2M1KA

Interaction of human s100a6 (c3s) with v domain of receptor for advanced glycation end products (rage)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
101
structure length
101
Chain Sequence
b'AMAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein S100-A6
publication title Interaction of the S100A6 mutant (C3S) with the V domain of the receptor for advanced glycation end products (RAGE).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 101
sequence length 101
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2m1kA00
4GOSA 1RZ8B 1NSNL 3OAYK 4KHXH 3TBYA 4JM4H 3MOAH 2J8UB 4LLDB 1NAML 4DVBA 1Q9WB 3IETA 3WHXB 3QDMD 1M6OB 2PYED 5C1MB 3QDJB 4E9LA 3GKWH 2H8PA 1N0XL 3U36A 3HR6A 1E4WL 3F5WA 4U1NA 4BSJA 5HYJA 4AIXA 5EUOF 4RFNB 5DJ6A 4MXWL 3RY6C 2W60B 1T0PB 1JF1A 2V9TA 1SY6H 5DJAA 1U91B 2R29L 4M5YH 4E5XB 1FFQA 1KNOA 3AU1B 4FZEH 2JJSC 3B9KB 2X4TB 3QUYC 1DQTA 2HTKD 4PD4J 4L9LC 3IDMA 1JGLL 3GRWA 1H8NA 1MCOL 2O5XL 5B39G 2JB6B 3CPLA 3NABL 2RCSL 2C1OB 1BQSA 4E41B 5DJXB 1CICB 4LRNL 3HS0A 3ZDYE 4DKFH 3QFJE 3VRLF 1W8NA 1MJ8H 3MLXH 3I50L 1BFVH 4BQ6A 3V79C 5F3HA 1K4CB 1TXKA 2H2SC 1Q1JL 2P4AB 2E9WA 5I9QC 3MUGA 4FG6D 4ZFFA 5HDBE 2X05A 3VD5A 4XPTH 5CUSL 1EBPA 3G5YA 3C60A 1P4BL 1MI5A 2VXSH 3MA9L 3LHPL 3W0WE 1JWSA 4LSUL 2KQNA 5FO9A 1FYTD 1QFWI 3UBXG 4LRIA 4DN4L 1TQBB 2WM0A 4LP5A 3HI6H 1QRNE 3N0PB 1FORH 4PV8A 3C08H 2CLZA 4JM2F 3P77A 1IGYA 4PJHB 1UENA 1ETZA 4ZPTA 2RBLA 2NNAA 5FA4A 5C0BA 2P45B 4QRUA 3OF6A 5FO7A 3V4PL 3WDHA 4XP4L 3RTQD 1OWWA 4NC1C 4XPGL 4CL7A 4H8WH 4OCXL 5HDQL 5TDPB 3U83A 1T7ZA 1MIEH 4JDZA 1MFCH 1NGXA 3HAEA 1DBKH 3PQYE 3H7BA 1OSZA 1GGCL 1EJ6A 3I3BA 3CU1A 1MQ8A 3K3QA 1S9VA 1FZMB 4WNQA 4RCAA 1A7QH 5LQBL 1EHXA 1G0XA 4LKCA 2PYEA 2R2CA 4HIJB 4PJAA 3AY4C 2NYYD 3QUML 4P5KA 1KJ2H 4X5LA 1OAXH 4KPHL 1K2DB 2BSTA 3F7YA 4QRRB 4HH9B 3LV3B 4X0KA 2W9EH 4GMTH 1OY3B 1W0VB 1J86A 3S36H 1N6VA 3FFDA 4IJ3B 4U1MB 5KN5A 1CVRA 1IGTB 1DANT 1HDMB 4WWKC 5C70A 1MFAL 2KZWA 4YR6B 4PJXE 2VQ1A 3VA6A 2OJEB 3KYKH 1AY1L 2CDEA 4PJIA 1E4KC 3L3JB 1WZKA 4YHLL 5EWIH 2EDYA 2J88L 2CLVA 5EU5B 4OLVL 2P8MB 4LCWD 3TA3C 2H2PC 5EN2B 2BHZA 1KLGA 4FABL 3T65B 4R6UA 2HVKA 3RDTC 4G8EA 4MJ6B 4XP9H 5F7EL 4MQ7B 3PP4L 1MRDL 5DJ0B 3VFWB 3MGTA 2CIKB 4Z78A 4LMQI 3NFSL 4HAFA 3ULSA 4GRLD 1QR1B 1FYTA 3X14A 2NZIA 3IKKA 1MHPH 4X8JA 4HKXB 2GFBB 3OXSB 1H15A 3O3BB 5CHNB 3VXRE 2ADJB 2EXYD 5EZIL 4MQSB 1Z5LB 1LGVA 2GUOB 1WZ1L 3EYFB 4Y4FA 1UB5A 3OBAA 1RJLB 4K7PH 3JTSA 1RUKL 4G80B 1IAIH 4HWZA 1ORQB 4YQXL 5CJBA 3RWIB 3KPPA 5IFAL 3RTQA 4D0BA 5DMIH 4NHUB 4U0QB 2DI8A 3SPVB 5AWNH 5C0JA 1A7RH 1SVCP 4XGZA 1A7NL 1FL5B 1FFOB 1T83C 4G6AD 2BRQA 4ZOCA 2XWBB 5FCUH 1R3JB 2ZKHH 5DLMH 2LVCA 3UPCA 1LO3H 3RVWD 5AAWA 1J12A 3QXTA 5IEKA 5LGJA 2AJVL 4OCYH 3F6LA 5IWLA 1Y18B 4RZCB 1T0MA 1A47A 2RB8A 1QPPA 5T3ZD 4BZ2H 3S37X 4KMQA 3WEXB 4OF3A 4LP4A 5I2IB 3MBXH 1HYSD 4JFEA 5MHSE 5L9DH 1A2YB 1EVTC 2A83B 5DK0A 4TRPL 5CZXD 1FLRH 1C1EL 5JMRA 3DVGB 5C0FA 4LSSH 4EUPH 1CT8B 1TTFA 2D7OA 1BECA 3KJ4C 2FJGA 5KAQF 4UNTA 1E27B 4YBQD 1V3LA 1U8NB 1YN6A 5HI4C 1FVDA 2WNGA 3LN5A 5CCKL 5IB1A 4MQTB 4YE4L 1GGBH 3PL6B 3LS5H 2OL3H 2X9WA 3QDGB 5C0CE 5IR1B 5GJSH 4YHZL 3RAJH 4LCWA 4N0UA 2ARJQ 1KJ2L 4MDJB 2X42A 1UVQA 3B6SB 1AGFA 4Q74A 1INQB 1MLCA 3KPQB 4OCSH 4PJBE 4PRAA 1RQ5A 5E2WH 4HUWA 1C12B 1CDHA 1KCRL 3C6SB 1GH7A 4GRLA 1XGTA 1I85C 3U79A 1BF2A 3OKKB 1B2WH 3EOTH 5HHVH 2ZUQC 2WIMA 5J57B 1VCAA 3TYGL 3GGWA 3QPQC 2PUQT 3FQNB 4L3CB 1S7VB 2HJKB 3SDXB 3QWRA 2D9QB 3T3MF 5IV2A 2DQIL 3T3PF 5ICZA 2EDHA 3HNTH 1DUYA 3BKCH 5DRZB 3IFLH 2XRAL 1RU9L 4G6KH 5B21A 1NANH 1RZKH 2ZJSH 5E8NB 1LO4H 3M17A 1AXIB 1ONQA 1CFQA 1WISA 2KDGA 4JY6A 1I9JL 3BKML 2HMIC 3ZE1E 3PIQB 4Y5XC 5CJXC 1FSKC 4OCLC 3STBA 1YEDA 1J0ZA 3FONA 4Z7UA 2GJJA 2R0KL 4YBLC 5DD3H 1X5GA 4D9QE 3MPCA 3L3GB 4QNPF 4P5TB 4WRLA 4YUEH 4P9ML 5INCB 4PGEA 4GG6E 1G7IA 1AQDA 3GFUA 2XPGB 1U9KA 4JZNB 5DD1L 4NNPH 5EOTA 2IEPA 4O2EB 1PZ5B 1OAUH 4KVNH 3GIZH 1DE4B 3DMMB 1MHCA 1FFNB 3GSUB 4UOW0 4QOKB 3FFCD 4ZODA 5IQ9A 4JM2D 4LQFH 3GEWB 1HH6B 5BV7B 4M00A 4LAQH 4PJGF 1F13A 2FHFA 5CIPB 3V5DA 3MROA 4ZNEE 2VLME 2Q6WB 3EYSH 2OS7A 2V2TB 1INEH 1YY8B 2E7BA 4M6NL 4CKVX 5H94B 2CD0A 1BAFL 2HT4C 2Y9RT 4PJ5A 1CF8L 2GY7B 3ULVC 4XVSH 4OGAD 4U6YB 3RGHA 2DWEB 3HAEG 4HIHA 4JQXA 3S5LA 4L29B 1VACA 2VLKE 1BBJA 4NM8L 1UH4A 4GW4A 4Z7VE 4MA7L 1IGCL 1XFPA 3BWUC 3L5HA 3T4YA 4ZO6A 5BVJA 4ZSOA 1MEXH 5ACZA 3TZVB 4H88H 4NO2A 3QEQB 1HK6A 2YOCA 5F1IA 4EJ1C 2DQDL 4L4JA 5CSGA 5IB2B 1B4JH 1CD1A 1Y6NR 1BOGA 1XZ0A 3B9KC 1BQHB 2WUBH 4LCIH 3EFDH 1ZGLP 3ARGA 5FIEA 4YDLB 4XNZB 2PN5A 1QR4A 4Z7WE 3IJYA 4H0IA 1BZ9B 3LRGA 3MRDA 4G7VL 1CICC 3OB0K 3KPRA 3RJQB 3VFOB 4I3SL 4E42A 4JO1L 1JFQH 1FC1A 1MIMH 3ULVF 1NQBA 3RVXD 4G9FE 4PJDF 3UYPA 3MRHA 1I3RB 5DGRA 4XNQA 3CFBA 4OF0A 3LRSA 3L7FB 2FIKA 4XBEL 2AJXH 4OIAA 5HHMB 1VENA 4EDWH 5DC9B 5K9JH 1MVUA 1KF9B 1FNGB 3FJTA 3T8XA 2H9GA 4ZFZB 3FFCA 2JJSA 5J3HC 4U31A 5IM7A 3QUYA 1BM3L 1VPOL 4HKJA 8FABB 2YC1A 2R23A 4PBVC 1PYWA 4PJFF 3SDYH 4HMCA 4ZD3H 4U1JA 3REWA 4PGZA 3BW9A 5CP7A 3QSKB 4IMKC 2XZQH 2Z35A 3HMXL 4HLJA 5LJYH 4M6MH 2P5WD 3VJ6B 