2M1MA

Solution structure of the psiaa4 oligomerization domain reveals interaction modes for transcription factors in early auxin response
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
HEADVGGIFVKVSMDGAPYLRKIDLRVYGGYSELLKALETMFKLTIGEYSEREGYKGSEYAPTYEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGTEAKGLGCGVGSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Auxin-induced protein IAA4
publication title Solution structure of the PsIAA4 oligomerization domain reveals interaction modes for transcription factors in early auxin response.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Transcription
total genus 21
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2m1mA00
4ANUA 3L10B 1M94A 2D2QA 4MGZE 2M1MA 3ZUNA 3ZNHB 1EUVB 2NPTA 3BY4B 5AZHA 4WWPA 4M0WB 1WX7A 1WXMA 4E71A 4DWFA 4FBJB 3EHVA 5J18A 1C1YB 1UBIA 3ZLZA 1V5OA 3WA0A 3EFUA 4KIKB 4KVGB 1SE9A 2D10A 2AEHA 4AP4C 4W9LA 4ZYNA 2RD0A 1L7YA 4K81A 2HD5B 3H7PB 5JHAA 3ZVVA 2RGFA 1Y8RC 2MQJA 4K7SA 4PYUA 5E6NA 1JRUA 3QX1A 2KMCA 4EKUA 4II2B 4ICUA 4TV3A 1Q1OA 2K39A 4W9HA 1YD8U 4HK2A 1WI0A 3M3JA 4IUMB 3U7DA 2JXXA 1WZ3A 4GU2A 4BBNC 3NY5A 4FADA 1D3ZA 4A3OA 4BOZB 1X1MA 3DBSA 2WX1A 2DX5B 2HJ8A 2N7EA 3QIJA 5D2MB 5E6PA 2PE6B 5FR6A 2D07B 3K9PB 3W1SC 1E8WA 3OJ4B 3L16A 3Q3JA 1S3SG 2VRRB 1WZ0A 2KANA 4GIVA 3HK0A 1Q0WB 2KHWB 3OAWA 1I35A 2FAZA 2JZZA 5KHQA 2KMAA 1E5WA 2L00B 2MA9B 2MWSB 3H9DA 1UELA 2DAFA 1KLVA 1YX6B 2LUEA 1L2NA 2I1KA 3ENEA 3SDLC 3NZSA 3U8ZA 4GXBA 3V62A 3IVFA 2IY1B 4WJOA 2XK5A 3TMPB 2DAJA 1V9JA 2DENB 4MGKE 5IA7A 1G6JA 3VTVA 3KUDB 3ZIMA 4JIOU 4CO7A 5JH5C 4WJPA 2KJ6A 1OGWA 3A9KA 2L7RA 3D32A 2O6VA 2BPSA 4TKNA 5E6OA 5CHVC 2KDIA 3APCA 4K7UA 2XBBC 3PRMB 2JPHA 2MBQA 3CSTA 4XZ4A 4BKGA 5C1ZA 3T9LA 3HM3A 4OVUA 2A4ZA 1WX9A 2IO1B 2CR5A 2L0FA 4KSKC 2GBNA 1VCBA 3C0RB 1P0RA 2KC1A 3PT2B 4DXAB 4FN2A 2KTFA 2CHXA 1WR6E 3PS6A 4II3B 3T8MA 4GDKA 1LM8B 3AU4A 4B6WA 2PJHA 2DZJA 2V4LA 2C7NB 4A3PA 2DZMA 2DZKA 3DVGX 2ZPNA 1V49A 2LVQA 4IW0A 4DK5A 2B3AA 4KV2A 2AL3A 1WMHA 3AULA 1YX5B 2FCMA 2NBVB 4W9CA 2KFKA 4ZDVA 2RPQA 2KDEB 4WWNA 4TQ1A 2XK5B 3A1QA 3A9JB 3M95A 2K6QA 2ZNVB 1WGRA 3A9KB 5G2NA 3RCZA 2K25A 3SU8X 2O6VD 2O6VB 4W9JA 1T0YA 2N1WA 1E8YA 4K1RB 3KYDD 2KN5A 2BF8B 2JRHA 3ONSA 4GSWA 3ZTCA 4F7ZA 3VFKA 1BT0A 2ZZPB 2J0JA 1E7UA 3RZFA 4EOYA 1OEYA 1YIWA 2PE9A 3WAMA 2D3GA 2WX0A 2KJRA 2C5LC 5DPWA 4MEMA 4W9IA 4AUQC 4DDID 3X23A 2FCQA 2AWTA 3JSVA 4GDKB 4MDKE 3DVNU 3KW5B 4PYZA 3WANA 1GC7A 4ANWA 5BO4B 3VUYA 2EKEC 3I3TB 4RMAA 1MG8A 4IM0A 4JQWC 2ASQA 1R4MI 1WRDB 1EO6A 1WIAA 4LDTD 3H1UA 4LDTB 4KZCA 5CHWA 3VUWA 4N9F4 1OQYA 1WMHB 1WX8A 2I1JA 4OVVA 3S2AA 3W1YA 1V86A 3IHPC 1WGGA 3UF8A 3VVWB 2HTHA 5AEKB 3ZO5B 3H6NA 4ZRJA 2KFKB 4EZLA 3U30A 2ZCBA 4PS8A 4HCNB 3VH4B 3M63B 1ZW7A 1VD2A 3QC8B 4MGIE 2IO2B 5CTRC 2LGDA 4DBGA 3UIOB 3DVNV 4IWQA 3R7RA 4BBNF 1HE8A 1NBFC 4HDOA 4FULA 2MCNB 1UH6A 3CF6E 4KDLB 2O2VB 3DCGA 2DYOA 1XT9B 3V61A 5JZEB 2KQ7A 2MBHA 2N9XA 5LLIA 4W9FA 1E90A 2EMTA 4EEWA 2KZRA 4WWOA 1Z2MA 4AJYB 4GOCA 4EFOA 1ISNA 1LXDA 1V81A 3H7SA 3ALBA 3NOBA 4URKA 5L95C 1F9JA 1H8CA 3UINB 2KTRA 3JSVB 4JGHB 4JL9A 2N9EB 3PPAA 2IO3B 2R2OA 3KUZA 3N32A 2NBUA 2G3QB 2G45B 4K7WA 2Z0EB 2KC2A 5D7GA 2V3SA 1GG3A 2RSUA 1GNUA 2LXCA 4GGQA 3ZNID 2IYDB 2MSED 2KFJA 3TIXA 1RLFA 2KJHB 3JVZX 2RR9A 3TL5A 2NPTB 1WF9A 1Z5SB 2A5UA 4NQLB 1LQBA 1TTNA 3L08A 2AYOB 3BINA 2JT4B 2J7QB 4HPMB 2LASA 4WJQA 4AJWA 3DDCB 4GDLA 3MTNB 2DHZA 1FXTB 4FLHA 4A20A 4RM9A 4FHKA 3VAWA 2C60A 2JWZA 3AXCA 3A33B 3R3MA 4NQKE 5CX3A 5KHOA 2L05A 2MLBA 2KOXA 2OOBB 3MJWA 4ICVA 4HPLB 1TZ1A 2JUOA 4J6IA 3QHTA 1R4NI 2BKRB 2GOWA 3LDZE 4DHZE 1UBQA 3VH3B 3APFA 2LJ5A 4GB9A 2K8CA 5DPRA 2MX2A 2KTRB 2KD0A 5D94A 4NPNA 3WALA 3VTWA 2D11A 5EDSA 2ZPYA 2MW5A 2KDBA 2NVUI 1E8XA 3GZNI 2BKFA 2LI5A 3L54A 3SHQA 2DYMA 3VTUA 2NR2A 2LGYA 1PQSA 2FCNA 2KVRA 2M8SA 2ZNVC 2ZVOA 1GC6A 2JRIB 4EZJA 1H4RA 3KH0A 2KO3A 4ANXA 2KLGA 4RM8A 4MJSA 3IG3A 3ZKJC 4CHKA 4IWPA 3PLUA 4GDLB 4HXDA 4FA6A 3ECIA 4BKSA 4WJNA 1UGMA 4BVUC 4KZ0A 3ZNGC 2QHOA 1IP9A 1YJ1A 2KDFB 2MBBB 2N4FA 2V1YA 4NJ7A 2BWFA 1EF5A 2EMSA 4TQ0A 2Y5BB 3VXWA 1RFAA 3PV1A 2LWPA 4AWJA 1J19A 1SGHA 3UQBA 2M4NA 3WIMA 2BYEA 3RULA 1KM7A 2CS4A 2UWQA 2J0KA 2YVCA 3UGBB 2KLCA 1WJNA 4LJOB 1V5TA 2L8JA 3QA8A 4MSQB 4WAAA 1TGZB 1GUAB 3UIPB 3CMMB 1K8RB 3QARA 2PPHA 3MHSD 4FHJA 2CU1A 3KYCD 2REXA 4M8NA 4W9EA 2FIFA 2MBEA 5GMVA 3TBLD 2KQSA 4KSLC 4IM3A 5DPTA 2UYZB 3RYTA 2L3ZA 3ZTDA 4KIKA 4MJSB 5J17A 2K1FA 3NZUA 4GMVA 2CKHB 4I6LB 1P3QU 3Q3FA 3LJ3A 2NBWB 1AARA 1IYFA 1E8ZA 4GN1A 1GJZA 4BKSD 2KNBA 2FIDA 2M0XA 2WYQA 1UZXB 3A1QB 4G3XB 2GBMA 3B08A 1WJ6A 2KX0A 2GBRA 2KKCA 3A4RA 2KX3A 1NI2A 1OTRB 3P2BA 3QCAA 2LXAA 2IZVB 2WWZA 2BYVE 3AI5A 1QZEA 2GBKA 3NHEB 4XX5A 3RT3B 4IG7B 3WAPA 1WYWB 1I42A 3B1LX 3L0WB 3PZDA 3TJPA 2LRUA 4ZRKA 2DYBA 1WXAA 2KWVB 3ZW3A 2CHZA 3OJ3A 2GBJA 5LXHA 4DHJD 4DHJB 2ZEQA 5CHFA 4G50A 2KWUB 3ZRFA 4I6PA 4F1SA 1CMXB 2C7HA 4G11A 2OJRA 4ZRIA 1P1AA 1WM3A 3APDA 3DVGY 3O65B 3W1SA 1WE6A 5DPSA 3ML8A 4ASWC 4I6NB 2GMIC 2K8HA 1ZGUB 4FJYA 2Z59B 3RUIB 2KWCA 5LXIB 2IO0B 4PS7A 2BYFA 1U4AA 2ZVNA 4MSMB 1WGHA 4HLEA 