  3O13 A;  1VRA B;  2VZK B;  2BS2 B;  1L0X B;  1TS5 A;  3VR9 B;  3AM9 A;  1E0Z A;  4RF0 A;  5HFY A;  1UUP A;  2DWQ A;  5E6J A;  1PGB A;  4YTN B;  4GDK B;  1KRH A;  1V1P B;  5EE0 A;  2LHE A;  2PW9 A;  2IGG A;  4LK0 M;  4P16 A;  5G5H A;  2HDE A;  5EE9 A;  4C7Y A;  4L2Y A;  1SJH D;  1P7E A;  2I38 A;  1D5X C;  2G9H D;  1PUT A;  2KDM A;  3MC0 B;  4REZ A;  5AUK A;  1RYJ A;  3P63 A;  1B1Z A;  2KAJ A;  3AH7 A;  3SR6 A;  1JAL A;  1FFV A;  1I4G A;  4ARI A;  2SEB D;  1UNS A;  2XN9 C;  3PO0 A;  2I2Y A;  4IKG A;  1BML C;  2EEL A;  4LLG M;  4JX1 C;  4TQ0 A;  4YSZ B;  3C8Y A;  1IGD A;  1FNW A;  2FE8 A;  3VRB B;  2PVO D;  3BYT B;  1KF6 B;  1TS4 A;  1JW9 D;  2J52 A;  3VQI A;  4HKZ E;  3TEW A;  1JWU D;  3EUB 2;  3NVZ A;  1FD6 A;  1ZE3 D;  4D2K A;  2JZP A;  3RFZ B;  1QT9 A;  2TSS A;  2BYT A;  1ZPS A;  1SSN A;  1PDX A;  1AW7 A;  1YQ4 B;  5EE3 A;  2N7J A;  2EKI A;  5D3D A;  4B0E A;  5HHD G;  3AEE B;  5D7G A;  4N6E B;  1N62 A;  1VZ6 A;  1VZ8 A;  1QKZ A;  1TS3 A;  2Y3A A;  4RF1 A;  3DWM A;  1HZ6 A;  4NJC A;  3T3O A;  1BXT A;  1HEZ E;  2RPV A;  3HRD D;  4KKJ A;  1WXQ A;  4LTU A;  1CJE A;  2BB6 A;  3T3N A;  1STE A;  2ICI A;  3TEX A;  1D5M C;  4H2A A;  2WXK A;  2RDH A;  1IUE A;  1VR9 A;  4GLS C;  4L23 A;  2V0G A;  1PYW D;  2M19 A;  1JQ4 A;  1ZXI A;  2WP9 B;  2JX5 A;  1V97 A;  1SB3 C;  3FAH A;  4KX6 B;  3FIL A;  1DOY A;  1QQR A;  3CWI A;  1SXT A;  3E9S A;  2ON8 A;  2D5G A;  2PTL A;  1GOZ A;  3Q8E A;  2CJO A;  2OED A;  3P4P B;  3W5U B;  2LFI A;  2V3N A;  1ACC A;  4ZHP A;  2Z8L A;  1C4A A;  3GP7 A;  1E7P B;  2CJN A;  2JYT A;  3BVM A;  1DOX A;  1C78 A;  1FIQ A;  3NRZ A;  4NAM A;  2BBC A;  3UI3 A;  2J53 A;  1YJI A;  3Q8C A;  4AS1 A;  3NVV A;  1N5X A;  3ABV B;  1DYQ A;  2DYO A;  2PIA A;  1QOG A;  2L52 A;  1GPX A;  1YMH E;  3WCQ A;  1TKE A;  2QIL A;  1ZXH A;  2H88 B;  3L4P A;  2Y5P A;  3R2I A;  1C4C A;  1N5W A;  3BII D;  4US9 A;  5BYQ A;  2DYM A;  3U7Z A;  4RNA A;  3RPF C;  1XXG A;  3VR8 B;  4B0M A;  5BMH A;  1I4X A;  2WXM A;  2PLP A;  4Q2J A;  1L5P A;  3TSS A;  1L0V B;  3MP9 A;  1R7S A;  2PKO A;  1PFD A;  2B76 B;  3CIR B;  2L1A A;  1Q10 A;  2IGH A;  1HXY D;  3KWL A;  1D4B A;  1IBX A;  3Q8B A;  2L83 A;  1QOB A;  5T8I A;  2DLB A;  3FIL B;  3P42 A;  4WQM A;  4OVZ A;  4RCO A;  1PGA A;  2JYE A;  4ZYS A;  2WXL A;  4ZRP A;  2YEP F;  5GXG B;  1FXI A;  1ZDX A;  1WWT A;  1BUI C;  2Y5C A;  5I4D A;  3ZJT A;  2RMM A;  4EE2 A;  1EWY C;  1J7B A;  1FEH A;  5BMG A;  3AEG B;  2X38 A;  3U52 E;  4YT0 B;  3ZJU A;  2QEJ C;  1ROE A;  1L0Y B;  4WWM A;  3AE5 B;  4FXC A;  2E3T A;  4HRO A;  4NZL B;  