2VC2L 5CEXB 1IQWH 2FGZA 3FN0H 5HHOB 3ARDB 4WDIB 1QD0A 2MPAL 5IESH 1V3MA 4DZ8B 5FUOL 4ZUWB 3GMOB 1ZVSA 1J11A 4GO6B 1S7RB 4F3FA 2L7UA 4OZIF 3MRJA 3QEUB 3QJFA 4LKXB 2VB5A 4MAUL 3ZL4H 3GIVA 5DYOA 4ZDHB 5ICYA 1FDLL 3FQXA 1NL0H 4KRNA 1IQDA 1LO0L 1NBZA 1NMAH 2YR3A 3MLWH 5CZKA 1MH5B 2FBJH 4WTZA 5CBEB 3KYNA 3CCHA 1R3KB 4DJMA 3FTGA 3SEPA 4U4BA 4GT7A 5A2FA 5EFIB 3QRGL 1MCBA 1S9YA 1HHHB 4ELKA 3G04B 5JOFA 3EJYC 3GMNA 4NIKB 3HZVA 3G6JE 4UNVA 5J89A 1GGIL 4H1LH 3R0MA 2E7MA 1UACL 3SE3C 4TNWF 2DICA 4S2SA 1EV2E 2AXGB 4K94C 5DK2A 1J0KA 5J13B 3O4OB 3NCJL 2ICWJ 5IT2L 1P2CB 5IF0B 3WXWH 1NGQH 3G5XB 1FZKB 2EEDA 2Z8VC 3EJZC 1IT9H 5SWZE 4H88L 5IK3A 1FO0H 3A6OA 4PRNB 1CS6A 2X4UB 3JBG7 1LEGA 1WITA 1F3DJ 4ODWB 5CGMA 5D1QD 3LB6D 4U1KA 2E9IA 2YKLL 4XXDA 3U0WL 4NSKA 4G8FB 2F74B 5E8EB 2NTFA 4QXTA 2UZXB 3LQZA 4M61A 4TNWK 4A6YL 2LAAA 3GMRA 4UZGA 5C6WH 3MV9A 3B4NA 4YWGH 1NPUA 5HY9A 4YXHL 5IQ7H 1JHKH 4MX7A 2R1WB 4KRMB 4NKOA 4BFIB 5F1NB 2GAZB 5KS9F 5C0AE 4OIBA 5IUSA 4GS7B 2G75A 3DXAB 1P69B 4FQJL 2GTWB 4EIZC 4WWKA 5GS0D 2GJ6E 3QWOA 4QXGL 2DQCH 1DUZB 5EORH 4U1IA 3MCKA 3P30L 1MRFH 1AGEA 1U42A 2I9TA 3OXRA 2Q8BL 4HK0B 3ES6A 3FOMA 1NC4B 1E4KA 3QHFH 3SDAD 1EERB 2O5ZL 3HNVH 3N9GH 1RURL 4O58H 3D25A 4XPHH 3VXTB 5K9QG 1YUHB 1N26A 2HRPH 4YHML 1YNTB 2VAAA 3TA3A 1X5ZA 1UEMA 2VR5A 1C7SA 1B0WA 2IBZX 1FFPA 1EJOH 1JZ2A 4DAGH 4GW1A 4NGHL 3RDTA 1MELA 4JO2L 1TMCB 3OR7A 3VDBA 1U8PA 3MRMB 5KW9H 2XT1B 1HINH 3SGKC 3FAXA 3GMPB 3OGCA 4X6BB 1TZHB 2AV1B 1QA9B 5D9SA 2QSCL 2A73B 3IFOB 4LVNC 1VFMA 1ZXQA 1LE5A 1JNHA 4K23L 2CJUH 3LMJH 2W07A 4I0CC 3BT2H 3QXAB 5EOQH 4JM2B 2VDNL 1YPZF 5A2JH 5D4QA 4PREB 3CFJB 1DN0A 4Z7QE 2J3SA 4MVBD 3VXSD 2KQMA 4LEOA 5E8PA 4LARL 1WFOA 4B5EA 1K8DA 1SYVA 2O61A 3FB8A 3L3OA 4UDUA 3PL6C 1P4LB 1JIBA 3GMQA 1XGRB 4LIQL 2P5EB 2FD6L 4KY1L 4QTHB 3EZJB 3BDBA 2DQFB 5FA3B 4IIQB 2N4IA 4NZRH 4JZOB 4K55A 2YUZA 1QSFE 4OM1L 5IEHA 2Y07L 4N90E 2HMID 5CSBA 2A74A 2DJ4A 1J1OH 1U8OB 5EBLB 3EJJX 5KSAB 5D1QA 1QNZH 1ZA6B 2BHUA 1FL3B 4GAFB 1F4WH 2UYLA 4M7JH 4YDVA 1INDH 3LKOB 1WWCA 1CYGA 2IGFH 4DQOL 5KSUA 1XCQA 3CIQA 2J8OA 1WEJH 3B2UC 4H25A 2AERT 2J6EH 1DVFB 4RISL 1HHIA 3UEZA 3UO1H 5DUBA 1QLEL 3N85L 1QRNB 1UM4H 1XGYH 4NUJB 4ONFH 5D6DC 4AH2B 4K3DH 1BD2B 2XZAH 3HRZA 1VFBA 1YEKL 4I4WA 3AAZB 2XTJB 4TULH 1OCWH 4DEPB 4FTVD 1F4XH 4XMLH 2BSSB 1FG2B 3CC5A 3UTZB 2CKNA 1LNUA 3C5ZD 4R7NB 4MJ2A 1BIIB 1TLKA 5FOJA 2X5PA 2Y5EA 1LK3H 2RIKA 3SDAA 3DVFA 4P4KB 3HC4H 4LHQB 4FQ1L 2W65A 3LQAH 3VRJA 4D3CH 4YFEA 4PB9H 1K3ZA 2NX5E 4XHJC 5DJYB 4P23B 5JORA 3KPLB 4HUXA 4RMTA 1QBAA 3MBED 2WINB 4R7DA 1MCKA 3S4SA 3ULVD 4MYWB 3ROOA 3TPUA 4L4TA 4N9OB 4DGIL 5I19L 3JVGA 4WTXA 4P5TC 4HPYL 5FGBC 3PV6B 2GY5A 1H3PH 3DETD 4EOWL 3MRCA 5EO0A 2ADFH 2IQAA 3P4MA 1OL0A 2YEZB 4P5MA 5AZ2L 4NQDE 3G6AB 1CE6B 1XR9B 1CU4L 1JZ8A 3JUYA 3G9AB 2J4WL 3DMMC 2UWEF 5IP4A 1ADQH 1A7BA 4ZO8A 4HT1L 1F6FB 3AFLA 4WEBH 2Q3AA 2BOBA 1NFIB 1R3LB 5FK9A 4KRPB 1KB5L 5J06A 5F7YC 1ZS8A 5BV7C 2AXFA 3NIGE 1N3NA 2P5WB 4DVRH 3EYQC 1NFKA 1I7RA 1YZZA 4PJGA 2KL6A 4NO3B 2EH8H 3VI4F 3L3HA 1JF6A 1VB9A 3T2NL 4YIQB 3GSNL 3U2SA 9CGTA 4RA0C 5MEND 5BRZE 4AL8L 5DJ8A 4PGBA 4OSUH 2GHWB 1LDPL 4Y5XA 1J05B 1QKZH 3MREB 5IMMA 5F9JB 1IEAA 2NCMA 1T22A 3B9EA 4AM0B 5BXFA 4WHTA 3BT2L 5EOQL 3WUZA 5HHPA 2ICEA 4KK8D 1MCHA 4Z95H 4Z77B 3WFBL 2Z0BA 2ZUYA 1I3GH 4TUKH 4XB8A 5D2LA 3QQ4B 4OM0H 2YD1A 5KSVA 1J88A 4HWBH 2X1OA 1FAIH 4P2QE 1MJUL 4OQ1A 2YHGA 4WCYL 1X4ZA 3BZEB 4JHAH 3QFDB 4TVPD 3TZVC 4FQHA 4N8CL 4RBPH 1L0XA 4WTZG 5T5NG 4TSCH 2R2EB 4DFHA 4Z6AT 5DVMA 2APWA 3SCMD 4JDVB 4U6VL 2AK4D 3L1OL 3ZO0A 2IH3A 1RJYA 4ZFOA 5JLZA 2PXYC 3OKOB 3ZT5A 2HH0L 4U7KA 4YDLC 1MNUH 4XNZC 3ROLA 1VSCA 2HFGL 4ODUA 1DEEA 4YNYA 1AQKH 5TF1H 2QQLL 3K4DA 4WW2F 2BVPB 1SBSH 5C6TL 3KPNA 4N0YH 2DWDB 3MBEA 5IMOA 4U3XA 1ZT1B 2IANA 1AI1H 2NW2A 4GXUN 5FKPB 1U95A 3MRQA 1QFWM 3FHQA 1BFOB 1F4XL 2DAVA 1T04B 4PJDA 2JJWA 5DJZA 1NEZA 3FQWA 4LLDA 1DBAL 5IB5B 3W11C 2UVFA 4I9WE 1EMTL 4JGJA 4PRPE 5CEZL 1GSMA 3MV7E 4ENED 4G6JL 1T7XA 3QNXA 4QT5B 3JWDC 4OZ4A 4RWYL 3MNWA 4OD1L 5I1KL 1O0VA 2A38A 4JVUA 2JIXB 4AMKL 4H20H 2EH7L 1MFEH 2X4RA 1FGVH 4OJFL 4E5XA 1KN2H 1J0IA 5JW3L 2XG4A 4YXLH 4CVZA 1MWAH 3R0NA 4K8RC 3O11A 2GT9A 4OZGB 5DWUH 1CL7H 1FZJB 4OFVA 4GRWH 2XXCB 5L2KA 2XZCH 4DOHB 3MLUH 1GL4B 4QGYA 1B6UA 1AXTH 1KCSH 2CQVA 3X3GL 2CIIB 5MENA 1PKOA 2C1OA 1UCBH 1YEEH 1CICA 5SWQB 3EIFA 4KJYA 4NYLB 5GRVK 1HWHB 5FM4A 3ARDC 1CLYH 1RJCA 2VLRE 3MCLL 4AEIL 4XBGA 1QFOA 3T0BA 1ZANH 1PX4A 2XQYG 2VLJE 2K7QA 5DJDB 5JHLH 3HZKA 1QYGL 2PCPB 4ODTL 1DQJB 1JRHH 4EI6A 4RGND 1OQOA 3WIHH 3OAUL 2PYFB 3E8UH 4JFXB 2Y36L 1JP5A 2OYPA 1U8IB 4JANA 4UIKH 3VXOB 3TBSB 3DI2B 3QJHB 3VXSB 1KJ3L 2Q86B 3HRPA 4PJ9C 3BZFB 1FBIL 1HHKA 4D9RE 1EHLL 5C3TA 4I3GA 4J6RH 4RRPA 3OKLB 5D6CA 1G9NL 3I6LE 5GZOD 2WLYA 5TE7L 3WFDH 4HFWB 1QQDA 4LPVA 1T6WA 4HF5L 2CK0L 4CAGA 1G6RA 3P40A 2X09A 4YHNA 5J13C 3O4OC 4I1NB 2IPUG 3C5SB 4R90L 1MJJB 2R8SH 1FAIL 4WV1B 1WWAX 1HZHH 2XKUA 5EZJB 2F58L 3L7EB 3RX5A 2ZPKL 4DWHA 4MCYA 4OTXL 3F8UB 2XACC 1NC2D 1V3JA 4JFHE 1KV3A 3S88L 1XGPB 1FIGH 4HIJA 4WO4B 3MZGB 4Y1AB 5TH2B 2CKBH 2ZOKA 