1RRBA 2PEAA 2WDTB 3HM6X 1C3TA 3DBRI 4MGYE 3DQVA 1XQQA 2FUHB 3GOEA 3ML9A 4MM3A 4BKTA 4P7IA 2KXJA 3QK0A 3R7QA 3PHXB 3DBHI 3V6EB 3L17A 3HHMA 4FJZA 1Q5WB 2G4SA 2NS5A 3CSFA 4PS3A 4E74A 3ZRCA 3JW0X 5DCNA 1XD3B 5AZGA 3PTFC 1WE7A 5L83A 3ZDMC 3PRPB 5TR5A 4IC7B 2LVOA 3OLMD 2DZIA 2LVPA 2CHWA 3EECA 4FJVB 2ZCCA 3KUCB 3ZNZB 4MELA 5HKHA 3A4SC 4DHZB 2YLMA 1J8CA 4W9KA 3WAOA 3TCAA 1IPGA 2BGFA 3QWZB 5J2RA 4KDIC 3EC8A 4BFRA 3A9JA 3JYUA 4DDGD 4F8CB 4W9DA 2J0MA 3QQ8B 2G4DB 2Z0DB 1J0GA 1OEYJ 1WJ4A 2JF5A 3R66C 3VDZA 1TBEA 4HCPB 2IY0B 1WM2A 1P9DU 3DBLI 2LZ6A 4NY0A 1LFDA 2NCNA 2K8BA 2IBIB 5AZFA 4JLCA 3QAQA 1EF1A 2N9PC 3PSEB 2K6DB 4B9KA 4HJKA 1V2YA 3HIZA 2MP2A 2ZJDA 4M8MA 4X57B 4HVBA 2JZ3B 3N30A 2R2QA 1P98A 1WY8A 5G55A 2N7DA 4HDQA 1WH3A 2KK8A 3RD2A 4NAWA 1WFYA 1V6EA 3SD5A 4XC2A 5C23A 2JVCA 2L0TA 4E3CA 3PLVA 1KOTA 4EUTA 5IAAC 3V6CB 4G0NB 1WJUA 4AOFA 4BOSC 3PGEA 3DOWA 3L13A 4MH0E 2XEWA 1WGDA 3PHWB 3PRZA 1V80A 3QJZA 1NDDA 3N3KB 2LRWA 1WR1A 4YL8A 4B95A 3NS8A 1A5RA 1S1QB 2M17A 2O2VA 3VQIA 1YQBA 2AL6A 1KJTA 4W9GA 2C7MB 3IFWB 2N1VA 3H7PA 4IWOA 3B0AA 4LJPB 4NJ6A 3X0WA 1E7VA 2MBOA 1WXVA 3ZDTA 1UD7A 2L76A 4CYEA 3VHTC 1WXSA 4WQOB 1WGYA 3VUXA 4HWIB 4EZKA 2JY6A 4NNJB 4ANVA 2MP2B 4LCDE 2LGXA 3V60A 3KVFB 2HE7A 5D6JB 2FNJB 2LD9A 2C9WB 3IBEA 5JHBA 3UQAA 3RZWC 3K9OB 1RAXA 3AU5A 2BWES 3M62B 3PVLA 2MRPA 1ZKHA 3DPDA 2FCSA 4NAWB 4IM2A 4TUUA 1SIFA 2W9NA 3PREA
chains in the Genus database with same CATH superfamily
3L10B 4MGZE 3ZUNA 3ZNHB 1I7HA 1F1HA 3RNFC 1F2RI 4M0WB 4RNAA 2AQ3B 1V5OA 4KIKB 4KVGB 2AEHA 4AP4C 2D5GA 2BW2A 2RGFA 4EKUA 1ZXIA 3VR8B 2QC8A 3AV8A 4TV3A 1CJEA 4W9HA 1WI0A 3U7DA 1WZ3A 1D3ZA 3EUB2 2N7EA 5D2MB 1OFFA 3W1SC 3OJ4B 1I4GA 1J7BA 3NRZA 2KANA 1Q0WB 3Q14C 2PKOA 3OAWA 1I35A 2JZZA 1TJEA 4BAXA 3N20C 2KMAA 2MA9B 2ON8A 4XDDA 2DAFA 1KLVA 3TEXA 4NJCA 3ENEA 3P4SB 3SDLC 3U8ZA 4P1BC 4MGKE 4WJPA 1F52A 1ZOYB 2KJ6A 5FR3A 3D32A 2BPSA 3APCA 3PRMB 1GB4A 4XZ4A 4BKGA 4JPSA 3T9LA 1WWTA 4LNNA 4OVUA 1WX9A 3BZDB 4B0EA 1YMHE 3PS6A 4II3B 1LM8B 1EWYC 3SFEB 2WDQB 3URYA 3RFZB 4WIPA 3E9SA 1V49A 2LVQA 1VJKA 1RFKA 2NBVB 2GLSA 4W9CA 3OG5A 4WWNA 5BYSA 3A1QA 1C4PA 3A9JB 2K6QA 2ZNVB 4YXDB 1WGRA 2WXLA 5G2NA 4OW0A 2JSVX 1T0YA 3KYDD 4WH4A 3VR9B 1E7UA 4N59A 3WAMA 1TS2A 4UDUC 2INNE 2WX0A 1FO4A 3L4PA 3P4RB 4AUQC 4DDID 3X23A 2FCQA 4C4VA 3JSVA 4MDKE 3KW5B 1GC7A 5BO4B 1MG8A 1EO6A 3VUWA 1WX8A 1B9RA 2D3CA 3DHHC 2HTHA 3ZO5B 3H6NA 1PGXA 4HCNB 1VD2A 4MGIE 4XWTA 4DBGA 3DVNV 4BBNF 3C8YA 1NBFC 1QOGA 4KDLB 2O2VB 3DCGA 3V61A 2N0SB 2INCC 3U52E 4W9FA 2EMTA 2KZRA 4WWOA 5FKAC 1JW9D 1SXTA 3RNEC 3H7SA 3ALBA 4URKA 5L95C 2QSDA 3UINB 1SEBD 4C4VB 3JSVB 1QLBB 3N1ZC 2DWQA 3PPAA 5MPOA 5FK9C 4LNFA 1C76A 2IO3B 3AE1B 3KUZA 2DLBA 2NBUA 3Q69A 4A90A 3BWUD 4DQOC 2RSUA 2IYDB 2KFJA 2BVCA 1RLFA 5JXVA 3TL5A 1WYGA 1TTNA 1K50A 2J7QB 4HPMB 2BB5A 4AJWA 1F2RC 4KGSA 3VAWA 2JWZA 3AXCA 5CX3A 2KOXA 3W2DA 4HPLB 2JUOA 3QHTA 3W9CB 1TKEA 3LDZE 1PGAA 4GB9A 1YOVB 3ETRA 1IUEA 2L1AA 3W5VB 1HA5A 1TIFA 3I9V1 3BK2A 3SHQA 2LI5A 2NR2A 2LGYA 1QILA 2ZNVC 2EELA 4PT5A 4N6EB 3ZQ4A 3N1XC 4EZJA 3IG3A 1DOIA 1L4DB 1T3QA 4ZOHC 1UGMA 4KZ0A 2MBBB 2BWFA 2Y5BB 1RFAA 3PV1A 2LWPA 4AWJA 1J19A 1FRDA 2M4NA 2J0KA 3UGBB 4LJOB 1TGZB 1GUAB 4K3BA 1FFVA 2WXFA 2REXA 4W9EA 1GB1A 2IGDA 2KQSA 4L2YA 1ZP0B 3AE3B 3IT6B 5J17A 3NZUA 3TEZA 1AYFA 1E8ZA 1GJZA 1SF0A 4HKZE 2ZW0A 4P16A 2WYQA 4FXCA 3N1YC 3ZXRA 3QCAA 1FNWA 2BYVE 1QZEA 4XX5A 4IG7B 2G1EA 4ZRPA 3L0WB 3PZDA 2DYBA 1EM7A 4DHJD 1VZ6A 4KKIA 1P7FA 3GE8C 2C7HA 2OJRA 3ZYYX 2NMQA 2XNAC 3Q6BA 2GMIC 4YWGG 2KWCA 4PS7A 4P1CC 1WGHA 1RRBA 1JWUD 1C3TA 3DBRI 2VZKD 2FUHB 4RH6A 4P7IA 1SE4A 4RGMA 1UUPA 4PS3A 3ZRCA 5DCNA 1OQQA 5L83A 2BS3B 2WXIA 5TR5A 3OLMD 1SSNA 2DZIA 4S0RA 2V4IB 2LVPA 2CHWA 1VZ8A 2FUG1 1K53A 2ZCCA 3KUCB 3ZNZB 1A70A 1PFDA 1L0VB 3BYTB 2JWUA 3RNCC 4O1NA 3TCAA 5BYRA 1IPGA 2INDC 3TEWA 3J9CA 1FFUA 2WDRB 4XDCA 1J0GA 2JF5A 1TBEA 1L6VA 2IY0B 1WM2A 3BIID 4HRSA 3DBLI 4NY0A 2K8BA 3QAQA 3PSEB 1GOZA 4HJKA 5HG2A 3BK1A 3HIZA 4X57B 5C3JB 5G55A 1DOYA 4GLSC 2KK8A 4NAWA 2MH7A 1V6EA 4XC2A 2L0TA 3V05A 2E3TA 2X38A 4BOSC 4MH0E 1WGDA 1V80A 1R4NB 2LRWA 1N63A 2VH1A 1FIQA 2QDFA 3X0WA 1E7VA 2MBOA 1WXVA 4OZCA 2HJ1A 1TKYA 1WXSA 1WGYA 5IN7A 4HWIB 4EZKA 4LCDE 2LGXA 1LGRA 3KVFB 2HE7A 2L52A 3K9OB 4RGOS 3PVLA 2I38A 3DPDA 1E0ZA 1ZDXA 4IM2A 4NAWB 1SIFA 3DBLB 3BY4B 5AZHA 1MFWA 4WWPA 1WXMA 4E71A 5J18A 3N9YC 2FE8A 1UBIA 1L0YB 3ZLZA 1PDXA 3EFUA 2D10A 1Q10A 1C78A 2RD0A 1L7YA 4K81A 3P1MA 1Y8RC 2MQJA 4PYUA 3BVZA 1XXGA 2Y3AA 4ICUA 4JX1C 1Q1OA 2K39A 2WXQA 2CU3A 2WXMA 4HK2A 4YSXB 2JXXA 2PLPA 4BBNC 5HI1A 2WXJA 4BOZB 3DBSA 2WX1A 2DX5B 3NVWA 5E6PA 3CIRB 1JMLA 2RDBC 3Q3JA 1YJIA 4AS1A 1LO5D 2FAZA 1E5WA 2MWSB 3BVGA 3H9DA 1SIJA 1XLNA 1L2NA 1J7AA 2I1KA 4GXBA 3W5UB 3RNBC 4M02A 5IA7A 1V9JA 2Q5WD 1G6JA 1SB3C 4JIOU 1OGWA 1C4CA 3ZJTA 2OHFA 2O6VA 5CHVC 4A8XC 2XBBC 2JPHA 2MBQA 5C1ZA 3HUIA 3HM3A 2IO1B 2CR5A 2GBNA 1P0RA 2KC1A 3PT2B 5H92C 4FN2A 3MC0B 1NYQA 2V4LA 3DVGX 2ZPNA 4ZHPA 1WMHA 1YX5B 2LJIA 4XWWA 1MVKA 1HZ6A 1K51A 4NZLB 5HFYA 2KDEB 3M95A 3RCZA 2WXOA 3SU8X 2O6VB 4W9JA 4K1RB 2KN5A 3ONSA 3P42A 4GSWA 2J0JA 