3EA6 A;  3IXS A;  1F2R C;  2VZK D;  4WH4 A;  3V05 A;  2J42 A;  2BW2 A;  2LGI A;  1KFY B;  1L6V A;  1HQR D;  1WGK A;  4L1B A;  1TJE A;  2AX5 A;  1ZDV A;  4RGM A;  3ZJV A;  3AE1 B;  1XLQ A;  2PMV A;  1MHH E;  5H8Y E;  3I9V 1;  4ARC A;  2SAK A;  2AQ3 B;  1JRP A;  1VDV A;  3W5V B;  3BZD B;  2NTT A;  1QOA A;  2DBY A;  1SE2 A;  4WAF A;  1ESF A;  1IBX B;  1CZP A;  3W1S A;  1N63 A;  1Y56 A;  2WXI A;  2OHF A;  4MT5 A;  1JRO A;  1C76 A;  3U2S C;  4GDL B;  3TUO A;  4A55 A;  1QIL A;  4XWT A;  3NZ3 A;  3DWG C;  3HVZ A;  1FRR A;  5H92 C;  1YN4 A;  4HJG E;  1K53 A;  3W2D A;  1UWM A;  3LYY A;  4J3O D;  1M4V A;  2LUM A;  2LMC A;  1F2R I;  2FBW B;  2AQ1 B;  3TEZ A;  1SF0 A;  1RWS A;  1ZUD 2;  4MM3 B;  1V1O A;  1XLN A;  1FMA D;  3ETR A;  2MJ3 A;  2H89 B;  1NEN B;  3J9C A;  4WIP A;  2BTE A;  4A90 A;  1YN5 A;  1FM0 D;  1YN3 A;  1ZOY B;  1EWC A;  1FFU A;  2IGD A;  3P4R B;  4TSS A;  2ACZ B;  1T3Q A;  3NVY A;  2R61 A;  4JWS C;  1A70 A;  1C77 A;  1MHX A;  2ZW1 A;  2ZW0 A;  3AE9 B;  1TKG A;  1I4H A;  1JWB D;  1AN8 A;  1UGJ A;  3EGR A;  1XEE A;  4KKI A;  1DGJ A;  1L6U A;  2KAC A;  4OZC A;  3ZYY X;  4C56 C;  3HUI A;  4M0W A;  2WS3 B;  3P1M A;  1ET9 A;  1L4D B;  3P4S B;  3V3X A;  5LNK 1;  2IJ0 A;  3BVG A;  3AE2 B;  2HTM E;  1N61 A;  1ET6 A;  1F0Z A;  5EE1 A;  1C4P A;  1EU4 A;  2RDG A;  3I57 A;  4MAC A;  3P4Q B;  4RFB A;  1YQ3 B;  4C80 A;  1NYQ A;  1KTK A;  1MI0 A;  1DOI A;  1VJK A;  3SEB A;  1JWM D;  2MEK A;  1YNT E;  5JXV A;  3HVD A;  3E56 A;  2INP E;  4USA A;  3AMZ A;  2J4X A;  3IAM 1;  1KLG D;  1E9M A;  4N59 A;  1FCL A;  2MJE A;  1MVK A;  2K0P A;  4KGT A;  4YXD B;  2GB1 A;  1GAQ B;  4KGR A;  4UDU C;  3BK1 A;  3VRA B;  1KH0 A;  1SJE D;  1XF5 L;  1TY0 A;  1TYG B;  2MH7 A;  1CK1 A;  2YEP B;  3OWE B;  1WYG A;  1JWA D;  1I4R A;  1NYR A;  4A8X C;  3B9J A;  1AWD A;  1MPE A;  1E10 A;  1P7F A;  2KQ4 X;  1QF6 A;  2W54 A;  1LO5 D;  1NVI D;  2WXN A;  4R3D A;  4ZOH C;  2GI9 A;  3H8H A;  2WDV B;  1FO4 A;  2WQY B;  3IAS 1;  3MJ5 A;  4YSY B;  3GB1 A;  3TEY A;  5TSS A;  3BWU D;  2JWU A;  4WUR A;  4XDC A;  4AQ7 A;  1I4P A;  1D6E C;  1GB1 A;  2L32 A;  2WU2 B;  1AYF A;  1J7A A;  1SE3 A;  2FUG 1;  5BYR A;  4ZHO A;  1OQQ A;  3LXF A;  3AN1 A;  4JPS A;  4XWW A;  1IGC A;  2K3U A;  3AV8 A;  3KWV A;  1ZP0 B;  1TS2 A;  1V8C A;  2QIE B;  2WXJ A;  2W3S A;  3BK2 A;  4CQN A;  5C2T B;  2JSV X;  1VLB A;  3AE6 B;  5D3I B;  2NTS A;  4OW0 A;  1PGX A;  1SBB B;  1XCT L;  2GRI A;  2W3R A;  3AEC B;  2M56 B;  2K9X A;  2IDY A;  2BS4 B;  4TMA B;  1JML A;  4HKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...