5CD3B 4HC1A 1JGDB 2X10A 5CINL 1OQXA 5E9DD 1X5IA 1MNUL 3F62A 4V1DB 1V3KA 4FTVB 4GH7B 3Q48A 1EGJH 1A7PH 5KANI 3EFFA 2DM7A 3FMGL 4GS7C 3H42H 2EYRA 4LLMB 2PTUA 4JFPA 2IAMB 4X4ME 4FFZL 3IDUA 1UJ3B 3ARBD 3VW3L 2A6DA 4PJCF 1IBGH 3SE3A 3FOLA 5L6YL 5ISZE 1N64L 1U0QA 4MA8H 1EO8H 4FZ8L 4FQCL 3BGFC 1S7WB 2BNUA 5C0ND 1LK2A 4OLUH 5EU5A 1IZKA 32C2B 3KDMA 1S7XB 5E2UL 3MACH 1U2HA 3FKUS 4HKZB 4R4NC 5DZNA 5KVFH 4L8SB 2VAJA 3TN0B 2YPLD 3CFDB 3O3AB 1IC4L 2APVA 1XR8B 4FP8L 1TZGL 5FDWA 4OF8A 4UT7H 4ETQB 1M7DA 5I75B 1RFDH 3GSWB 1R0AH 3P9WB 1JMXA 2AK1L 4AIOA 2YPKA 1NCCH 3CX2A 4NNYB 5DJ0A 4G8GD 4ODXB 4DK3A 3K1DA 3MRBB 3D0VB 5I1EL 5JO5A 3FB7B 4LPTA 5EZOL 5FUZL 5I16B 5DD0H 2GFBA 1TETL 3MYJB 3VI3E 2SEBB 1WFNA 4GQPH 4JB9L 1Z5LA 4LCCC 3EYFA 3KPSA 2YD9A 3ARZA 4I48A 1JTPA 1YPZA 1YEGH 1JPFB 3CMOL 4G80A 1CLYL 1Q94A 3P73A 5GQBA 2DDQH 4GQ9L 3RWIA 2FX8H 4I13B 1IJ9A 4N5EC 4JVWA 4DGYL 1TVBB 1YYLL 2GKIA 3LSOA 4JG1H 2FJFB 4W81A 4O2FB 1CGSL 1T5WB 2ENSA 1I8MA 5BOPA 3A67L 4QHNB 5T3XH 4IIQC 3RA7H 3GO1L 2H32A 5CGTA 4FQPA 4NZUH 2N56A 1T1WA 2OMNA 4V2CB 4OFPA 4HCRA 1V8HA 1OM3H 5MP6L 4UV7L 4S1RL 5IFHH 3MJ6A 5L2JB 1Y18A 1YEIL 4XCYB 3DSNA 5KSAC 3TH4T 3KLHD 4KTEH 1TCRA 3BO8B 1WTLA 1VFAA 4WHDA 3O81A 3GRWH 3ZHDA 4U3HA 3HG1B 5JW5A 5IBTH 2VTFA 3FN3A 5C08B 4UT6L 1OP3K 1DVFC 1A6PA 3DVGA 4D8PB 5M95B 5JR1L 1QVOB 2EYTB 3UTTD 1F3JB 3L5XL 5IBUB 1WTGT 3BSZH 3SCMB 4MZ2A 2AK4B 2MMXA 2XTJC 2NXYD 3HI1A 1L7TH 1NLDH 3FO1B 5I1CH 3DX8B 3HE7D 1E0OB 3LIZH 2COQA 3U0TB 2D0HA 4JFFB 4P4KC 2IALB 2R9HC 1OD9A 5C0RH 1T5XB 5C0DB 1SJHB 1W72A 4Y19D 3QUKB 1NMCB 3ZDYF 4G3YH 4KUZH 4NQTA 4XCCH 4Y4HC 4JKLA 1UCTA 3SE8L 1CK0H 4P23C 2OXHA 4F57L 3P0VL 1OW0A 3BP7B 4NN5B 4LPXA 1JE6A 5BOZG 4Z5RA 1S9WA 5B38B 2ICWA 1BMGA 4LQ1A 1INQA 4EEEA 1T6VN 5EZLA 2FWOA 4G8GA 5FYLL 5HDBF 4XNMB 4ORZC 4L9DA 1LP9B 5TQ2L 3ME0A 5GGVY 5JDSA 4BZ1L 5B3JF 5L0QB 2OBGA 2X4QA 4RSVA 4X7FC 1NAKH 4P46B 3OPZH 4PRHA 3U9UB 3ZHLA 5KS9B 2X1XR 5D6DA 2EE3A 3HAEH 3RHWF 4CU8A 3FQNA 2R0ZL 1YQVH 4NNXB 4LSRH 4RAVA 4X6DE 3VFGL 2CRIA 1QG3A 2PO6D 2VXVL 5I66B 3L6FB 4LSVH 4HK3J 4M1CD 3CFCH 4P57B 2UWEA 2DOCA 3F6IA 1SYSB 4ODSH 4PGJA 2DQTH 3FCTB 4OT1L 4GKSB 5HGBA 1WV7T 3GSRB 1RMFL 2OTPA 1KELL 3RU8L 3WNPA 3MNVA 3ZHKA 2DM4A 3QI9D 4NPYA 4PV9A 3VXUB 3S36X 4HAGA 3KYOB 5DI8A 4JQIH 2H1PH 1F8TL 4OLZH 4BFEA 1F3RB 3F7RA 5FV1L 4QCIA 1I1FB 1RK1B 3ARFB 2UY6A 5L8LB 4RGNB 4UU9B 1YEGL 4O51B 5D1XB 3HZYB 5FGBA 1MY5A 2X1QA 5E0QA 1HILA 4FMFA 4HS6B 3S96B 1T80A 2FYYB 3BIKA 2XPGA 3TCLB 5CJQH 2H6PB 4JZNA 4AEHL 5F6HJ 4MSWB 5JHDE 5GRJH 3UTTA 4PRID 3GB7A 4EKXA 1PZ5A 3RA7L 1P4IH 4MNGB 1YJDC 1FE8H 1UM6L 4NKMA 3DMMA 3IFPA 2CDGA 1GPOH 3HE7A 1TJHH 1MQKL 4WY7H 1HH6A 4KJQC 4HS8H 4HUVA 1TCMA 1JCKA 3D18A 4QRPD 2VKWA 5BO1L 1KFAH 3P2TA 4Y19A 1HKFA 1HNGA 3KAAA 3TGXA 3TWCL 4KZEL 4RRPG 3AROA 4RMQA 1I8IB 5SWSE 4K7PX 1T03L 3AXLA 4JO4H 2VSCA 4M7KH 1GAFH 2VXQL 4WW2A 1NC2B 5T1DH 3VMOA 5I8KL 4PR5A 3BRDA 2P8LA 1MFDL 1NCNA 4YHKL 5F7UA 1EVUA 5BS0D 1AR1C 2NW3A 2DQJH 4PP1C 1FGNH 5DK3A 1V7ML 4WU5A 5E9DB 3GHBH 4TOYH 2I5YH 4OIIH 3D3VD 1TNMA 5F7LB 5C0RL 1HXYA 4Z76B 2DQGL 2OQJB 4KDTA 5FHAL 4LSTL 2WV3A 2PO6A 4HPOL 3S3SA 3TVMD 3EYVA 3T1FB 5FF6B 4M1DL 2OR9H 2IPTL 4KVCH 1DDHA 3QEHA 2C7UB 4Y5VA 3KPOA 5JZ7D 1P7HL 3REVA 2QTEA 3MLTB 4R0LB 4U2ZA 2PXYA 1GZQA 3MO1B 1RHHB 3F7PC 2AABL 1N4XL 1AKJB 3WFCL 1A9EB 2C3WA 3HLAB 2YPLB 4KK5D 5GGTH 3MODH 2D7NA 4Z7NE 1L7IL 3TESA 1QSFB 4K3EH 3UX9B 2BNQE 2F5BL 1K5NB 1RIVL 4XPAH 3VFOA 3BPNB 5HHQA 3RWEB 1BQUA 1DQDL 5T1MB 2GITA 3BDYH 5JIKA 1JGUL 3V52H 2F5AL 1YMHA 2A9MH 2AQ3A 4LBEB 3QCUL 3BP5B 5K59F 3P9MB 1I3RA 1QSEE 4JEGB 4ZAKD 1JMZA 3RWFB 2IG2L 3MGOB 1RJZA 1OGAB 1EH9A 3HKFA 4PYGA 4LDOB 3ZT7A 1FNGA 1DANU 4JRYA 3F7VA 3I3EA 4DUWA 4O00A 5CSZB 2X1WL 1A3RH 1X4YA 3S98A 1N59A 4LNVA 3WIIH 5IIEA 3W39A 3ZYIA 1NCWH 3D87B 4XC1L 4QRPA 3D39E 3S34L 1F11A 1U3HC 4I0KA 5DHVB 2GTZB 1EO7A 1HN1A 4XXCA 1JBJA 1WFTA 4QY8B 3BE1L 3KWWA 4M6OL 4ZPVA 4LAJH 1C5CL 1Q9LB 3BYTA 1TFHA 2DQHL 2NZ9C 3QG7H 4WV1C 4ZXBC 3PGDA 3ARDA 3I02B 1URLA 2VN7A 3HNSH 2V2XA 4D9LL 1G6VK 3GMOA 1CD0A 2EC8A 3B3IA 4M1GL 4G6MH 5BS0A 2BVYA 1KEMH 4JGUA 3H8NA 3C2SA 2HFEB 4ZDHA 2A1WL 2XKNB 3IKCA 4LGRB 3AMLA 4XAWL 4WO4C 3BWAB 4JPWH 1MH5A 3D3VA 3THML 4R4FH 4OV5A 1X4XA 1UM5L 2V5RA 1R3KA 4KQ4L 2AJSH 4DN3H 1JPGB 2D7MA 2AP2A 2FO4B 3NFNB 1TVHA 3O6MH 5GGVL 1Q9KA 3QQNA 1WQVT 5E8OB 4NQDB 4YDIL 4PJ9A 4JHBA 1QFUL 1SEQH 4AEEA 1PKQB 4IRSB 3BKYH 2ZUTA 3RNQA 3K0WA 2DIJA 3MV8E 3IDIB 1HI6B 5T3ZH 4OF5A 4F37F 2IAMC 1OTTD 1UJ3C 1JHTA 4I2XE 4FQXD 4PJCA 3VFTA 2VUOA 1X5AA 4H5SB 4YGAB 1H3TA 1U36A 2AXGA 1KT2B 1D5BA 1FGNL 3C2AL 1CLZL 5E4IA 1MHHB 4HG4K 3QG6A 4W6XB 5MI0B 4OLWL 2I9LB 1CXFA 3G5XA 4KROD 1U41A 5FO8A 2OMBA 1HQ4B 3QFJD 4JY5L 5CGYD 3TN0C 5GJTH 3BQUC 4HXAL 2XN9A 2HG5B 5DUMH 5FGRA 4XP5H 5I75C 4LLUA 3MLRL 1O7SA 5C07D 4HKBA 2WLZA 2Y06L 4BQ9A 3V4VL 1KIPA 1N0LA 4Q7DA 2VE6B 4F33A 4C56D 1MLBB 3Q3GA 4S1DD 2R56L 1YNKH 5EUKB 5ADPH 1I7UA 1H5BC 2ZCHL 2XA8H 1FL6A 4UB0L 1A4KA 1XIWC 2QR0B 5AEAA 1R5IB 4OUUB 5IMLA 2Q3ZA 1JL8A 2DQEL 3BN9D 3V7AG 1CVSC 3PJSA 4ZUTB 3QI9B 3IXAB 1RAMA 1NC4A 3C8DA 1DSFH 2MJWA 7FABL 