4N58A 3RZFA 3DWMA 3RMKC 5DPWA 4MEMA 2LFIA 1IGCA 3WANA 3DVNU 3VUYA 3I3TB 3GP7A 4RMAA 4IM0A 2ASQA 1WIAA 5CHWA 4LDTB 4N9F4 1WMHB 2I1JA 3VVWB 4WAFA 3U30A 1MI0A 3M63B 1ZW7A 1QKZA 3R7RA 1HE8A 4FULA 1UH6A 2EKIA 3CF6E 5JZEB 1FNVA 3P4PB 2Z8LA 1T0SC 4GOCA 1TT5B 1ISNA 1C9FA 1H8CA 2V9HA 2BT6A 4JL9A 1YQ3B 2R2OA 2G3QB 2G45B 4XYCA 2Z0EB 3ABVB 2LXCA 4GGQA 2TSSA 2WXHA 1FXIA 1Z5SB 4NQLB 1LQBA 3EFCA 3L08A 2AYOB 2W54A 4GDLA 3MTNB 2RMMA 4A20A 1MPEA 4K3CA 3R3MA 1FXAA 3MJWA 4ICVA 2OOBB 4MT5A 4J6IA 2GOWA 2LHDA 2MX2A 4ZRQA 2KD0A 3AE4B 5D94A 4OZAA 3VTWA 1NYRA 1N61A 2DBYA 2D11A 5EDSA 1KLUD 2MW5A 3L54A 2KDBA 1E8XA 2DYMA 2KVRA 2M8SA 3AECB 1GC6A 1VDVA 2JRIB 1D6EC 4LK0M 2HDEA 2KLGA 3PO0A 3ZKJC 5EE9A 4CHKA 4GDLB 4BKSA 4WJNA 4BVUC 1IP9A 1IGDA 3ZNGC 2KDFB 2N4FA 2V1YA 1EF5A 2EMSA 2KAJA 2SEBD 3U7ZA 4M00A 4TQ0A 2IJ0A 1CQVA 3WIMA 2BYEA 1KM7A 2KDMA 1FMAD 2KLCA 2WXGA 1ET6A 3QA8A 3UIPB 2BB6A 1K8RB 3QARA 2PPHA 3MHSD 1JQ4A 2CU1A 4C7YA 3DHIC 2MBEA 2K9XA 2K0PA 1TKGA 5DPTA 2G9HD 2WU2B 2UYZB 4R3DA 4KGTA 2K1FA 4GMVA 2CKHB 1P3QU 2KNBA 1UZXB 2HTME 3A1QB 4G3XB 2QMTA 2GBRA 4HKQA 3I63C 1JWAD 2Y5PA 1ET9A 1ROEA 1V97A 2D3AA 2IZVB 1VRAB 4ITKA 3RT3B 3NHEB 3WAPA 1WYWB 3AEBB 3B1LX 4ZRKA 2NTSA 1TZOA 5AUKA 3OJ3A 2ZEQA 4G50A 2CJNA 2QJLA 4F1SA 1ESFA 4G11A 4ZRIA 1WM3A 3ML8A 4I6NB 1CZPA 4FJYA 3RUIB 1U4AA 4MSMB 1GAQB 4YT0B 1IBXA 4MM3A 3GOEA 1FCLA 1PGBA 2KXJA 3QK0A 3PHXB 3RNAC 1ZDVA 4E74A 1STEA 3PRPB 4IC7B 4M01A 3AE8B 2RDGA 1XLQA 4DXFA 3I5JC 4MELA 1J8CA 3UI3A 5J2RA 1N6ZA 3QWZB 1E6EB 4DDGD 1XO3A 4W9DA 4F8CB 2G4DB 2LHEA 4NAMA 1IBXB 4MM3B 2PMVA 1B1ZA 4YSZB 1EF1A 2K6DB 3KLSX 2N7JA 3R8BA 2MP2A 4TMAB 3IAM1 2JZ3B 1P98A 1WY8A 1L5PA 4HDQA 1WH3A 3NVVA 1D4BA 1WFYA 4JWSC 2OEDA 1KOTA 5IAAC 5IO9A 3V6CB 4G0NB 4JE3B 1WJUA 5D3DA 4YTPB 1FCCC 3PHWB 3PRZA 3QJZA 4LLGM 3AE2B 4B95A 2ONQA 4W9GA 3IXSA 4KX6B 3ZDTA 2YEPF 4S17A 1UD7A 2B76B 3VHTC 4WWMA 4NNJB 2MP2B 2N9LA 5GXGB 5D6JB 3IBEA 3UQAA 1RAXA 2WXKA 3AU5A 3GS2A 1ZKHA 3KQ4A 4L1BA 3TUOA 2M1MA 1EUVB 2NPTA 1RWSA 1UGJA 1WX7A 1FPYA 4DWFA 4FBJB 1FM0D 3MFGA 4OZBA 4ZYNA 1QT9A 2PVOD 5JHAA 4QAYA 2DNFA 5E6NA 3QX1A 2FBWB 1VR9A 4IUMB 4GU2A 3NY5A 4A3OA 1X1MA 2HJ8A 2PE6B 2D07B 3ZJUA 1E8WA 1S3SG 4GIVA 4HEA1 1UELA 1YX6B 2WXPA 1T5XD 3Q8AA 3NZSA 2JYTA 3V62A 2XK5A 3VTVA 1FD6A 2K5PA 3AM9A 2L7RA 4TKNA 5E6OA 1F77A 1CK1A 4K7UA 1QOAA 2IGHA 1RYJA 4HROA 2A4ZA 2L0FA 2SAKA 4KSKC 1T0RC 3C0RB 4RF0A 4DXAB 2CHXA 1WR6E 4P6VF 3T8MA 4GDKA 3LXFA 4B6WA 2PJHA 3AB5A 4A3PA 2DZMA 1KTKA 4C7ZA 4IW0A 4KV2A 2AL3A 2FCMA 3DBRB 3DHGC 3AEEB 4ZDVA 2BBCA 2RPQA 4TQ1A 2XK5B 1BMLC 2QILA 2WXRA 2K25A 2O6VD 3ZTCA 1E8YA 4F7ZA 2BF8B 2JRHA 4KKJA 3FILA 3VFKA 1NVID 2LUMA 4EOYA 1JROA 1C4AA 4LNIA 2KJRA 1JWSD 2C5LC 1SE2A 4YTNB 2AX5A 2WQYB 2AWTA 3Q8EA 4WQMA 4GDKB 5BYQA 4PYZA 4ANWA 2EKEC 1WXQA 2CJOA 4JQWC 1WRDB 4LDTD 4OVZA 4KZCA 1ZPSA 1OQYA 3O13A 2K22A 4OVVA 3IHPC 3UF8A 4ZRJA 2OJWA 4US9A 4EZLA 2ZCBA 3QC8B 2IO2B 5CTRC 3UIOB 1YNTE 4HDOA 2MCNB 3P4QB 1GPXA 3FILB 2KQ7A 1TS4A 4EEWA 1Z2MA 4RFBA 4EFOA 3IT4B 3HVZA 1EU4A 3SR6A 3AN1A 5HHDG 3GE3C 2KTRA 3FAHA 1EWCA 2JU6X 3N32A 3C19A 4K7WA 1WGKA 2WXNA 2KC2A 1YN5A 2V3SA 3MJ5A 1GNUA 2N9KA 2YEPB 1N5WA 3JVZX 2RR9A 4DXGA 2JT4B 4WJQA 3DDCB 4FLHA 1FXTB 3LB8C 2C60A 3A33B 3SEBA 1TS3A 4EE2A 3OWEB 3FKYA 4WURA 1TZ1A 1MHHE 2BKRB 2IDYA 1UBQA 3APFA 2LJ5A 3Q8FA 3IAS1 2KTRB 1DYQA 4NPNA 1YN3A 1TYGB 2X8XX 3TSSA 2ZPYA 2LEKA 2NVUI 3GZNI 1ENFA 3ZGZA 1PQSA 2FCNA 2ZVOA 1C79A 1L4ZB 1H4RA 2KO3A 2PW9A 4MJSA 4RM8A 1DGJA 4IWPA 3PLUA 4HXDA 4FA6A 3ECIA 2QHOA 3AEFB 1YJ1A 2ZW1A 4NJ7A 3AH7A 1SGHA 3PZ7A 2JZPA 3VRAB 3RULA 1QOFA 4HPPA 2YVCA 1WJNA 1T6BX 1V5TA 2L8JA 4WAAA 4MSQB 2QCZA 1XF5L 3KYCD 4M8NA 1ACCA 1MJDA 1J7CA 2FIFA 3TBLD 3AE9B 4J3OD 4KSLC 2V3PA 3ZTDA 4KIKA 4MJSB 3VRBB 4I6LB 2Y5CA 3Q3FA 1IYFA 4GN1A 4BKSD 2H88B 1YN4A 1XCTL 3KWLA 1WJ6A 2KX0A 3A4RA 1NI2A 1OTRB 2J53A 3AI5A 4ARCA 1NI3A 1I42A 3TJPA 3ZW3A 2CHZA 2KWUB 1D5XC 1CMXB 2KT7A 2VH2A 1SBBB 3DVGY 3O65B 1WE6A 4C80A 5D3IB 5G5HA 1ZGUB 5LXIB 5AUIA 4HLEA 2WDTB 1OQRA 2QEJC 1DOXA 1XEEA 3R7QA 3V6EB 3HHMA 1L6UA 5H8YE 1Q5WB 2G4SA 1P7EA 3CSFA 3BYYB 3RNGC 4RGTA 5AZGA 3PTFC 3ZDMC 3NG0A 2J52A 2KN4A 5HKHA 4Q2JA 3A4SC 3WAOA 4H2AA 3Q3OC 4D2KA 4BFRA 3A9JA 4RF1A 4REZA 2J0MA 3RN9C 1K52A 3AE5B 3AE6B 5T8IA 1FEHA 1OEYJ 1WJ4A 2L32A 5EE0A 3R66C 2ACZB 1MG4A 3VDZA 1P9DU 1AWDA 5AZFA 1LFDA 2NCNA 2IBIB 4JLCA 2N9PC 4USAA 4B9KA 2M0AA 1V2YA 1I4HA 3N30A 2R2QA 1I4PA 2N7DA 1XLPA 4YSYB 3GB1A 3RD2A 1E10A 3SD5A 1I4XA 5C23A 2JVCA 4E3CA 4EUTA 1HTOA 3V3XA 4AOFA 4L23A 2WDVB 3PGEA 4A9AA 3ZJVA 1UWXA 1JWBD 3NS8A 3P63A 4RGNA 3R2TA 1S1QB 2M17A 1E9MA 2NTTA 2O2VA 1YQBA 2AL6A 1KJTA 2C7MB 3H7PA 4LJPB 3B0AA 4IKGA 4NJ6A 4B0MA 3PZ8A 4CYEA 2WS3B 4MACA 4ANVA 3V60A 2JYEA 5BMHA 2KWDA 1UWMA 4LNKA 2LD9A 2C9WB 5JHBA 2RPVA 3AEDB 2PIAA 2FCSA 1HEZE 2GI9A 2W9NA 1KF6B 4PK1A 4ANUA 1M94A 2D2QA 2J42A 5EE3A 3B2FA 3EHVA 1C1YB 3AE7B 1SE3A 3WA0A 2LGSA 1SJHD 1SE9A 1MHXA 1V8CA 1NENB 3NUHB 4W9LA 2GRIA 5TSSA 1I4QA 2HD5B 3H7PB 3ZVVA 4K7SA 1JRUA 1WRIA 2KMCA 4KGRA 4II2B 1YD8U 1QOBA 3M3JA 2W82A 4FADA 5FR6A 3QIJA 2RDHA 3K9PB 3E56A 3L16A 2AQ1B 2MJ3A 1WZ0A 2VRRB 4LTUA 