3VXTA 4MAYD 1IGMH 4QHLA 5I8CB 2NQCA 1PY4A 2BVOB 5I1LB 3G6DL 2W9DH 3PQYD 4WJ5B 2C4FT 2GI7A 2VXTH 3INUL 2G9HA 3D0LB 1AGDB 3F58L 43CAB 4PBWD 2YZ1A 3ULUH 3LZFH 4M62L 3TFKC 4L8BA 3VCLA 2HJLA 3SDDD 2ZUVA 4ZS6C 5HYEA 4TUJA 4QXUH 1P7KB 4JVPA 4K9EC 4PRIB 3NVQA 1WBYA 4XH2A 4X6BA 2EIBA 3OX8A 1I9RL 4CUCA 1QA9A 2NY4C 2Y1VA 2UZYB 4OCRH 4BQCA 3MJ9L 2A73A 4DUVA 4H0HB 3GSVA 2BVTA 3MJ7A 4Y2DB 4RQQB 4ONHA 4CVUA 3G08B 2NY6D 4LCCA 3U6RA 5D7LE 5EA0H 3JWDL 4O9HH 4PJ5E 4FQIH 4EDXB 3NA4A 4FQXA 1N2RB 5DVLA 2X1PA 5GRZA 1EFXD 5GRUH 2MKLC 1KCKA 4DKEL 1YEHL 4OLYL 3T2OA 4D0DA 4Z7WF 3QPXL 2OK0L 1WC7B 1IAKA 4D2NA 4HS3A 3UJTL 1WCBA 5JQHC 1OT2A 4OGXL 5A3IC 4F15B 3X13A 5EU4B 3QIBC 4X9HA 1U93A 2DI9A 2BZDA 5J1AB 3RUGF 3C8KB 3LH2H 1MJ7L 3O6ML 4DTGH 3UC0L 3D2UA 3TNMB 4MNHA 1AD0B 4HLZG 5MEQB 2F15A 1RZGA 4PRDA 5IFJB 4KUCF 4ACPA 1JJUA 2F54B 5F9WB 4GKOA 3NZHL 4NJ9L 2V7NB 3DUUA 3P4OB 3W0WA 1KTKE 3ARWA 1MFBH 1DVFA 3TVMB 1QLFB 4P46C 4TPRL 4MNQD 4NRXA 1JYXA 1QRNA 4NUJA 5LBSL 4O5LH 2ATKA 2W1NA 3BD3A 3VXRD 2CLRB 3V5HA 5F96L 2ZOLB 2BSSA 5I30H 3LKRB 2R4SH 5EO1A 3UTZA 1WAAE 3CAFA 1QZ1A 1YN7A 1J8HD 4FFVC 4DFIA 1JV5A 3WD5H 1S5HA 4JCLA 3O2DH 4PGDA 2YD3A 4IBLT 3BH8B 5DD6B 4CDHA 1NCAH 4MAYA 2XY2A 5ICXB 3BZDA 3ARXA 4Y4HA 1BQHG 3NCYS 3P0GB 3RWDA 3PQYA 4P23A 4L3ED 5IW3A 4GUPB 1DLHA 3SJVE 2E7HA 2XA8L 4ZAKB 1AHWA 3ARFC 1UZ6E 2NY5C 3PF2A 4LIQE 3QCTL 5CZVL 2DLFH 3O6FB 3SDDA 5IGXH 4ZS7H 1G9ML 5D1XC 3CDCA 1QEWB 4HWEH 2F19L 3PXHA 5C9JB 5MHSD 5TQ0L 5DUPL 2NLJA 4MMXC 4XMKH 4LSPH 5K9QI 1T3FA 3DX9A 2QQKH 3H3KA 2EICA 1NFDE 3H9SD 3RVUD 1BVLA 3G6JF 4QYOA 3S35L 2W9DL 1REIA 4UUJB 4HUUA 3HUJE 3T77A 1NFIA 5IBLC 4PJXA 3QAZB 1F4AA 2V5YA 4K07A 2VWEE 1S8DB 4OCWL 5HI5C 5HVHB 5L7XL 2WAHA 1WGOA 1CBVL 6FABL 1C5DB 2XFXB 1Q0YH 4LDLB 1MCFA 2AEQH 4OCRL 2GSGA 3TT3L 1HSBA 1B4RA 1HKLH 5E2TH 2VL5A 5F9JA 2ERJC 3KGRA 4AM0A 3CFIC 1UXSA 5FKAB 1OTSC 4Z77A 3OKEB 5DEFB 5CJ8A 3RQ3A 1A0QH 4EQ2A 4X6CB 2RGSA 3SQOH 2HFTA 3CFKB 3EDDA 3K2MC 1P9MA 4H0GA 3TIEB 5E00A 3O3DB 1S3KL 3VXRA 5A40E 5LGHL 4DGVL 3JV0A 3BP4A 1VKXA 3CVHA 1YC7A 3UTSB 3V2AR 3PE9A 4JDVA 1KPRB 4HV8B 3O4LE 4R0LC 1U3HD 3BISA 1G7JB 2AGJH 5BJTB 5D96B 1T20B 3MR9B 1K6QH 4OQTL 3EOAA 3D9AL 2XNAA 1WF5A 2WBJB 2BXYA 2BVPA 2VR9A 3CJJA 4WHCA 2VN4A 3BPNC 2Z31D 1D6VH 1F42A 5C07B 1D5IH 4FQ2H 1LQSR 4OZHE 5EC1A 2EIZB 4X7EC 2HKFL 5GGQH 3SKOB 1EAPB 1L4IA 1YEFL 3G9VA 1PBYA 4JR9L 3QNYA 4L3AA 5FGCE 1ZSDA 3VFNA 5IB5A 4F7CB 1T1XA 2YUXA 4D9QD 1ES0A 5E2VH 3QCVL 1DBML 5D70H 2DJSA 1MAMH 4XMPL 2CUHA 5IB3B 4I5BB 5ITBH 3IYLW 4BFGA 5SX5H 2YPVL 2UZIH 4U1SA 4CVXB 4C57C 5BZDB 1AGBA 2MQ3A 2W59A 4FNLL 2B2XL 3P0YL 6CGTA 3DGGB 2DD8H 3WKNA 4PGCA 3KXFD 2BY1A 2NY1D 3ZE2E 1CFVH 3A6BL 4RDQF 4KKAC 4OZGA 1EXUA 1FZJA 4XWGH 1EEZA 5HSFA 1OLZA 1RZIA 4ZOBA 3O41A 3L5WA 5C0CA 4G7YH 4A2LA 5F21B 2VDOL 3FB5B 4NYLA 5IVXF 3TJHC 1GIGL 3U4BH 4XNXL 1XGQB 2V5TA 1U8HB 5DGQA 3K7UA 3U1SL 5IW1A 1W0WA 5GS0H 3DROB 5I17A 4PJBA 3EW3B 2F8XC 4GRMB 4RX4D 1KYOJ 2VH5H 4YFDB 3C87A 4GXUM 4ZO9A 3FO2A 1WIPA 1E6JH 4L8DA 2DBLL 2VLKD 3LEXA 4JFXA 4MWFB 1PG7L 4Z18A 4EUPA 1CFNA 3R1GH 4KGLA 4W4OC 2ADGB 3NGBB 1EFXB 4G42B 3LEVH 5H35A 1Q9OB 4XPFH 1HWGB 4NP4L 5LAXA 1JNJA 2DMBA 5CEZE 5E08L 3X3FH 4OKVB 3OKLA 1U3HA 2OI9B 3I9GH 1ULVA 2LU7A 2D7QA 2ZP0T 3MLYL 1KLUA 3CK0L 3JTTB 5GGSA 1I4FA 4Q9BA 5GRYA 2V7HA 3U48A 2A6IB 2DQUH 2B1HH 3HPLA 2QHRH 1A0QL 1Y0LB 3CVIH 3UYRH 2P42B 4ZXBA 3CSGA 4URTB 4OFYD 4JFQA 3BPLB 4Q9QL 2ESVB 5I1IH 4KK6D 3RZCD 1MCQA 3KYAA 5ESQB 3MNZA 5GGRB 2WWMD 2QQNL 1LO5B 2FX7H 4WFHE 2X70B 5I0DA 1GHFH 4GW5B 1M7XA 4EBQH 5DO2C 3V8OA 4LNRB 5T1KD 4GG6A 5FYKL 1MREH 5D7IE 1KJ2B 2P24B 3Q0HA 3MGAA 4MNQB 4B41A 4KUCD 5CD3A 4HIXH 1IC7L 3UTQB 3DURA 4XCFH 4PJ7B 5EU6E 1YY9C 4AIZA 2P8PB 3NACL 3TM6A 1QBLL 2B0SL 1J8HB 2R0LH 4XI5D 2G5BB 5INDA 4GAJL 4CW1B 4LK4A 3RPIB 1G1CA 4L4TE 1KENL 3ZKNC 1S7QA 2NY0D 4HGKC 4NDMB 5ACLA 2JTDA 3C6LB 3IJHA 4RWHA 1NBYB 4ZNEA 4L3EB 4O4YL 4OLXH 2IBBA 4V2BA 3SO5A 4ZTOL 2R1YB 5D70L 4LPCA 3MQIA 3EOBA 5AYUH 1ED3A 3DUSA 5DT1H 3U7WL 2B4CC 1T89C 4ZUUB 3BQUA 4IDJL 2DI7A 3CFDA 3O3AA 1XR8A 4XP6H 1A3QA 1DQMH 2IFGA 1UWEH 3NIDE 1A14L 3GSWA 3CXDH 1WBZB 2EXWD 4QEGA 2J1KA 1VGKA 4NNYA 1KCLA 1CFVL 2AXJA 5IG7B 1ZTXL 5BQ7A 3P9LB 3CDYA 4WUUD 4Z7VA 2GCYB 3ARVA 1JK8A 3UAJD 4Y16B 2A6KA 3EDJA 2YD8A 1U8JA 1CFTA 3IDJB 1ZA3B 3B9DA 3IJSB 1H5BA 1N5YH 4OGZA 1BLNA 2WW8A 1XIWA 4NQEE 4XP1L 3W9DA 4YK4B 1ZHBB 5C92A 3ULVH 4U1HA 3TV3L 5DDHB 1JHLL 3O0RH 3E6FA 1Z3GH 2O5YL 3GNML 5F89B 1PLGL 2FJFA 5GHWL 5MEPB 2VH5L 1KIUA 5C2BL 4HSQA 3H6JA 3OHXB 5IKCA 2X4PA 1F90L 5DQDL 3B5GA 3S37L 3A6CH 4F15C 3NN8A 1GZPB 5E2JA 1O7VA 1MF2H 3CFEA 5SWZD 4XCYA 4G9FA 5TE4H 5T1KA 4Z9KB 4BH7B 1GYAA 5HGAA 4XPFL 3CH1A 5B4MC 1J0HA 1NCBL 2OM5A 2QJDA 3WO3B 4KKBC 4TTDD 2R4RH 1MRCH 4YDJA 2JCCB 3ZDXE 1WWWX 4PY7A 3EAKA 1A21A 2DLIA 3C9NA 1LEKA 2DIAA 2A77L 4N0FA 3T4AA 3WL9B 4ELME 4PJ8D 5I1JL 2ADIA 2JB5L 5E95B 1BIHA 2D31B 4UQ3B 4PTUB 4X98B 4B7IA 5ESVB 2IADB 4R26L 2FLBT 4CN6A 3DX8A 2OL3B 2NY2D 2GJ6D 1A6ZB 4KKCD 2J8UE 1DFBL 4JHZA 5DQ9B 3SGEH 1HHGA 2PW1A 2BVQA 3LD8B 2XY1A 3F12A 3T0DA 1S7SB 3HFMH 2GJZA 4Z7OE 1KOAA 2ZSVA 3QDJE 5C0DA 4J8RB 3OKDA 3QUKA 1KYOK 3DX7A 4NO0D 3O8XD 1EO5A 3QIBA 5JXAL 3N50A 3QEGL 3S97C 3TJEL 2IQ9H 3BP7A 3O6LH 1FN4B 1EEQA 4RBPK 5KVDL 2GK0A 4X5XB 3BESR 3OJDB 2RFXA 2WIIB 5LCVL 2FH6A 4FFWC 2Z93A 1CZ8L 3O6FC 3W2DL 3PWPD 4P4RA 2D03L 2A6JB 2Y6SC 4OLEA 5F7HA 3SKJL 3SGDH 2OR7A 4ONGL 2WMPA 3E0GA 3F7QA 1G6RH 1OTUC 1M71A 4NT6A 4P46A 3U9UA 4P48A 4J4PC 4E41E 5A16A 2ZUSA 2P47B 4EN3D 3HR5B 3WUWB 5DT1L 2JJTC 1FPTL 1RVFL 1RZJL 1MCDA 3G6JA 2PTTA 5IMKB 5F7WC 4X80H 4KTDH 4LSQH 1D5ZA 3JZ7A 3GSQA 3FCTA 1A1MB 1R24A 1T66D 3GMMB 3QAZC 2FX9L 1U58A 3PGFH 5HVHC 4PB0H 4YHOL 1HXMA 4KJPD 4ODBD 5E5UB 5D1ZD 3HTLX 4HC1H 3UZVB 4HWUA 1E4XH 2AJZB 4KAQH 1YC8A 3HA0A 5BVPL 2B5IB 4XRCB 3BEVB 4OFIA 4WU7B 5DQJA 1I7TA 4QF1A 3PHOA 4XNUL 5HI3D 3WLBB 2NY3D 4HH8A 5J7CC 1I1FA 2YWYA 3V0VA 3BVNB 4PJHE 4L4VB 5F93C 5ETUA 1P6FA 4NUGL 4UU9A 5GSVB 3WFHB 2ZUXA 1JWMA 3U4EA 5F8RC 5D1XA 3HZYA 2HLAA 2JF1A 3S96A 4XZUB 5KVMC 2FYYA 2H6PA 2ZG1A 4K94H 3LEYL 1TPXC 1T21A 3BUYB 3P4LA 4MSWA 4YO0B 3QXVA 4NM4H 4UTAH 4TVSa 5HD8D 3ZTNH 3B8YA 4M7ZB 5C0AA 5FYLE 1UKTA 2APXA 2QKIA 4RNRA 1FIEA 1ZE3C 1QO3B 2GJ6A 2IPKA 4OGYH 3W9EB 3BZ4B 3HPJA 1QBMH 2ZWLT 3N1QC 3ZDZE 4LEXH 1J1XL 5E8DH 1ZLUH 2P48B 4JDTL 1HIMH 1T7VA 5D96C 5EC2A 1E28A 3O8XA 5ENWA 4E0RB 3VXNA 3RZCB 5ANMB 1XF3B 4ZTPH 1LE9A 4Z8FL 4GKNA 4OCNC 1YNLL 3RUGB 2NX5D 2WBJC 3M1BB 5AUMB 3X12B 4QRRE 3ZKMC 4CNIB 3V0WH 4FXGB 1NLBH 4QRTA 2BDNH 4NZTH 3VXMD 1OOAA 1KN4H 1KEGH 3VE0A 3BYYA 4FQQA 1B0RA 5J6HB 5IHZA 4MQXD 3VMPA 3TBWB 3AGVA 5JOPE 5I18L 2BFVL 1MCNA 3P4NA 1MCCA 2NXZB 1F58H 3WS3B 1YECL 4QRQB 4EN3A 3HFML 2H32H 3Q6FB 5DJCB 2YUVA 4TVPL 3ESVF 1X7QA 4HCRH 1ZAGA 4ERSL 5T1LD 2IJ0C 5IVNA 3I75A 4DW2H 2NY0B 3N1GC 4A6YB 3GSOB 4YPJA 3PP3H 4R0LA 2XZZA 3LKSA 4P2OB 3RP1A 3MO1A 1TZIB 5CD5C 5FCSH 3WLWD 4JZJA 2OTWA 5I15H 2J2ZA 2DF3A 3VXPA 1KSRA 4JFZL 4M5ZH 3IU3A 3KLAB 4GLRH 4C4KO 1QSFA 4KQ3H 4Q6YA 3PWVB 1OSPH 1K5NA 3JV6B 5DHYA 1JI1A 5BRZD 1SBBA 1KPUB 2BNRE 4XCEB 2PNDA 3BP6A 1JUFB 4KK9C 3GI8L 2N7AA 5ERWB 4M7LH 3RZWA 1Q0XL 4WUUB 2ARJB 3U30B 1TJGH 3WDIA 1IEBB 3TBTA 3OKMA 4R2GC 3V6FA 3RWFA 3I2CH 3TO2B 1DQQA 4NQCD 1I8KB 1A6UL 3FRUB 1UH3A 1IKNC 3QA3B 4L8CB 3MJ8B 4MDIA 1A3LH 4X7TB 4JHWH 4EIGB 2I07A 1GVIA 1NCDH 1W72H 2OJZL 1SM3L 3QQ9C 4NRZB 4P2QD 3MOBL 4GAYA 4JFDD 1CGTA 4KAQL 3O6KH 4Y5YB 5HTSA 4B0MM 3I6GA 2P49B 3EYOA 4AG4H 2AEPL 2OI9C 5C8JA 2B1AL 2VKXA 1MPAH 5ID1B 2GTZA 3VFMA 1HE7A 1JNLL 4KHTL 3CZFA 1H0DB 3X11A 5AD0B 3WXVH 3FQUB 2NX5A 1U2CA 1A1OB 4HJ0D 3I6KB 3EDFA 3BPLC 1OD7A 1FYHB 4DZBB 1N7MH 4JQVA 2NY7H 2ITDB 4J3SA 5JNYA 1EUTA 1C16A 4UDTA 5IVZA 4ALAH 4UQ2B 4PBXA 5D5ME 3PWUA 3CXHJ 5C09B 3L3DA 4X7DC 1MAJA 4TQEH 2FR4B 2YSSB 3SDCC 5HHNB 2YMXL 3DO7A 5FYKU 3QDGE 1BZQK 1OP5H 1HH9B 5JQ6H 3MV7D 4PJ8B 1S9XB 3NFNA 2R1XA 2BOCB 4X6DF 4NQDA 3LPWA 1D9KD 1CFBA 3R4DA 1G7HA 3LVEA 3PHSA 1SJEB 4H1LB 3ALWA 5I1AB 4J2XA 5F1OB 1HQRB 1MCIA 3CGTA 5CKAA 1JGEB 1PGRB 1RULL 3QUXD 1A4JB 1UKSA 4GSDL 1AD9A 1F4HA 5IBUG 4NO0B 3BH9B 3B8SA 3O9WD 3BUTA 4U0RB 3C6LC 2FATH 3RKPA 5GSRB 1J0YA 4WEMB 4S1QH 1S78D 5BRZA 1DL7H 5D2NB 4NQUA 1FO0B 3BHBB 3V7AE 3LAFA 2HT3C 4LHJB 3SDXE 3HE6D 1JI2A 2HG5A 4P2CG 3ZSSA 4Z0BL 1KUMA 3WJLA 3NH7L 4L5FL 5KSBB 1I1AD 4G6FB 1I7ZB 4NWTH 1JN6A 2CO6B 2VLJD 2VDML 3CLEH 5BV7H 3EOYG 1K85A 4HXBH 3VD7A 2VE6A 5B38G 5CIPH 2Q76B 3G5VA 1J7VR 4P2QA 4APQB 4Y16C 4HLZH 2Y72A 1KJVA 5EUKA 2P46B 2QADD 5IB4A 3VWJD 3CDGA 1NDGB 2BRRH 5GS1B 1U8QA 4YK4C 3FQTA 1XH3B 4JKWA 1FV1A 1KG0B 1ZGLB 4TUOB 5D7KE 5D1ZB 4UV4L 3H3PL 2B20A 1A6TB 4PJAF 4HIIB 3O2WH 4BSVB 1AIFB 4XHQA 3FO0L 4U6XB 1UB6B 5E70A 1JF5A 1MHEA 4RFEA 1VEOA 1NGZA 1A5FL 2NY3B 3HC3H 3T0ED 4MS8C 4XAKD 3BXNA 3UJIH 1G7MB 3ILQC 3VH8B 5J6GB 4KKLC 4UT9H 1KB5B 4IRZH 1Z2KA 5B39A 2ED8A 5A2LH 5I73B 4I0PC 3UXFA 1UYWH 2D3VA 1VGEL 4QOKE 3QIWD 3M8OL 3MRRA 4U2YA 2BSED 4JFHD 1P1ZA 5GS2H 1CR9L 3K8KA 1XCTB 4PRPA 4UNUA 1UA6H 3MV7A 1AO7B 3LS4H 2EE6A 4QTIH 2C26A 3O2VH 4M43H 3MRNB 5EO9A 3WYRA 2EO9A 1D9KA 3ZKXB 4UBDC 1ZHNB 3TO4C 1AP2B 3MMEA 4LLYA 5I1GL 2FJHB 3MRPA 4EXPX 3E6HA 2OZ4L 1FVCB 4HBCH 4NJAH 2F53B 2FEDD 2FZ3B 4LHUB 5E4EB 1IM9B 3HB3C 2I60H 1N7ML 2I24N 4WGVB 4YZFE 4NRYA 2YK1L 3LD8C 5ISZD 1C08A 1YMMB 2XYCA 3UJJH 5JUEH 4Z7NF 5E6ZA 2EEAA 4G9DB 5B8CB 5EU4A 3DSFL 1WZLA 5J1AA 4NO5B 3VXMB 2FO1A 2PR4H 3EDKA 3QEQE 4Y4KC 2IC2A 2VLRA 3V4UH 1J10A 1I1AA 3KPMB 4MJIB 3VDCA 2VLJA 3QQ3A 2VIRB 2NR6D 2YRPA 3O3EA 4N9GA 1R5WA 2FHBA 3DHJA 4ZQKA 5D8JL 4JRXD 1IAMA 4ODHL 1ACYH 3WKMH 5LWYH 4P2RD 5I8EB 4JN2A 2EDWA 4KMLB 1ORSB 3BGMB 1JPSH 4P3DB 4PLJD 3RIAK 1SQ2N 4LPUA 1I8LC 1NAMA 4WIQA 1L0YA 2C1PA 2GSIB 2ZOLA 4HUNB 4WUKH 5TDOB 3FB6B 5ALCH 4Q0XH 3PGCB 3B2VH 4RAHA 4MMZC 3P11L 1DBBH 1CTNA 1UT9A 5C0EA 1PFCA 3V6OE 2R2HA 3MRGA 5GIRB 3FT2A 5HHME 3IDXH 4YGVA 3CXHK 3MRFA 5KOVC 2B5IC 4XVTL 1BBDH 3WCYA 1K4DA 1T1YB 4TSAL 1LEIB 2P7TB 1TDQA 4HJGA 5K9KB 3QIWA 1DBJL 3QXWA 4POUB 4YH6A 5IVOA 1MUJB 2J5LC 1FNSL 5LXGL 1CXIA 4Z0XB 1XF2B 3S7GA 4JFDB 3DBXB 5DEGB 2H26B 3PHQA 3X17A 3OZ9L 3DX6A 1T0NB 3MXVL 4J4PA 4K3HA 3NA9L 2ZUUA 2VITA 3PWLA 3DV6A 2MQ0A 3H7LA 5HHOE 4PUBL 3QIUB 3HC3L 5GRVL 2JJTA 5A43C 2HVJB 4MCZA 2VDPL 5F9OL 3LKQA 4UT9L 