3HK0A 2XN9C 2KHWB 5KHQA 2L00B 1UF0A 3RI7C 2MJDA 2LUEA 3IVFA 2IY1B 4WJOA 1QF6A 3TMPB 2DAJA 2DENB 3KUDB 1R7SA 3ZIMA 4CO7A 3MHZA 3EGRA 5JH5C 3A9KA 1JWMD 2KDIA 3CSTA 2KACA 5BMIA 1VCBA 2KVZA 2KTFA 1HXYD 1WSPA 3AU4A 1F0ZA 2DZJA 3T3OA 2C7NB 3H8HA 2DZKA 4MH8A 4A6QA 3NJTA 3AMZA 4DK5A 1SJED 2B3AA 3AULA 3B2GA 2KFKA 1HZ5A 2KQ4X 3Q2AC 1YQ4B 2H89B 1VZ7A 3A9KB 2N1WA 5IP4D 1BT0A 2ZZPB 2WLBA 2W55A 2WU5B 1OEYA 1YIWA 2PE9A 3HVDA 3AEAB 2D3GA 4W9IA 3BVMA 3NS1A 1R4MI 2E6XA 3FC4A 3H1UA 3Q3MC 3S2AA 3W1YA 1V86A 1WGGA 5AEKB 2IGGA 3MC8A 3R2IA 2KFKB 3U4EG 4PS8A 3VH4B 2V3NA 2LGDA 4IWQA 1QQRA 4LNOA 2MJEA 1T0QC 2D3BA 2DYOA 1XT9B 5C2TB 1FRRA 4ACFA 2MBHA 2N9XA 1NEKB 5LLIA 1E90A 1TS5A 4AJYB 3NVZA 5EE1A 1LXDA 1V81A 2PTLA 1D5ZC 3NOBA 1F9JA 4JGHB 2N9EB 2WP9B 4JWUC 5E6JA 5D7GA 1GG3A 3LYYA 3ZNID 2MSED 3TIXA 2KJHB 2BS4B 1C77A 2NPTB 1WF9A 2A5UA 3B9JA 3BINA 1ZUD2 2LASA 1BXTA 2DHZA 3WCQA 1KLGD 4RM9A 4FHKA 2INPE 1TY0A 3MP9A 5KHOA 4NQKE 1XLOA 2L05A 1R4MB 2MLBA 4ARIA 1R4NI 4DHZE 3VH3B 2K8CA 5DPRA 2IPKD 3AEGB 3WALA 2BKFA 5BMGA 3VTUA 1RM6C 1JALA 3DWGC 1N62A 1EU3A 3KH0A 4ANXA 2MHJA 3VXWA 3U2SC 1V1PA 4ZHOA 2K3UA 3UQBA 4CQNA 4YTMB 2CS4A 4RCOA 4TSSA 2UWQA 4US8A 3KWVA 1ZXHA 2PVGC 3CMMB 4A55A 5LNK1 4FHJA 1TY2A 4IDIA 1N5XA 2M56B 5GMVA 2KYWA 4IM3A 1V1OA 1I4RA 3RYTA 2L3ZA 3MC9A 5I4DA 3LJ3A 2NBWB 1AARA 2JXTA 3NVYA 2V0GA 3CWIA 2FIDA 2M0XA 1AW7A 2BQQA 4ZYSA 4C56C 2GBMA 1V1PB 3B08A 1HTQA 2KKCA 2KX3A 3P2BA 2L83A 2LXAA 2WWZA 4C00A 2UU7A 2KMMA 2GBKA 2W3SA 1JRPA 2LRUA 2LGIA 1WXAA 2KWVB 3Q8BA 1KH0A 2GBJA 5LXHA 2WGSA 4XGAB 4DHJB 5CHFA 3ZRFA 4I6PA 1D5MC 5IKCM 1P1AA 3APDA 1E7PB 3W1SA 5DPSA 4ASWC 2K8HA 2Z59B 1AN8A 2JQRB 2IO0B 2BYFA 2ZVNA 1YJJA 2PEAA 3HM6X 4MGYE 3DQVA 1KRHA 1XQQA 2VZKB 3ML9A 4BKTA 2BYTA 1ZE3D 3DBHI 3L17A 4BZAA 2MEKA 4FJZA 2NS5A 1BUIC 2ICIA 3JW0X 3I57A 3SFDB 1XD3B 1FNUA 1WE7A 3T3NA 2LVOA 1L0XB 3EECA 4FJVB 1HQRD 5IOIA 4DHZB 2YLMA 4W9KA 4XE0A 3TEYA 2BGFA 2W3RA 4KDIC 3EC8A 2WNMA 1JCKB 4OHJA 3JYUA 1XCQL 3QQ8B 3EA6A 2BS2B 2M19A 2Z0DB 4HCPB 4AQ7A 2LZ6A 2J4XA 2JX5A 5G5GA 2ZJDA 2LMCA 4M8MA 4HVBA 3Q3NC 3RPFC 2WHIA 4HJGE 3NZ3A 3PLVA 1KFYB 2GB1A 1M4VA 3HRDD 2AQ2B 2QIEB 3DBHB 3DOWA 4M0WA 2BTEA 3L13A 2XEWA 2R61A 1NDDA 3N3KB 1WR1A 4YL8A 1A5RA 3VQIA 2I2YA 3IFWB 2N1VA 4IWOA 3Q8CA 2L76A 4WQOB 3VUXA 2JY6A 3GZNB 1UNSA 1PYWD 2FNJB 1Y56A 3RZWC 1VLBA 2BWES 3M62B 3ZXVA 4IOIE 1PUTA 2MRPA 4TUUA 1N60A 3PREA
chains in the Genus database with same CATH topology
4ANUA 3L10B 1M94A 2D2QA 4MGZE 2M1MA 3ZUNA 3ZNHB 1EUVB 2NPTA 3BY4B 5AZHA 4WWPA 4M0WB 1WX7A 1WXMA 4E71A 4DWFA 4FBJB 3EHVA 5J18A 1C1YB 1UBIA 3ZLZA 1V5OA 3WA0A 3EFUA 4KIKB 4KVGB 1SE9A 2D10A 2AEHA 4AP4C 4W9LA 4ZYNA 2RD0A 1L7YA 4K81A 2HD5B 3H7PB 5JHAA 3ZVVA 2RGFA 1Y8RC 2MQJA 4K7SA 4PYUA 5E6NA 1JRUA 3QX1A 2KMCA 4EKUA 4II2B 4ICUA 4TV3A 1Q1OA 2K39A 4W9HA 1YD8U 4HK2A 1WI0A 3M3JA 4IUMB 3U7DA 2JXXA 1WZ3A 4GU2A 4BBNC 3NY5A 4FADA 1D3ZA 4A3OA 4BOZB 1X1MA 3DBSA 2WX1A 2DX5B 2HJ8A 2N7EA 3QIJA 5D2MB 5E6PA 2PE6B 5FR6A 2D07B 3K9PB 3W1SC 1E8WA 3OJ4B 3L16A 3Q3JA 1S3SG 2VRRB 1WZ0A 2KANA 4GIVA 3HK0A 1Q0WB 2KHWB 3OAWA 1I35A 2FAZA 2JZZA 5KHQA 2KMAA 1E5WA 2L00B 2MA9B 2MWSB 3H9DA 1UELA 2DAFA 1KLVA 1YX6B 2LUEA 1L2NA 2I1KA 3ENEA 3SDLC 3NZSA 3U8ZA 4GXBA 3V62A 3IVFA 2IY1B 4WJOA 2XK5A 3TMPB 2DAJA 1V9JA 2DENB 4MGKE 5IA7A 1G6JA 3VTVA 3KUDB 3ZIMA 4JIOU 4CO7A 5JH5C 4WJPA 2KJ6A 1OGWA 3A9KA 2L7RA 3D32A 2O6VA 2BPSA 4TKNA 5E6OA 5CHVC 2KDIA 3APCA 4K7UA 2XBBC 3PRMB 2JPHA 2MBQA 3CSTA 4XZ4A 4BKGA 5C1ZA 3T9LA 3HM3A 4OVUA 2A4ZA 1WX9A 2IO1B 2CR5A 2L0FA 4KSKC 2GBNA 1VCBA 3C0RB 1P0RA 2KC1A 3PT2B 4DXAB 4FN2A 2KTFA 2CHXA 1WR6E 3PS6A 4II3B 3T8MA 4GDKA 1LM8B 3AU4A 4B6WA 2PJHA 2DZJA 2V4LA 2C7NB 4A3PA 2DZMA 2DZKA 3DVGX 2ZPNA 1V49A 2LVQA 4IW0A 4DK5A 2B3AA 4KV2A 2AL3A 1WMHA 3AULA 1YX5B 2FCMA 2NBVB 4W9CA 2KFKA 4ZDVA 2RPQA 2KDEB 4WWNA 4TQ1A 2XK5B 3A1QA 3A9JB 3M95A 2K6QA 2ZNVB 1WGRA 3A9KB 5G2NA 3RCZA 2K25A 3SU8X 2O6VD 2O6VB 4W9JA 1T0YA 2N1WA 1E8YA 4K1RB 3KYDD 2KN5A 2BF8B 2JRHA 3ONSA 4GSWA 3ZTCA 4F7ZA 3VFKA 1BT0A 2ZZPB 2J0JA 1E7UA 3RZFA 4EOYA 1OEYA 1YIWA 2PE9A 3WAMA 2D3GA 2WX0A 2KJRA 2C5LC 5DPWA 4MEMA 4W9IA 4AUQC 4DDID 3X23A 2FCQA 2AWTA 3JSVA 4GDKB 4MDKE 3DVNU 3KW5B 4PYZA 3WANA 1GC7A 4ANWA 5BO4B 3VUYA 2EKEC 3I3TB 4RMAA 1MG8A 4IM0A 4JQWC 2ASQA 1R4MI 1WRDB 1EO6A 1WIAA 4LDTD 3H1UA 4LDTB 4KZCA 5CHWA 3VUWA 4N9F4 1OQYA 1WMHB 1WX8A 2I1JA 4OVVA 3S2AA 3W1YA 1V86A 3IHPC 1WGGA 3UF8A 3VVWB 2HTHA 5AEKB 3ZO5B 3H6NA 4ZRJA 2KFKB 4EZLA 3U30A 2ZCBA 4PS8A 4HCNB 3VH4B 3M63B 1ZW7A 1VD2A 3QC8B 4MGIE 2IO2B 5CTRC 2LGDA 4DBGA 3UIOB 3DVNV 4IWQA 3R7RA 4BBNF 1HE8A 1NBFC 4HDOA 4FULA 2MCNB 1UH6A 3CF6E 4KDLB 2O2VB 3DCGA 2DYOA 1XT9B 3V61A 5JZEB 2KQ7A 2MBHA 2N9XA 5LLIA 4W9FA 1E90A 2EMTA 4EEWA 2KZRA 4WWOA 1Z2MA 4AJYB 4GOCA 4EFOA 1ISNA 1LXDA 1V81A 3H7SA 3ALBA 3NOBA 4URKA 5L95C 1F9JA 1H8CA 3UINB 2KTRA 3JSVB 4JGHB 4JL9A 2N9EB 3PPAA 2IO3B 2R2OA 3KUZA 3N32A 2NBUA 2G3QB 2G45B 4K7WA 2Z0EB 2KC2A 5D7GA 2V3SA 1GG3A 2RSUA 1GNUA 2LXCA 4GGQA 3ZNID 2IYDB 2MSED 2KFJA 3TIXA 1RLFA 2KJHB 3JVZX 2RR9A 3TL5A 2NPTB 1WF9A 1Z5SB 2A5UA 4NQLB 1LQBA 1TTNA 3L08A 2AYOB 3BINA 2JT4B 2J7QB 4HPMB 2LASA 4WJQA 4AJWA 3DDCB 4GDLA 3MTNB 2DHZA 1FXTB 4FLHA 4A20A 4RM9A 4FHKA 3VAWA 2C60A 2JWZA 3AXCA 3A33B 3R3MA 4NQKE 5CX3A 5KHOA 2L05A 2MLBA 2KOXA 2OOBB 3MJWA 4ICVA 4HPLB 1TZ1A 2JUOA 4J6IA 3QHTA 1R4NI 2BKRB 2GOWA 3LDZE 4DHZE 1UBQA 3VH3B 3APFA 2LJ5A 4GB9A 2K8CA 5DPRA 2MX2A 2KTRB 2KD0A 5D94A 4NPNA 3WALA 3VTWA 2D11A 5EDSA 2ZPYA 2MW5A 2KDBA 2NVUI 1E8XA 3GZNI 2BKFA 2LI5A 3L54A 3SHQA 2DYMA 3VTUA 2NR2A 2LGYA 1PQSA 2FCNA 2KVRA 2M8SA 2ZNVC 2ZVOA 1GC6A 2JRIB 4EZJA 1H4RA 3KH0A 2KO3A 4ANXA 2KLGA 4RM8A 4MJSA 3IG3A 3ZKJC 4CHKA 4IWPA 3PLUA 4GDLB 4HXDA 4FA6A 3ECIA 4BKSA 4WJNA 1UGMA 4BVUC 4KZ0A 3ZNGC 2QHOA 1IP9A 1YJ1A 2KDFB 2MBBB 2N4FA 2V1YA 4NJ7A 2BWFA 1EF5A 2EMSA 4TQ0A 2Y5BB 3VXWA 1RFAA 3PV1A 2LWPA 4AWJA 1J19A 1SGHA 3UQBA 2M4NA 3WIMA 2BYEA 3RULA 1KM7A 2CS4A 2UWQA 2J0KA 2YVCA 3UGBB 2KLCA 1WJNA 4LJOB 1V5TA 2L8JA 3QA8A 4MSQB 4WAAA 1TGZB 1GUAB 3UIPB 3CMMB 1K8RB 3QARA 2PPHA 3MHSD 4FHJA 2CU1A 3KYCD 2REXA 4M8NA 4W9EA 2FIFA 2MBEA 5GMVA 3TBLD 2KQSA 4KSLC 4IM3A 5DPTA 2UYZB 3RYTA 2L3ZA 3ZTDA 4KIKA 4MJSB 5J17A 2K1FA 3NZUA 4GMVA 2CKHB 4I6LB 1P3QU 3Q3FA 3LJ3A 2NBWB 1AARA 1IYFA 1E8ZA 4GN1A 1GJZA 4BKSD 2KNBA 2FIDA 2M0XA 2WYQA 1UZXB 3A1QB 4G3XB 2GBMA 3B08A 1WJ6A 2KX0A 2GBRA 2KKCA 3A4RA 2KX3A 1NI2A 1OTRB 3P2BA 3QCAA 2LXAA 2IZVB 2WWZA 2BYVE 3AI5A 1QZEA 2GBKA 3NHEB 4XX5A 3RT3B 4IG7B 3WAPA 1WYWB 1I42A 3B1LX 3L0WB 3PZDA 3TJPA 2LRUA 4ZRKA 2DYBA 1WXAA 2KWVB 3ZW3A 2CHZA 3OJ3A 2GBJA 5LXHA 4DHJD 4DHJB 2ZEQA 5CHFA 4G50A 2KWUB 3ZRFA 4I6PA 4F1SA 1CMXB 2C7HA 4G11A 2OJRA 4ZRIA 1P1AA 1WM3A 3APDA 3DVGY 3O65B 3W1SA 1WE6A 5DPSA 3ML8A 4ASWC 4I6NB 2GMIC 2K8HA 1ZGUB 4FJYA 2Z59B 3RUIB 2KWCA 5LXIB 2IO0B 4PS7A 2BYFA 1U4AA 2ZVNA 4MSMB 1WGHA 4HLEA 1RRBA 2PEAA 2WDTB 3HM6X 1C3TA 3DBRI 4MGYE 3DQVA 1XQQA 2FUHB 3GOEA 3ML9A 4MM3A 4BKTA 4P7IA 2KXJA 3QK0A 3R7QA 3PHXB 3DBHI 3V6EB 3L17A 3HHMA 4FJZA 1Q5WB 2G4SA 2NS5A 3CSFA 4PS3A 4E74A 3ZRCA 3JW0X 5DCNA 1XD3B 5AZGA 3PTFC 1WE7A 5L83A 3ZDMC 3PRPB 5TR5A 4IC7B 2LVOA 3OLMD 2DZIA 2LVPA 2CHWA 3EECA 4FJVB 2ZCCA 3KUCB 3ZNZB 4MELA 5HKHA 3A4SC 4DHZB 2YLMA 1J8CA 4W9KA 3WAOA 3TCAA 1IPGA 2BGFA 3QWZB 5J2RA 4KDIC 3EC8A 4BFRA 3A9JA 3JYUA 4DDGD 4F8CB 4W9DA 2J0MA 3QQ8B 2G4DB 2Z0DB 1J0GA 1OEYJ 1WJ4A 2JF5A 3R66C 3VDZA 1TBEA 4HCPB 2IY0B 1WM2A 1P9DU 3DBLI 2LZ6A 4NY0A 1LFDA 2NCNA 2K8BA 2IBIB 5AZFA 4JLCA 3QAQA 1EF1A 2N9PC 3PSEB 2K6DB 4B9KA 4HJKA 1V2YA 3HIZA 2MP2A 2ZJDA 4M8MA 4X57B 4HVBA 2JZ3B 3N30A 2R2QA 1P98A 1WY8A 5G55A 2N7DA 4HDQA 1WH3A 2KK8A 3RD2A 4NAWA 1WFYA 1V6EA 3SD5A 4XC2A 5C23A 2JVCA 2L0TA 4E3CA 3PLVA 1KOTA 4EUTA 5IAAC 3V6CB 4G0NB 1WJUA 4AOFA 4BOSC 3PGEA 3DOWA 3L13A 4MH0E 2XEWA 1WGDA 3PHWB 3PRZA 1V80A 3QJZA 1NDDA 3N3KB 2LRWA 1WR1A 4YL8A 4B95A 3NS8A 1A5RA 1S1QB 2M17A 2O2VA 3VQIA 1YQBA 2AL6A 1KJTA 4W9GA 2C7MB 3IFWB 2N1VA 3H7PA 4IWOA 3B0AA 4LJPB 4NJ6A 3X0WA 1E7VA 2MBOA 1WXVA 3ZDTA 1UD7A 2L76A 4CYEA 3VHTC 1WXSA 4WQOB 1WGYA 3VUXA 4HWIB 4EZKA 2JY6A 4NNJB 4ANVA 2MP2B 4LCDE 2LGXA 3V60A 3KVFB 2HE7A 5D6JB 2FNJB 2LD9A 2C9WB 3IBEA 5JHBA 3UQAA 3RZWC 3K9OB 1RAXA 3AU5A 2BWES 3M62B 3PVLA 2MRPA 1ZKHA 3DPDA 2FCSA 4NAWB 4IM2A 4TUUA 1SIFA 2W9NA 3PREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ANU A;  3L10 B;  1M94 A;  2D2Q A;  4MGZ E;  2M1M A;  3ZUN A;  3ZNH B;  1EUV B;  2NPT A;  3BY4 B;  5AZH A;  4WWP A;  4M0W B;  1WX7 A;  1WXM A;  4E71 A;  4DWF A;  4FBJ B;  3EHV A;  5J18 A;  1C1Y B;  1UBI A;  3ZLZ A;  1V5O A;  3WA0 A;  3EFU A;  4KIK B;  4KVG B;  1SE9 A;  2D10 A;  2AEH A;  4AP4 C;  4W9L A;  4ZYN A;  2RD0 A;  1L7Y A;  4K81 A;  2HD5 B;  3H7P B;  5JHA A;  3ZVV A;  2RGF A;  1Y8R C;  2MQJ A;  4K7S A;  4PYU A;  5E6N A;  1JRU A;  3QX1 A;  2KMC A;  4EKU A;  4II2 B;  4ICU A;  4TV3 A;  1Q1O A;  2K39 A;  4W9H A;  1YD8 U;  4HK2 A;  1WI0 A;  3M3J A;  4IUM B;  3U7D A;  2JXX A;  1WZ3 A;  4GU2 A;  4BBN C;  3NY5 A;  4FAD A;  1D3Z A;  4A3O A;  4BOZ B;  1X1M A;  3DBS A;  2WX1 A;  2DX5 B;  2HJ8 A;  2N7E A;  3QIJ A;  5D2M B;  5E6P A;  2PE6 B;  5FR6 A;  2D07 B;  3K9P B;  3W1S C;  1E8W A;  3OJ4 B;  3L16 A;  3Q3J A;  1S3S G;  2VRR B;  1WZ0 A;  2KAN A;  4GIV A;  3HK0 A;  1Q0W B;  2KHW B;  3OAW A;  1I35 A;  2FAZ A;  2JZZ A;  5KHQ A;  2KMA A;  1E5W A;  2L00 B;  2MA9 B;  2MWS B;  3H9D A;  1UEL A;  2DAF A;  1KLV A;  1YX6 B;  2LUE A;  1L2N A;  2I1K A;  3ENE A;  3SDL C;  3NZS A;  3U8Z A;  4GXB A;  3V62 A;  3IVF A;  2IY1 B;  4WJO A;  2XK5 A;  3TMP B;  2DAJ A;  1V9J A;  2DEN B;  4MGK E;  5IA7 A;  1G6J A;  3VTV A;  3KUD B;  3ZIM A;  4JIO U;  4CO7 A;  5JH5 C;  4WJP A;  2KJ6 A;  1OGW A;  3A9K A;  2L7R A;  3D32 A;  2O6V A;  2BPS A;  4TKN A;  5E6O A;  5CHV C;  2KDI A;  3APC A;  4K7U A;  2XBB C;  3PRM B;  2JPH A;  2MBQ A;  3CST A;  4XZ4 A;  4BKG A;  5C1Z A;  3T9L A;  3HM3 A;  4OVU A;  2A4Z A;  1WX9 A;  2IO1 B;  2CR5 A;  2L0F A;  4KSK C;  2GBN A;  1VCB A;  3C0R B;  1P0R A;  2KC1 A;  3PT2 B;  4DXA B;  4FN2 A;  2KTF A;  2CHX A;  1WR6 E;  3PS6 A;  4II3 B;  3T8M A;  4GDK A;  1LM8 B;  3AU4 A;  4B6W A;  2PJH A;  2DZJ A;  2V4L A;  2C7N B;  4A3P A;  2DZM A;  2DZK A;  3DVG X;  2ZPN A;  1V49 A;  2LVQ A;  4IW0 A;  4DK5 A;  