2V2WA 4X4MA 2IFFH 3G5ZA 35C8L 5KZCD 1XF5B 3BOVA 1DN2A 5F3BA 1JYVA 4CN4A 3D69B 4HZLA 2HJFB 5EIVA 1AGCB 1KCVL 5T3XD 3DJ9A 5ADOH 4I77L 1E6OL 5HYJD 3NZ8B 1N5AB 1M05A 5HHXH 4NWUL 2DMCA 3WFEH 4LSDA 1CGVA 4XVJL 2X89D 1S7UB 3GI9H 3K2UL 3SY0A 3TH2T 1RD6A 3RI5K 2NXZC 2ZCLL 3MRLB 1YDPA 2BHYA 4KI5C 5EBWA 4S1SL 3TP4A 1U6AH 5F72S 2VERN 3K8LA 3WIFA 3QUXB 1ZKAA 4YPGB 3UBXB 4KMTH 4Z7UF 3QUMA 4ORGA 3TIDA 3LN4A 3O9WB 1ZWIB 1T7WA 4TSBH 4P2OC 1ZT7A 3LY6A 3RY4A 1Q72H 2QSTA 4MB3A 5FYJU 2R0WL 4X4YB 4UILH 2FBOJ 1MI5D 4K3JL 5D7JB 1A6VH 4FQLL 3HE6B 1MCPH 1IKFH 1V7NH 5TPWH 2AJUH 2DTMH 5LWYL 2CRMA 3PDOB 5L88H 3PUCA 12E8H 5HYSA 3DXAE 1NGWA 1F6AB 3BAEH 3AUVA 3R06A 4X9IA 3ZSTA 5FOBB 5CP3A 1T2JA 4JAMA 1QFWL 2HKHH 1SJXA 2IH1A 5C0BD 4EI5C 2BVEA 5GRXG 5DRNA 2FL5A 3OF6D 3VWKC 2A9NH 4I5BA 1OPGL 3SE9H 1CGYA 3VWJB 4IRJD 4GBXD 5JXEC 3DVNA 3K74B 1RIUL 3WE6A 1BQLH 1BGXH 3VRLE 4GKZB 5JHDD 1U8MA 2VLLA 4Q9RH 1MWAB 2QHLA 2H3NA 4UIMA 4X5WB 2JK5B 4Y5YC 4GXVH 3FAWA 4HD9A 5KJRL 3V95A 2HWZL 4YC2B 4GRWB 1C5BH 3RL1A 1BWMA 4AENA 2WUCH 3NCEB 3UZQA 1KB9J 5I76B 4NZJA 1NMBH 3ZLQC 3AB0B 2AJYH 3T0EB 4RAUB 1OB1A 4GMSL 5I1HL 2Y5TA 4CJ1A 3ILPA 4XVUC 3TF7C 4YX2H 1B0GA 4X6EA 4R96A 1DLFH 2EYSA 5E5MA 1F45A 3L9RB 3RGVB 4O02H 3AREB 5SWSD 3BKJH 1XGQA 4HUKB 3VG9C 2AJ3B 5T5FH 3QBTB 5GGRY 3ULUF 2X89A 3MA7B 1XGUB 3KJ6L 1RUQL 3MLZH 2OCFD 3L3IA 1AFVH 1IKNA 4NC2B 1NJ9A 3MJGX 2P5EE 3RX8A 1RIHL 5T33H 3ECBB 1QLRB 4BK4A 4AZ8A 2D7TL 4JCMA 3OR6B 1TJIH 1ZHKA 2HN7B 2VDQH 3IAGC 4RIRA 5K9OB 4LGSB 4X6DA 2CDFA 1FNEA 4QWWD 4XCNB 4P3CL 5B22A 4O2CB 1WAAF 1SEBB 4OI9A 4J3XA 3IVKB 4P9HL 3V0AC 1C8PA 3H9HB 5EBMA 3RY5A 3S9DB 4JG0H 4OKDA 3OAZH 2XWTB 2VWEC 4U0RC 5IHUH 2MCPL 1PVHA 3STZB 5L8JB 3VFRB 4JPVH 5EULV 4M93B 1PQZB 4YHIB 5TFSH 2ZSWA 1HOCB 5BMFH 1BJ1H 2BNQD 1BD2E 5DD5L 2XTJE 2BP3A 2X4OB 1UZ6F 4I18B 1YA5A 5FHBL 4KXZI 4I0PD 4LLWA 4Y4FD 1PG7X 5JPMA 2E3VA 2YZ8A 3UP1A 4BKLA 2CKBB 4JRXB 3IAQA 2HT2C 5FECB 1VADB 4F7EA 2BJMH 3SDCA 4MA1C 1QSED 4IRJA 4GBXA 5IROA 5C86A 3MLVH 5GZNC 5D71L 4JFYA 5ITFB 4APQC 5F7NC 4PS4L 5JHDA 4F7TA 1HYRC 4X99B 4HFUL 2DYPA 1W2KT 3V5KA 4K7PY 3T1WA 4DCQA 3TNNA 1HEZA 1JNNL 5KVGH 3JV4A 4QHMA 3VGBA 3RPIA 1G7QB 2FB4L 4N0CC 3D39D 1CLOL 4PRBB 3MUZ1 4NQSB 4PJEB 3BPOB 2Y7QB 1GC1L 5T5NF 3C6LA 4CN1A 2BMKB 4K7FB 4JFED 3IDNB 5DSCA 4IMLB 4MJ4A 4R3SB 1WVZA 3K1KC 4PPTA 1WLHA 5SWSA 4ZUUA 2VDRH 3L3KB 4P59H 8CGTA 2HTLC 4XNYL 2XQBH 1YJDH 3IGAB 4OD2B 5DFTA 4OF6A 3UCRA 5I73C 2ZNWA 4PLKD 3CVHH 1RUAH 2CGRL 5KG9B 1K9TA 1IC5L 3WJJC 1QHPA 4KHXL 2P5WE 2DN7A 4JM4L 3MOAL 5E6IB 2EKSB 1FH5H 4WHYG 2XWJB 4KFZC 1N8ZB 4K71B 3VFSB 25C8H 4PP2B 5DJ2A 1ZA3A 1GGTA 1OARH 3GKWL 1G84A 2RHEA 4LLQA 1I9IH 5FYKE 2HFFB 2YUWA 3TBYB 4B53A 4ODVH 1SY6L 4M5YL 4DVBB 3JSSA 5E94A 3EDEA 5MERA 3IETB 3PABA 4FZEL 2XIDA 4U3CA 2H8PB 4MHHG 3U36B 3OHXA 3VA2C 5DMKA 3F5WB 4U1NB 3FHAA 5DJ6B 5I74B 4AK1A 2BNQA 5B8CC 4N5UA 5DJAB 5KTEH 5FUCE 4AY0A 3BD5A 2BNRB 3QUZB 1T1ZA 3EGSA 4I0PA 4OV6F 4DKFL 1MJ8L 3MLXL 3QWRD 1BFVL 3IDMB 5CMAA 4NBZB 1JWUA 3VFUB 3MXWH 1QSEA 4C83A 4HJJH 4OB5H 2BCKA 3CPLB 2VRAA 2R69H 1NUFA 4IS6A 3GJFK 1Q8MA 4XPTL 3HS0B 1A9BA 2VXSL 3TO4A 4F7PA 3QYCA 5IHLB 4UTBH 3FT3A 3HI6L 4HQQH 5GISH 2Z4QA 3RVTD 1FORL 1VEMA 4MZ3A 5ESVA 1N6QH 3MUGB 3C08L 4ZFFB 1KLFA 3D39A 1FAKT 2YBRA 3RVVC 4JE4B 5F6IB 1A6ZA 4HX1A 3G5YB 5DQ9A 1DQLH 3C60B 1MI5B 2BY3A 1JWSB 5FO9B 4LFHG 1VA9A 4YAQA 5GGTA 4U05A 4PD4K 3UPAA 1QUNA 4H8WL 2XQYK 4U6TA 2M1KA 4PV8B 2CLZB 1QSVA 5MEOA 4ZFGH 4Y4KA 1MIEL 4PG2C 1MFCL 2AKRB 3P77B 1DBKL 1ETZB 3L95A 3GHEH 3IF1A 4ZPTB 4OD3H 3OJMB 2NNAB 3OJDA 5C0BB 2WIIA 5FO7B 2OSLA 2GK2A 5D5MB 4LOUC 5I0ZA 2XOTA 4OZGE 4RGOH 3RBGA 4DOHE 1A7QL 5IOPA 1IGIH 5HYSG 1H3VA 4JDZB 3T0XA 1RK0A 3HAEB 3DOSA 3H7BB 2EZ0D 2OTUB 4YDKH 2LTQB 3HR5A 3HCVA 4U1GB 1I8LA 1OAXL 3QIUC 1S9VB 5D7LD 3RWCA 3VFPA 1JGVH 2W9EL 3MV8A 4IOIA 4X9BA 5IMKA 4GMTL 4PJ5D 3S36L 3EO0A 3QDMB 2PYEB 4LKCB 4QNPE 4I2XA 3PWJA 4WFFD 2IPUK 4PJAB 1KXVC 4N8VA 4FXKA 4UAOC 4P5KB 1JZ3A 2VDKH 1WJ3A 3GUTA 2BSTB 3KYKL 3DRTA 5SX5K 5JTWA 4XRCA 5EWIL 3L5JA 3VXSE 3ZYOA 5HDLA 1A6WH 4WU7A 1G9NC 2FDBP 3FFDB 5C0IB 2XG5A 4L4VA 2L0DA 2VQ1B 3HMXA 4B50A 5CJ5A 1OWRM 2VABA 4IOFC 5DMGD 5D7IF 3ULUD 2CDEB 4BH8B 2BSRA 4PJIB 5DR5H 3PNWA 1X5HA 4XP9L 3ARSA 3VXQA 3ARGD 4OAWA 4YO0A 4JKPH 5F8QC 2EDBA 4X7CC 3FZUD 4X7SH 1KLGB 1MHPL 3BDXA 3KPRD 5DVOA 2HVKB 3K4ZA 4X4XA 1KPVA 1I1YA 2VDLH 3QZWB 1Z0NA 1QO3A 4LASH 4WW1A 3BZ4A 4K7PL 3MGTB 1MCLA 4Z78B 5DC4B 3ULSB 1IAIL 4EVNB 1FYTB 3X14B 3UPRA 1AJ7H 4Y1AE 3CSPA 1KCUH 5DMIL 4X8JB 3WN5C 1H15B 5AWNL 1UEYA 1A7RL 5D7JC 4MD5A 3MRIB 4V1DE 4FTVE 3C09B 3TCXA 5HGDA 5FCUL 4CNIA 1WBXA 4Y4FB 1UB5B 3O45B 4UINH 2ZKHL 5DLML 3VGGA 3JTSB 1LO3L 4HWZB 4JLRA 4XC3H 3AMKA 2BX5A 3IXTA 5DRXA 3SJVD 3KPPB 3STLA 3RTQB 4D0BB 4OCYL 5GISL 3QUYD 5C0JB 1AXSA 4XWOC 1KTDA 4JREB 3ZE0E 4BZ2L 1F5WA 3QP3A 2ZCKH 3MBXL 5L9DL 2BY0A 5IEKB 5LGJB 1FLRL 5TGBA 4FFYH 5D7LA 1FHGA 1IMHC 4LSSL 5F7DA 4AQOA 1ITBB 1T0MB 3VD9A 2Y23A 3GSOA 2H2SD 4YC2C 5D2LF 4JFEB 1TZIA 2UVEA 4NQXA 5DK0B 1K8IA 3SKMB 4K9EH 5DFVC 2F9BT 3JWOH 3K46A 1GGBL 1KIQB 5C0FB 3LS5L 2OL3L 4TN9A 3IS1X 43C9A 