2B3A A;  4KV2 A;  2AL3 A;  1WMH A;  3AUL A;  1YX5 B;  2FCM A;  2NBV B;  4W9C A;  2KFK A;  4ZDV A;  2RPQ A;  2KDE B;  4WWN A;  4TQ1 A;  2XK5 B;  3A1Q A;  3A9J B;  3M95 A;  2K6Q A;  2ZNV B;  1WGR A;  3A9K B;  5G2N A;  3RCZ A;  2K25 A;  3SU8 X;  2O6V D;  2O6V B;  4W9J A;  1T0Y A;  2N1W A;  1E8Y A;  4K1R B;  3KYD D;  2KN5 A;  2BF8 B;  2JRH A;  3ONS A;  4GSW A;  3ZTC A;  4F7Z A;  3VFK A;  1BT0 A;  2ZZP B;  2J0J A;  1E7U A;  3RZF A;  4EOY A;  1OEY A;  1YIW A;  2PE9 A;  3WAM A;  2D3G A;  2WX0 A;  2KJR A;  2C5L C;  5DPW A;  4MEM A;  4W9I A;  4AUQ C;  4DDI D;  3X23 A;  2FCQ A;  2AWT A;  3JSV A;  4GDK B;  4MDK E;  3DVN U;  3KW5 B;  4PYZ A;  3WAN A;  1GC7 A;  4ANW A;  5BO4 B;  3VUY A;  2EKE C;  3I3T B;  4RMA A;  1MG8 A;  4IM0 A;  4JQW C;  2ASQ A;  1R4M I;  1WRD B;  1EO6 A;  1WIA A;  4LDT D;  3H1U A;  4LDT B;  4KZC A;  5CHW A;  3VUW A;  4N9F 4;  1OQY A;  1WMH B;  1WX8 A;  2I1J A;  4OVV A;  3S2A A;  3W1Y A;  1V86 A;  3IHP C;  1WGG A;  3UF8 A;  3VVW B;  2HTH A;  5AEK B;  3ZO5 B;  3H6N A;  4ZRJ A;  2KFK B;  4EZL A;  3U30 A;  2ZCB A;  4PS8 A;  4HCN B;  3VH4 B;  3M63 B;  1ZW7 A;  1VD2 A;  3QC8 B;  4MGI E;  2IO2 B;  5CTR C;  2LGD A;  4DBG A;  3UIO B;  3DVN V;  4IWQ A;  3R7R A;  4BBN F;  1HE8 A;  1NBF C;  4HDO A;  4FUL A;  2MCN B;  1UH6 A;  3CF6 E;  4KDL B;  2O2V B;  3DCG A;  2DYO A;  1XT9 B;  3V61 A;  5JZE B;  2KQ7 A;  2MBH A;  2N9X A;  5LLI A;  4W9F A;  1E90 A;  2EMT A;  4EEW A;  2KZR A;  4WWO A;  1Z2M A;  4AJY B;  4GOC A;  4EFO A;  1ISN A;  1LXD A;  1V81 A;  3H7S A;  3ALB A;  3NOB A;  4URK A;  5L95 C;  1F9J A;  1H8C A;  3UIN B;  2KTR A;  3JSV B;  4JGH B;  4JL9 A;  2N9E B;  3PPA A;  2IO3 B;  2R2O A;  3KUZ A;  3N32 A;  2NBU A;  2G3Q B;  2G45 B;  4K7W A;  2Z0E B;  2KC2 A;  5D7G A;  2V3S A;  1GG3 A;  2RSU A;  1GNU A;  2LXC A;  4GGQ A;  3ZNI D;  2IYD B;  2MSE D;  2KFJ A;  3TIX A;  1RLF A;  2KJH B;  3JVZ X;  2RR9 A;  3TL5 A;  2NPT B;  1WF9 A;  1Z5S B;  2A5U A;  4NQL B;  1LQB A;  1TTN A;  3L08 A;  2AYO B;  3BIN A;  2JT4 B;  2J7Q B;  4HPM B;  2LAS A;  4WJQ A;  4AJW A;  3DDC B;  4GDL A;  3MTN B;  2DHZ A;  1FXT B;  4FLH A;  4A20 A;  4RM9 A;  4FHK A;  3VAW A;  2C60 A;  2JWZ A;  3AXC A;  3A33 B;  3R3M A;  4NQK E;  5CX3 A;  5KHO A;  2L05 A;  2MLB A;  2KOX A;  2OOB B;  3MJW A;  4ICV A;  4HPL B;  1TZ1 A;  2JUO A;  4J6I A;  3QHT A;  1R4N I;  2BKR B;  2GOW A;  3LDZ E;  4DHZ E;  1UBQ A;  3VH3 B;  3APF A;  2LJ5 A;  4GB9 A;  2K8C A;  5DPR A;  2MX2 A;  2KTR B;  2KD0 A;  5D94 A;  4NPN A;  3WAL A;  3VTW A;  2D11 A;  5EDS A;  2ZPY A;  2MW5 A;  2KDB A;  2NVU I;  1E8X A;  3GZN I;  2BKF A;  2LI5 A;  3L54 A;  3SHQ A;  2DYM A;  3VTU A;  2NR2 A;  2LGY A;  1PQS A;  2FCN A;  2KVR A;  2M8S A;  2ZNV C;  2ZVO A;  1GC6 A;  2JRI B;  4EZJ A;  1H4R A;  3KH0 A;  2KO3 A;  4ANX A;  2KLG A;  4RM8 A;  4MJS A;  3IG3 A;  3ZKJ C;  4CHK A;  4IWP A;  3PLU A;  4GDL B;  4HXD A;  4FA6 A;  3ECI A;  4BKS A;  4WJN A;  1UGM A;  4BVU C;  4KZ0 A;  3ZNG C;  2QHO A;  1IP9 A;  1YJ1 A;  2KDF B;  2MBB B;  2N4F A;  2V1Y A;  4NJ7 A;  2BWF A;  1EF5 A;  2EMS A;  4TQ0 A;  2Y5B B;  3VXW A;  1RFA A;  3PV1 A;  2LWP A;  4AWJ A;  1J19 A;  1SGH A;  3UQB A;  2M4N A;  3WIM A;  2BYE A;  3RUL A;  1KM7 A;  2CS4 A;  2UWQ A;  2J0K A;  2YVC A;  3UGB B;  2KLC A;  1WJN A;  4LJO B;  1V5T A;  2L8J A;  3QA8 A;  4MSQ B;  4WAA A;  1TGZ B;  1GUA B;  3UIP B;  3CMM B;  1K8R B;  3QAR A;  2PPH A;  3MHS D;  4FHJ A;  2CU1 A;  3KYC D;  2REX A;  4M8N A;  4W9E A;  2FIF A;  2MBE A;  5GMV A;  3TBL D;  2KQS A;  4KSL C;  4IM3 A;  5DPT A;  2UYZ B;  3RYT A;  2L3Z A;  3ZTD A;  4KIK A;  4MJS B;  5J17 A;  2K1F A;  3NZU A;  4GMV A;  2CKH B;  4I6L B;  1P3Q U;  3Q3F A;  3LJ3 A;  2NBW B;  1AAR A;  1IYF A;  1E8Z A;  4GN1 A;  1GJZ A;  4BKS D;  2KNB A;  2FID A;  2M0X A;  2WYQ A;  1UZX B;  3A1Q B;  4G3X B;  2GBM A;  3B08 A;  1WJ6 A;  2KX0 A;  2GBR A;  2KKC A;  3A4R A;  2KX3 A;  1NI2 A;  1OTR B;  3P2B A;  3QCA A;  2LXA A;  2IZV B;  2WWZ A;  2BYV E;  3AI5 A;  1QZE A;  2GBK A;  3NHE B;  4XX5 A;  3RT3 B;  4IG7 B;  3WAP A;  1WYW B;  1I42 A;  3B1L X;  3L0W B;  3PZD A;  3TJP A;  2LRU A;  4ZRK A;  2DYB A;  1WXA A;  2KWV B;  3ZW3 A;  2CHZ A;  3OJ3 A;  2GBJ A;  5LXH A;  4DHJ D;  4DHJ B;  2ZEQ A;  5CHF A;  4G50 A;  2KWU B;  3ZRF A;  4I6P A;  4F1S A;  1CMX B;  2C7H A;  4G11 A;  2OJR A;  4ZRI A;  1P1A A;  1WM3 A;  3APD A;  3DVG Y;  3O65 B;  3W1S A;  1WE6 A;  5DPS A;  3ML8 A;  4ASW C;  4I6N B;  2GMI C;  2K8H A;  1ZGU B;  4FJY A;  2Z59 B;  3RUI B;  2KWC A;  5LXI B;  2IO0 B;  4PS7 A;  2BYF A;  1U4A A;  2ZVN A;  4MSM B;  1WGH A;  4HLE A;  1RRB A;  2PEA A;  2WDT B;  3HM6 X;  1C3T A;  3DBR I;  4MGY E;  3DQV A;  1XQQ A;  2FUH B;  3GOE A;  3ML9 A;  4MM3 A;  4BKT A;  4P7I A;  2KXJ A;  3QK0 A;  3R7Q A;  3PHX B;  3DBH I;  3V6E B;  3L17 A;  3HHM A;  4FJZ A;  1Q5W B;  2G4S A;  2NS5 A;  3CSF A;  4PS3 A;  4E74 A;  3ZRC A;  3JW0 X;  5DCN A;  1XD3 B;  5AZG A;  3PTF C;  1WE7 A;  5L83 A;  3ZDM C;  3PRP B;  5TR5 A;  4IC7 B;  2LVO A;  3OLM D;  2DZI A;  2LVP A;  2CHW A;  3EEC A;  4FJV B;  2ZCC A;  3KUC B;  3ZNZ B;  4MEL A;  5HKH A;  3A4S C;  4DHZ B;  2YLM A;  1J8C A;  4W9K A;  3WAO A;  3TCA A;  1IPG A;  2BGF A;  3QWZ B;  5J2R A;  4KDI C;  3EC8 A;  4BFR A;  3A9J A;  3JYU A;  4DDG D;  4F8C B;  4W9D A;  2J0M A;  3QQ8 B;  2G4D B;  2Z0D B;  1J0G A;  1OEY J;  1WJ4 A;  2JF5 A;  3R66 C;  3VDZ A;  1TBE A;  4HCP B;  2IY0 B;  1WM2 A;  1P9D U;  3DBL I;  2LZ6 A;  4NY0 A;  1LFD A;  2NCN A;  2K8B A;  2IBI B;  5AZF A;  4JLC A;  3QAQ A;  1EF1 A;  2N9P C;  3PSE B;  2K6D B;  4B9K A;  4HJK A;  1V2Y A;  3HIZ A;  2MP2 A;  2ZJD A;  4M8M A;  4X57 B;  4HVB A;  2JZ3 B;  3N30 A;  2R2Q A;  1P98 A;  1WY8 A;  5G55 A;  2N7D A;  4HDQ A;  1WH3 A;  2KK8 A;  3RD2 A;  4NAW A;  1WFY A;  1V6E A;  3SD5 A;  4XC2 A;  5C23 A;  2JVC A;  2L0T A;  4E3C A;  3PLV A;  1KOT A;  4EUT A;  5IAA C;  3V6C B;  4G0N B;  1WJU A;  4AOF A;  4BOS C;  3PGE A;  3DOW A;  3L13 A;  4MH0 E;  2XEW A;  1WGD A;  3PHW B;  3PRZ A;  1V80 A;  3QJZ A;  1NDD A;  3N3K B;  2LRW A;  1WR1 A;  4YL8 A;  4B95 A;  3NS8 A;  1A5R A;  1S1Q B;  2M17 A;  2O2V A;  3VQI A;  1YQB A;  2AL6 A;  1KJT A;  4W9G A;  2C7M B;  3IFW B;  2N1V A;  3H7P A;  4IWO A;  3B0A A;  4LJP B;  4NJ6 A;  3X0W A;  1E7V A;  2MBO A;  1WXV A;  3ZDT A;  1UD7 A;  2L76 A;  4CYE A;  3VHT C;  1WXS A;  4WQO B;  1WGY A;  3VUX A;  4HWI B;  4EZK A;  2JY6 A;  4NNJ B;  4ANV A;  2MP2 B;  4LCD E;  2LGX A;  3V60 A;  3KVF B;  2HE7 A;  5D6J B;  2FNJ B;  2LD9 A;  2C9W B;  3IBE A;  5JHB A;  3UQA A;  3RZW C;  3K9O B;  1RAX A;  3AU5 A;  2BWE S;  3M62 B;  3PVL A;  2MRP A;  1ZKH A;  3DPD A;  2FCS A;  4NAW B;  4IM2 A;  4TUU A;  1SIF A;  2W9N A;  3PRE A; 
#chains in the Genus database with same CATH topology
 3L10 B;  4MGZ E;  3ZUN A;  3ZNH B;  1I7H A;  1F1H A;  3RNF C;  1F2R I;  4M0W B;  4RNA A;  2AQ3 B;  1V5O A;  4KIK B;  4KVG B;  2AEH A;  4AP4 C;  2D5G A;  2BW2 A;  2RGF A;  4EKU A;  1ZXI A;  3VR8 B;  2QC8 A;  3AV8 A;  4TV3 A;  1CJE A;  4W9H A;  1WI0 A;  3U7D A;  1WZ3 A;  1D3Z A;  3EUB 2;  2N7E A;  5D2M B;  1OFF A;  3W1S C;  3OJ4 B;  1I4G A;  1J7B A;  3NRZ A;  2KAN A;  1Q0W B;  3Q14 C;  2PKO A;  3OAW A;  1I35 A;  2JZZ A;  1TJE A;  4BAX A;  3N20 C;  2KMA A;  2MA9 B;  2ON8 A;  4XDD A;  2DAF A;  1KLV A;  3TEX A;  4NJC A;  3ENE A;  3P4S B;  3SDL C;  3U8Z A;  4P1B C;  4MGK E;  4WJP A;  1F52 A;  1ZOY B;  2KJ6 A;  5FR3 A;  3D32 A;  2BPS A;  3APC A;  3PRM B;  1GB4 A;  4XZ4 A;  4BKG A;  4JPS A;  3T9L A;  1WWT A;  4LNN A;  4OVU A;  1WX9 A;  3BZD B;  4B0E A;  1YMH E;  3PS6 A;  4II3 B;  1LM8 B;  1EWY C;  3SFE B;  2WDQ B;  3URY A;  3RFZ B;  4WIP A;  3E9S A;  1V49 A;  2LVQ A;  1VJK A;  1RFK A;  2NBV B;  2GLS A;  4W9C A;  3OG5 A;  4WWN A;  5BYS A;  3A1Q A;  1C4P A;  3A9J B;  2K6Q A;  2ZNV B;  4YXD B;  1WGR A;  2WXL A;  5G2N A;  4OW0 A;  2JSV X;  1T0Y A;  3KYD D;  4WH4 A;  3VR9 B;  1E7U A;  4N59 A;  3WAM A;  1TS2 A;  4UDU C;  2INN E;  2WX0 A;  1FO4 A;  3L4P A;  3P4R B;  4AUQ C;  4DDI D;  3X23 A;  2FCQ A;  4C4V A;  3JSV A;  4MDK E;  3KW5 B;  1GC7 A;  5BO4 B;  1MG8 A;  1EO6 A;  3VUW A;  1WX8 A;  1B9R A;  2D3C A;  3DHH C;  2HTH A;  3ZO5 B;  3H6N A;  1PGX A;  4HCN B;  1VD2 A;  4MGI E;  4XWT A;  4DBG A;  3DVN V;  4BBN F;  3C8Y A;  1NBF C;  1QOG A;  4KDL B;  2O2V B;  3DCG A;  3V61 A;  2N0S B;  2INC C;  3U52 E;  4W9F A;  2EMT A;  2KZR A;  4WWO A;  5FKA C;  1JW9 D;  1SXT A;  3RNE C;  3H7S A;  3ALB A;  4URK A;  5L95 C;  2QSD A;  3UIN B;  1SEB D;  4C4V B;  3JSV B;  1QLB B;  3N1Z C;  2DWQ A;  3PPA A;  5MPO A;  5FK9 C;  4LNF A;  1C76 A;  2IO3 B;  3AE1 B;  3KUZ A;  2DLB A;  2NBU A;  3Q69 A;  4A90 A;  3BWU D;  4DQO C;  2RSU A;  2IYD B;  2KFJ A;  2BVC A;  1RLF A;  5JXV A;  3TL5 A;  1WYG A;  1TTN A;  1K50 A;  2J7Q B;  4HPM B;  2BB5 A;  4AJW A;  1F2R C;  4KGS A;  3VAW A;  2JWZ A;  3AXC A;  5CX3 A;  2KOX A;  3W2D A;  4HPL B;  2JUO A;  3QHT A;  3W9C B;  1TKE A;  3LDZ E;  1PGA A;  4GB9 A;  1YOV B;  3ETR A;  1IUE A;  2L1A A;  3W5V B;  1HA5 A;  1TIF A;  3I9V 1;  3BK2 A;  3SHQ A;  2LI5 A;  2NR2 A;  2LGY A;  1QIL A;  2ZNV C;  2EEL A;  4PT5 A;  4N6E B;  3ZQ4 A;  3N1X C;  4EZJ A;  3IG3 A;  1DOI A;  1L4D B;  1T3Q A;  4ZOH C;  1UGM A;  4KZ0 A;  2MBB B;  2BWF A;  2Y5B B;  1RFA A;  3PV1 A;  2LWP A;  4AWJ A;  1J19 A;  1FRD A;  2M4N A;  2J0K A;  3UGB B;  4LJO B;  1TGZ B;  1GUA B;  4K3B A;  1FFV A;  2WXF A;  2REX A;  4W9E A;  1GB1 A;  2IGD A;  2KQS A;  4L2Y A;  1ZP0 B;  3AE3 B;  3IT6 B;  5J17 A;  3NZU A;  3TEZ A;  1AYF A;  1E8Z A;  1GJZ A;  1SF0 A;  4HKZ E;  2ZW0 A;  4P16 A;  2WYQ A;  4FXC A;  3N1Y C;  3ZXR A;  3QCA A;  1FNW A;  2BYV E;  1QZE A;  4XX5 A;  4IG7 B;  2G1E A;  4ZRP A;  3L0W B;  3PZD A;  2DYB A;  1EM7 A;  4DHJ D;  1VZ6 A;  4KKI A;  1P7F A;  3GE8 C;  2C7H A;  2OJR A;  3ZYY X;  2NMQ A;  2XNA C;  3Q6B A;  2GMI C;  4YWG G;  2KWC A;  4PS7 A;  4P1C C;  1WGH A;  1RRB A;  1JWU D;  1C3T A;  3DBR I;  2VZK D;  2FUH B;  4RH6 A;  4P7I A;  1SE4 A;  4RGM A;  1UUP A;  4PS3 A;  3ZRC A;  5DCN A;  1OQQ A;  5L83 A;  2BS3 B;  2WXI A;  5TR5 A;  3OLM D;  1SSN A;  2DZI A;  4S0R A;  2V4I B;  2LVP A;  2CHW A;  1VZ8 A;  2FUG 1;  