4POYA 2FJGB 4RFNC 5GJSL 5ACMA 5B3NA 3RAJL 5C0GA 4XCEA 3AREC 1H3GA 1YN6B 1Z0MA 4G43A 4G8IA 1CDGA 1FVDB 3LN5B 5FYJH 5IB1B 5ERWA 4PJFE 5EOCH 5D72H 1T2QH 4EI5A 4CMHB 2JKXA 3PG2A 4OCSL 5E2WL 3VWKA 3ZDXF 3QA3A 5JXEA 4LCWB 1MCSA 4N0UB 5DZOA 1PSKH 5EIQA 1IC1A 4U7SA 4Q97A 1B2WL 5TF0A 2D4DA 2AXHA 3EOTL 3RKDC 4ELMF 5HHVL 1UVQB 1AGFB 1CWVA 1RY7B 2P1YA 5DXWA 1R3IH 1MLCB 4PRAB 4HUWB 2HRLA 1WAAA 2EDOA 5EU3A 2J8UF 4GRLB 5TDNA 1BJMA 1FNLA 1XGTB 4EZMA 1Q38A 15C8H 1R5VA 4YXKH 5GGUA 3O4LD 3LKPB 5HGHB 3TH3T 3HNTL 1H0DA 3HG1E 3BKCL 1OAZH 3DYMA 3IFLL 4ZYKA 3GK8H 4G6KL 5C08E 1RZKL 2ZJSL 3QHZH 1A1OA 3GGWB 3FO9B 2CSPA 3MV9D 1LO4L 4M93C 1TQBC 1Y6KR 3RY6A 2K9UA 3K8MA 5IV2B 1CDIA 2ORBH 2AK4E 3SJVA 5C7XH 4PG9A 5FYJE 5ICZB 4I18C 4NHCH 1DUYB 1LDSA 3IDGA 4L9LA 4WWKD 5F44A 4NQVA 4M48H 5JIIA 2VZ1A 5DD3L 4JFFE 4M3JA 1XAUA 1ONQB 1CFQB 4YUEL 5EIIA 4YHPA 1R3HA 1HSAA 1UKQA 4JY6B 1RPQA 2DL9A 1S9XA 2BOCA 2W0KA 4XT1C 3GBNH 1VHPA 4NKIH 4NNPL 1YEDB 5F88A 1NFDA 3TA3D 3FONB 3KG5A 2H2PD 3KNBA 4KGJA 1OAUL 4KVNL 1KXQE 3GIZL 4PGEB 3HUJA 5SX4I 1IGJA 3RDTD 1IARB 1G7IB 1JGEA 2JELH 1AQDB 3O2DA 2Q1EA 4AT6A 4LQFL 1LP9E 2LVEA 2G2RA 1NDMA 4LAQL 1OAYH 4LF3A 5EOTB 4F8QA 1M4KA 3VG0H 3OQ3B 5KS9E 3RWHB 2XV6B 1M7IA 3EYSL 5F9AC 1MHCB 1INEL 3EUUA 1Z9MA 4PJHF 5TJWK 3WFZA 1CG9B 5IQ9B 4IJ3C 1P7QA 3MRKA 1ND0B 1UWGH 1L6ZA 4OI8A 2VZVA 5J56B 1FJ1A 4XVSL 3V5DB 3MROB 4J1UA 4KDVA 5E6IC 3WDJA 4K71C 3VXUE 3ZYZA 4XBPA 3GBMH 3ABZA 4POZC 3MLSH 5KVEH 1FG9C 3C5JA 2FECL 3UROR 5HJ3B 1MEXL 2QBWA 4JPIA 1XH3A 4HIHB 3OKYA 3S5LB 2OP4H 5CEZD 1ZGLA 4RGNE 3O4LA 1VACB 2XKSA 3ZDZF 1BBJB 1B4JL 1S5IH 3OV6A 4GW4B 3WUWG 1IAOA 2WUBL 2X2YA 3AY4A 3T4YB 4LCIL 1A6AA 2H45A 1H9VA 4ZSOB 3EFDL 3LKNA 2BY2A 5TE6H 3VRIA 5ACZB 2WP3T 5EUOB 4LCYA 1F4YH 2VISA 4NO2B 2VSDA 4N8VG 3K80A 3BJ91 4LU5H 5HDOA 2AV7A 3QUZC 4MNGE 4OZHA 1JZ5A 1CD1B 3OWEA 1BOGB 1XZ0B 3QHTC 4BQ8A 1JFQL 4S0SD 1MIML 4WFHD 5GS3A 5HI4D 1IL1A 5HYQA 1OAQH 3GSNA 4MB5A 2YRZA 3IJYB 1CLCA 3UYOD 3MRDB 3KPRB 2FNBA 2AJXL 3MRNA 4E42B 3OB8A 3EBAA 3OG4B 5EU6D 4EDWL 5K9JL 1CXKA 1J1PH 3RNKA 2JJUA 4LVHB 3RWJA 2FGWH 2MFNA 2CMRH 3RX7A 4LHUA 4F8TA 3MRHB 1FZOB 5F6IC 3LRSB 2FIKB 1PEZA 4L4TD 3C60C 5E9DE 1F97A 3KHQA 3V6ZB 2HAZA 4ZD3L 3SDYL 1I9EA 3FT4A 2OX5A 1YMMA 4NCC1 1MVUB 1CDUA 4D0CA 3V6BR 5B8CA 2XZQL 4NO5A 4FRWA 4JY4A 2H9GB 4M6ML 3QPQD 5CJOH 3FFCB 4K2UH 1IQWL 5IM7B 1PW3A 4HKJB 3FN0L 1CIDA 2YC1B 1UGNA 5I8OH 1PYWB 4NKDB 5IESL 5IW6A 3REWB 2X41A 5CP7B 3IFNH 2KKQA 5JMOC 3BIAX 3ZL4L 1HHJA 2EDNA 1CFSA 1ZLUK 1ZV5A 1T83A 2EDJA 1NL0L 1NMAL 2YPLE 3MLWL 3DRQA 2FBJL 1YEJH 2LTQC 5H2BB 1ZVSB 4U1GC 1KTLA 5IJVA 4F3FB 1D5MB 2J8HA 3QJFB 1A1NA 3GIVB 5DYOB 3Q1SH 4Y89A 3PGCA 5ICYB 4ZUSB 1IQDB 1NBZB 2EIEA 2BC4A 3KYNB 2RQ8A 3CCHB 4FXLA 1OGAE 3QO0B 1G7PB 1JPTH 2B8OT 2VZSA 4PY8J 4F80A 1S9YB 1AE6H 1DZBA 4ELKB 3IDYB 5D7SH 1T1YA 5JOFB 4PG2A 3GMNB 3JUZA 3HZVB 3WXWL 2HTKC 1EEYA 4CMMA 1NGQL 4DK6A 4Y8DC 3CNKA 2L7JA 5K9KA 4IHOA 1IT9L 3Q6GH 1FO0L 1ZT4A 2R2BA 3MFFA 4MD0A 4S2SB 3D85A 2X4NB 4HGWB 4M4PA 1CE1H 5D7IA 3ZT6A 5DK2B 2G60H 4Z0XA 2DLHA 4WEUD 5FFLA 4M8QA 5DMJB 1D5XA 5EU6A 5TE6L 1RUMH 4YWGL 1FCCA 1ZEAH 2B39A 1JHKL 2PETA 1F4YL 5IK3B 5ID0A 5IQ7L 3QIUA 4KZDH 4LLVA 4Q2ZA 1H8OA 1J8KA 3MTRA 2HT4D 4FG6C 3WMSA 4U1KB 1LVEA 4XXDB 4NSKB 2IAND 3GJFB 2NTFB 3LQZB 4M61B 2DQCL 1I85A 2ZZUT 3GMRB 3MV9B 5EORL 5HY9B 3PDGA 1MRFL 4MX7B 5EPMB 4NKOB 1OAKH 3PWNA 3QDJD 3QHFL 5JIPA 3GMLB 4F58H 3HNVL 4TNVF 3C09C 3N9GL 4O58L 2G75B 4KKNA 4XPHL 2HRPL 5F7MC 1PKQE 4WWKB 5DURD 3U7AA 4I3RH 3ZYJA 3QWOB 4WTWA 2HA1A 4BK5A 4U1IB 3MCKB 1AGEB 5ALBH 3OXRB 1EJOL 2I9TB 4HHAA 4DAGL 3B9KD 3ES6B 1RUPH 3FOMB 5CLTA 1S7UA 4JFOA 4U6HA 1EAJA 4F2MA 3NFPA 5L2KD 5HPMA 3MRLA 5AZEH 3D25B 5KW9L 1HINL 4LPWA 2VAAB 1MVFA 4E41D 2B4CH 3WHE1 1CICD 1ERNA 4NQEA 4GW1B 5CJXA 3RDTB 4TNVK 3OR7B 2CJUL 3LMJL 5CJOL 4S11A 4Y0GA 1A7OH 3CU7A 4FN0A 2Z8WC 1ZWIA 5HVGB 5J0BA 5I8OL 2NYYC 1T7YA 4G5ZH 1ZLSH 3H0TA 2PW2A 1CDJA 4X4ZA 3U46A 4MA3A 3WN5A 1FRGH 1KC5H 3DV4B 3QO1A 5BW7C 4X4YA 2IWGA 1LE5B 2Q8AH 1NGPH 3QH3B 1BFTA 1YYMH 3SHSA 2IMNA 4NZRL 4GG8A 4LEOB 5E8PB 1CQYA 1K8DB 1SYVB 2O61B 3EO1A 4BUGA 5J3HD 3CX5J 3L3OB 1LO2H 4UDUB 1J1OL 3BRGC 3QULA 3GMQB 1QNZL 1JZ4A 2Z91A 4CMHC 1F4WL 3QXDB 2C3VA 4M7JL 4BM7A 1D6EA 1V5JA 1INDL 3KLDA 2AI0H 2A0LC 2IGFL 2V17H 1WEJL 3EO9H 2J6EL 5ILTH 3UO1L 2A74B 4ELMA 3FL7A 1AE6L 2FIRT 5D1QB 1UM4L 1XGYL 4ONFL 3WS6C 4K3DL 2XZAL 4YDVB 1RZ8A 4TULL 1OCWL 4XMLL 4GRLC 5KSUB 2J8UA 4YZFF 1Q9WA 3WHXA 3V6OC 3WSQH 1M6OA 3KR3H 1HHIB 4PRIE 3QDJA 3HC0B 1BEYH 1LK3L 5DUBB 2WZPD 3VGAB 1ZK9A 2EXYC 3HC4L 3HRZB 3D5OF 1VFBB 3L9RA 3LQAL 3MX0A 4D3CL 4I4WB 2W60A 1NSNH 3AREA 4PB9L 4RFOH 1U91A 1NAMH 3CC5B 2I26N 1TTGA 3AU1A 3EJYD 3B9KA 3BI9X 2X4TA 5C9KA 1N0XH 3SDAB 3VH8G 1NEUA 1E4WH 4G6AC 2D2OA 2W65B 4MXWH 3VRJB 1W0YT 2JB6A 2R29H 3NOIA 4NN7B 4E41A 3T2QA 1QLRA 5DJXA 5JORB 1CGXA 1H3PL 2ADFL 2EDDA 4R7DB 1JGLH 3EJZD 3S4SB 4RGMB 2O5XH 1K4CA 3ROOB 3TPUB 4WHYH 2MCG1 1HYSC 3NABH 1UADC 2RCSH 4EQ3A 3BMVA 5J9PB 1ADQL 4LRNH 5CZXC 2F54E 4WEBL 4M4RA 5EO0B 2IQAB 5DS8B 3I50H 3P4MB 3STZA 4DVRL 4LHUG 2Q7NA 1RV6X 4P5MB 4PYHA 2EH8L 4OZFB 1Q1JH 3ZMRA 4YBQC 2X6MA 2FSEB 5E5RB 2WK2A 4OSUL 1U8KB 2RAMA 3KPSD 5CUSH 4PJHA 5FK9B 1QKZL 1P4BH 3MA9H 3LHPH 1ZS8B 2AXFB 4LSUH 1N3NB 5IHBA 1I7RB 4PJGB 3UTPE 4DN4H 4Z95L 3L3HB 1BVZA 1I3GL 4IMKA 4TUKL 4OM0L 3U2SB 2VYRE 5TDPA 5DJ8B 4HWBL 5CS7A 5J4MA 5IMMB 3SOBH 1IEAB 1OVZA 2Z9TA 1T22B 4WHTB 1G9MC 2JLLA 5HHPB 2ICEB 3V4PH 4JHAL 4XP4H 4XPGH 2VXUH 1FZMA 4OCXH 4YEEA 4JQXC 4TSCL 1G7QA 5KSVB 4PRBA 4QGTA 4NQSA 3TYFB 3W5MA 5A2KH 1GGCH 2NTSP 1K2DA 4FQHB 4GAGH 4QRRA 4HH9A 3LV3A 4J23A 3T09A 5LQBH 1AQKL 1W0VA 3VMNA 3C5ZB 5TF1L 3KYMB 4U1MA 1SBSL 5DHXB 4N0YL 2IH3B 1RJYB 1IGTA 3QUMH 3U7YH 5JLZB 1HDMA 4FMKA 4YR6A 1J18A 1KTRL 1AI1L 4KPHH 2OJEA 5E1HB 3ROLB 3PL6D 3L3JA 4ODUB 1DEEB 4YNYB 1N8ZA 3VFSA 3QDGD 4PP2A 2P8MA 3KPNB 3TC9A 3MBEB 1UFUA 5IMOB 3AM8C 1FQ9C 1RHFA 2NW2B 3IAPA 4WI4A 5EN2A 3T65A 1U95B 3MRQB 4RFOL 4H20L 1MFEL 4LVHC 1AY1H 4PJDB 1FGVL 5DJZB 1NEZB 3FQWB 4YHLH 4MJ6A 1KN2L 1CDBA 1CCZA 2J88H 4MQ7A 4YXLL 4OLVH 2AAVA 1MWAL 3HN3A 3VFWA 5CP3H 2CIKA 4P0DA 4X6CE 1BJ1J 3QNXB 1QR1A 5DWUL 1CL7L 4OZ4B 3CX5K 3MNWB 2XZCL 3B2UD 1UG9A 3BGAA 3MLUL 4FABH 4HKXA 1WSST 3O3BA 1AXTL 1KCSL 3OXSA 2X4RB 4PRHD 5CHNA 5DURB 2ADJA 1UCBL 5J1SC 1YEEL 2BNRA 3QUZA 4Q58C 2GUOA 5F7EH 3PP4H 4NBXB 1MRDH 4JM2C 4CVZB 1RJLA 3O11B 2GT9B 3UTSE 3NFSH 4PJFB 1ORQA 3SBWC 3VFUA 5L2KB 3RBSA 1ZANL 2GEEA 4NHUA 2UV3A 3SPVA 2JJVA 2WWKT 5MENB 5JHLL 5EZIH 1FL5A 1FFOA 1WZ1H 4KJYB 1JRHL 2XWBA 1R3JA 5DVNA 2EC9U 3WIHL 5HPOA 4P99A 2EECA 3E8UL 1RUKH 4XHJD 4YQXH 4UIKL 5IFAH 4XBGB 4OGAC 5C07E 4RZCA 1BREA 4OZIB 3HZKB 1A7NH 4PLOB 4C56E 4EI6B 3WEXA 5D7KD 4J6RL 5ESAB 3SGKA 5I2IA 4P5TD 3LN9A 5B3JE 1A2YA 1EUUA 2A83A 4JANB 3WFDL 5FEBA 2AJVH 1CT8A 3IDYC 1PAMA 2AKRA 2R8SL 1HHKB 2PTVA 1HZHL 1E27A 5HBBA 3SOBL 5D6CB 4DEPC 1GOFA 1U8NA 3DMMD 4BUHA 3NAAH 1WICA 5D5MA 4TRPH 1QQDB 3HMWH 4QOKD 1C1EH 2VXUL 1G6RB 3PL6A 1PY9A 3WNNA 4YHNB 3QDGA 3EYQD 1FIGL 3BJLA 5IR1A 4HIEB 5ECJE 2CKBL 2OTUA 4MDJA 5L8KB 1WFUA 5CCKH 3RVXC 4MCYB 4NFCA 1VEPA 4YE4H 4GAGL 3B6SA 1EGJL 4JO3H 1A7PL 3MZTA 3KPQA 3QDMA 4QHKI 1C12A 3PDDA 4YHZH 3C6SA 3H42L 3RIFF 2ZOKB 3U7YL 5JW4N 2OLDA 3ARUA 1IBGL 3OKKA 1MSPA 1TTUA 2CH8A 4MA8L 1EO8L 4OLUL 3EFFB 4L3CA 3TZVD 3MACL 1KCRH 1S7VA 2HJKA 4Y88A 3SDXA 2EYRB 5C0IA 5KVFL 3QEQD 4JFPB 3NCMA 3F65A 2CUMA 2A6DB 3FOLB 2D0FA 1H3WM 4UT7L 3MUJA 5DRZA 4BH8A 4KRPC 1RFDL 3TYGH 2BNUB 2PXYD 1R0AL 2KZ1B 5GS2D 1LK2B 1HCVA 3RIFK 1NCCL 3KDMB 5E8NA 4MLSA 4MHHI 3VD3A 4UMGA 2A0LD 5C71A 2W91A 2DQIH 1R6VA 5FDWB 5DD0L 2ESVE 1M7DB 3PIQA 2XRAH 1RU9H 2EDEA 3RHWK 1Y6MR 3QZWA 2YPKB 2GYSA 1AC0A 3L3GA 4P5TA 5INCA 1OHQA 3B83A 4EVNA 5JO5B 2DDQL 3W11D 2FX8L 4MNQE 1I9JH 1U3YA 2CK2A 3BKMH 4JG1L 1A8JH 3MRIA 4PJ7E 1HNFA 2WBKA 5HHMD 3KPSB 2CO7B 4I48B 4O2EA 2R0KH 3O45A 5FUCC 4JRYD 5T3XL 1YPZB 3KPTA 5I1DB 4P9MH 1J8HE 1DE4A 4NZUL 1Q94B 2I25N 3P73B 3I84A 1FFNA 3GSUA 1CD8A 3GJEB 4QOKA 1OM3L 3LSOB 4PJXF 1FC2D 4K8RD 2VL4A 4J3UA 3U82B 5IFHL 2V5MA 5DD1H 1CDYA 3A0OA 1I8MB 3OAZK 4KTEL 3DIFB 5CIPA 5IJKC 4L3EE 2H32B 3GRWL 2Q6WA 1WCQA 2V2TA 2EE2A 1T1WB 1YY8A 5IBTL 5H94A 5HHOD 3ARDD 4HEME 2MNUA 5D1QC 3LB6C 1TCRB 3BSZL 4U6YA 1VFAB 5K59E 2DWEA 3NCCB 2UUDH 1L7TL 4L29A 1NLDL 5I1CL 5JW5B 1NUGA 2OR8A 3NAAL 3SKMA 4M6NH 3HMWL 3GM0A 3LIZL 5BW7A 2EDFA 1KIQA 4LVNB 1BAFH 3VGAC 1CF8H 3H9SE 3TZVA 1IVLA 3QEQA 4G3YL 4KUZL 4XCCL 3ZKSD 5GS0C 2QSVA 3ARBB 3HI1B 1CK0L 4PJ9D 5LG1A 5IB2A 4U1LB 4NM8H 5DA0B 1F6LL 1BQHA 4MA7H 1IGCH 4YFLI 3SDAC 4JO3L 1DCLA 1W72B 4L1DA 3Q5YA 2OXGA 1BZ9A 4NN7C 2DQDH 2V6HA 3NTCH 1NAKL 2E6JA 3OPZL 4Z5RB 1S9WB 2ICWB 1EK3A 3IRZA 3WS6A 5EZLB 4RGMC 1LD9B 2FWOB 4G8GB 1YQVL 2EIDA 2V9QA 4LSRL 2XN9D 3JVGC 3CSBA 3MJ9A 4LSVL 2B7DT 3CFCL 5JDSB 3LKPA 4WI3A 4G7VH 5HGHA 3V6OA 2X4QB 3L7FA 4ODSL 4PRHB 2JCCE 2DQTL 4I3SH 4NCDA 4JO1H 1UH2A 4MXQC 1NUNB 3FO9A 2IMMA 1AH1A 4NBYB 4RAVB 3U4AA 3NCYP 4MVBC 3SKUD 2D0GA 3UZEA 2UWEB 4ZFZA 4JQIL 4AEFA 2H1PL 4OLZL 4HK3N 1IM3B 1EBAA 4JGMA 4XBEH 8FABA 3DXAD 4OZGF 1Z9SA 5HGBB 3BEWB 5CEYB 4AJ0A 2EO1A 2E7LC 3MNVB 3UDWC 4NPYB 4PV9B 1NC4D 3VJ6A 5DI8B 5CJQL 5CEXA 1BM3H 1VPOH 1ZLWH 5HHOA 4R4ND 4WDIA 4QCIB 5GRJL 1DEDA 3T04D 3CSYB 4DZ8A 4J3VA 4ZUWA 1S7RA 4OCMC 4PJBF 1P4IL 1FE8L 3QEUA 1HILB 3HMXH 4LKXA 1GPOL 1O5DT 3BIKB 1OT1A 1TJHL 1CN4A 2VC2H 4WY7L 4HS8L 5CBEA 2Q20A 3UTTB 2MPAH 1KFAL 5FUOH 3GB7B 1RZJC 3RWHA 3SO3B 2NXYB 3RL2B 5EFIA 3KXFE 4NKMB 3AS0A 3IFPB 5EOCJ 2CDGB 1HHHA 2X4SB 4MAUH 3G04A 3HE7B 2LE9A 3C5ZC 1CG9A 1FDLH 4JO4L 1LO0H 4M7KL 1IEHA 4N1HB 1GAFL 1ND0A 5T1DL 4ISVB 4HUVB 3D18B 4BZYA 3B9AA 1G0DA 3O3UN 4Y19B 1U8LB 4N5ED 4HDIB 3QRGH 2DQJL 2Z92B 1F2QA 2P5ED 3GHBL 4TOYL 3AXLB 2I5YL 4OIIL 1P2CA 5CWSB 5IF0A 4WW2B 1GGIH 4M02A 3ZE1F 1FZKA 3MBEC 4L8SC 5HJ3A 4PR5B 1KACB 2P8LB 2E9JA 1UACH 4PRNA 2DKMA 2NW3B 1UQSB 2X4UA 4L4VE 3D2UD 2OR9L 4KVCL 5KSAD 4ODWA 3TBVB 4GG6F 4WU5B 3FRPA 3NCJH 4F37K 4J12A 3DETC 5IT2H 4G8FA 2F74A 5E8EA 3GDBA 1HXYB 5EUOA 4BQBA 3W0WD 2PO6B 2R1WA 1DVFD 4BFIA 5F1NA 2VJXA 3EYVB 2GAZA 1E4JA 2QV2A 5GGTL 3MODL 1DDHB 4C59B 2E6QA 1QRND 3QEHB 4K3EL 4Y5VB 2YKLH 3KPOB 3NTCL 1BD2D 3U0WH 4IM8A 4XPAL 3REVB 3DXAA 2XTJD 2GTWA 2PXYB 1GZQB 4QXWA 5J8OA 4A6YH