1K53 A;  2ZCC A;  3KUC B;  3ZNZ B;  1A70 A;  1PFD A;  1L0V B;  3BYT B;  2JWU A;  3RNC C;  4O1N A;  3TCA A;  5BYR A;  1IPG A;  2IND C;  3TEW A;  3J9C A;  1FFU A;  2WDR B;  4XDC A;  1J0G A;  2JF5 A;  1TBE A;  1L6V A;  2IY0 B;  1WM2 A;  3BII D;  4HRS A;  3DBL I;  4NY0 A;  2K8B A;  3QAQ A;  3PSE B;  1GOZ A;  4HJK A;  5HG2 A;  3BK1 A;  3HIZ A;  4X57 B;  5C3J B;  5G55 A;  1DOY A;  4GLS C;  2KK8 A;  4NAW A;  2MH7 A;  1V6E A;  4XC2 A;  2L0T A;  3V05 A;  2E3T A;  2X38 A;  4BOS C;  4MH0 E;  1WGD A;  1V80 A;  1R4N B;  2LRW A;  1N63 A;  2VH1 A;  1FIQ A;  2QDF A;  3X0W A;  1E7V A;  2MBO A;  1WXV A;  4OZC A;  2HJ1 A;  1TKY A;  1WXS A;  1WGY A;  5IN7 A;  4HWI B;  4EZK A;  4LCD E;  2LGX A;  1LGR A;  3KVF B;  2HE7 A;  2L52 A;  3K9O B;  4RGO S;  3PVL A;  2I38 A;  3DPD A;  1E0Z A;  1ZDX A;  4IM2 A;  4NAW B;  1SIF A;  3DBL B;  3BY4 B;  5AZH A;  1MFW A;  4WWP A;  1WXM A;  4E71 A;  5J18 A;  3N9Y C;  2FE8 A;  1UBI A;  1L0Y B;  3ZLZ A;  1PDX A;  3EFU A;  2D10 A;  1Q10 A;  1C78 A;  2RD0 A;  1L7Y A;  4K81 A;  3P1M A;  1Y8R C;  2MQJ A;  4PYU A;  3BVZ A;  1XXG A;  2Y3A A;  4ICU A;  4JX1 C;  1Q1O A;  2K39 A;  2WXQ A;  2CU3 A;  2WXM A;  4HK2 A;  4YSX B;  2JXX A;  2PLP A;  4BBN C;  5HI1 A;  2WXJ A;  4BOZ B;  3DBS A;  2WX1 A;  2DX5 B;  3NVW A;  5E6P A;  3CIR B;  1JML A;  2RDB C;  3Q3J A;  1YJI A;  4AS1 A;  1LO5 D;  2FAZ A;  1E5W A;  2MWS B;  3BVG A;  3H9D A;  1SIJ A;  1XLN A;  1L2N A;  1J7A A;  2I1K A;  4GXB A;  3W5U B;  3RNB C;  4M02 A;  5IA7 A;  1V9J A;  2Q5W D;  1G6J A;  1SB3 C;  4JIO U;  1OGW A;  1C4C A;  3ZJT A;  2OHF A;  2O6V A;  5CHV C;  4A8X C;  2XBB C;  2JPH A;  2MBQ A;  5C1Z A;  3HUI A;  3HM3 A;  2IO1 B;  2CR5 A;  2GBN A;  1P0R A;  2KC1 A;  3PT2 B;  5H92 C;  4FN2 A;  3MC0 B;  1NYQ A;  2V4L A;  3DVG X;  2ZPN A;  4ZHP A;  1WMH A;  1YX5 B;  2LJI A;  4XWW A;  1MVK A;  1HZ6 A;  1K51 A;  4NZL B;  5HFY A;  2KDE B;  3M95 A;  3RCZ A;  2WXO A;  3SU8 X;  2O6V B;  4W9J A;  4K1R B;  2KN5 A;  3ONS A;  3P42 A;  4GSW A;  2J0J A;  4N58 A;  3RZF A;  3DWM A;  3RMK C;  5DPW A;  4MEM A;  2LFI A;  1IGC A;  3WAN A;  3DVN U;  3VUY A;  3I3T B;  3GP7 A;  4RMA A;  4IM0 A;  2ASQ A;  1WIA A;  5CHW A;  4LDT B;  4N9F 4;  1WMH B;  2I1J A;  3VVW B;  4WAF A;  3U30 A;  1MI0 A;  3M63 B;  1ZW7 A;  1QKZ A;  3R7R A;  1HE8 A;  4FUL A;  1UH6 A;  2EKI A;  3CF6 E;  5JZE B;  1FNV A;  3P4P B;  2Z8L A;  1T0S C;  4GOC A;  1TT5 B;  1ISN A;  1C9F A;  1H8C A;  2V9H A;  2BT6 A;  4JL9 A;  1YQ3 B;  2R2O A;  2G3Q B;  2G45 B;  4XYC A;  2Z0E B;  3ABV B;  2LXC A;  4GGQ A;  2TSS A;  2WXH A;  1FXI A;  1Z5S B;  4NQL B;  1LQB A;  3EFC A;  3L08 A;  2AYO B;  2W54 A;  4GDL A;  3MTN B;  2RMM A;  4A20 A;  1MPE A;  4K3C A;  3R3M A;  1FXA A;  3MJW A;  4ICV A;  2OOB B;  4MT5 A;  4J6I A;  2GOW A;  2LHD A;  2MX2 A;  4ZRQ A;  2KD0 A;  3AE4 B;  5D94 A;  4OZA A;  3VTW A;  1NYR A;  1N61 A;  2DBY A;  2D11 A;  5EDS A;  1KLU D;  2MW5 A;  3L54 A;  2KDB A;  1E8X A;  2DYM A;  2KVR A;  2M8S A;  3AEC B;  1GC6 A;  1VDV A;  2JRI B;  1D6E C;  4LK0 M;  2HDE A;  2KLG A;  3PO0 A;  3ZKJ C;  5EE9 A;  4CHK A;  4GDL B;  4BKS A;  4WJN A;  4BVU C;  1IP9 A;  1IGD A;  3ZNG C;  2KDF B;  2N4F A;  2V1Y A;  1EF5 A;  2EMS A;  2KAJ A;  2SEB D;  3U7Z A;  4M00 A;  4TQ0 A;  2IJ0 A;  1CQV A;  3WIM A;  2BYE A;  1KM7 A;  2KDM A;  1FMA D;  2KLC A;  2WXG A;  1ET6 A;  3QA8 A;  3UIP B;  2BB6 A;  1K8R B;  3QAR A;  2PPH A;  3MHS D;  1JQ4 A;  2CU1 A;  4C7Y A;  3DHI C;  2MBE A;  2K9X A;  2K0P A;  1TKG A;  5DPT A;  2G9H D;  2WU2 B;  2UYZ B;  4R3D A;  4KGT A;  2K1F A;  4GMV A;  2CKH B;  1P3Q U;  2KNB A;  1UZX B;  2HTM E;  3A1Q B;  4G3X B;  2QMT A;  2GBR A;  4HKQ A;  3I63 C;  1JWA D;  2Y5P A;  1ET9 A;  1ROE A;  1V97 A;  2D3A A;  2IZV B;  1VRA B;  4ITK A;  3RT3 B;  3NHE B;  3WAP A;  1WYW B;  3AEB B;  3B1L X;  4ZRK A;  2NTS A;  1TZO A;  5AUK A;  3OJ3 A;  2ZEQ A;  4G50 A;  2CJN A;  2QJL A;  4F1S A;  1ESF A;  4G11 A;  4ZRI A;  1WM3 A;  3ML8 A;  4I6N B;  1CZP A;  4FJY A;  3RUI B;  1U4A A;  4MSM B;  1GAQ B;  4YT0 B;  1IBX A;  4MM3 A;  3GOE A;  1FCL A;  1PGB A;  2KXJ A;  3QK0 A;  3PHX B;  3RNA C;  1ZDV A;  4E74 A;  1STE A;  3PRP B;  4IC7 B;  4M01 A;  3AE8 B;  2RDG A;  1XLQ A;  4DXF A;  3I5J C;  4MEL A;  1J8C A;  3UI3 A;  5J2R A;  1N6Z A;  3QWZ B;  1E6E B;  4DDG D;  1XO3 A;  4W9D A;  4F8C B;  2G4D B;  2LHE A;  4NAM A;  1IBX B;  4MM3 B;  2PMV A;  1B1Z A;  4YSZ B;  1EF1 A;  2K6D B;  3KLS X;  2N7J A;  3R8B A;  2MP2 A;  4TMA B;  3IAM 1;  2JZ3 B;  1P98 A;  1WY8 A;  1L5P A;  4HDQ A;  1WH3 A;  3NVV A;  1D4B A;  1WFY A;  4JWS C;  2OED A;  1KOT A;  5IAA C;  5IO9 A;  3V6C B;  4G0N B;  4JE3 B;  1WJU A;  5D3D A;  4YTP B;  1FCC C;  3PHW B;  3PRZ A;  3QJZ A;  4LLG M;  3AE2 B;  4B95 A;  2ONQ A;  4W9G A;  3IXS A;  4KX6 B;  3ZDT A;  2YEP F;  4S17 A;  1UD7 A;  2B76 B;  3VHT C;  4WWM A;  4NNJ B;  2MP2 B;  2N9L A;  5GXG B;  5D6J B;  3IBE A;  3UQA A;  1RAX A;  2WXK A;  3AU5 A;  3GS2 A;  1ZKH A;  3KQ4 A;  4L1B A;  3TUO A;  2M1M A;  1EUV B;  2NPT A;  1RWS A;  1UGJ A;  1WX7 A;  1FPY A;  4DWF A;  4FBJ B;  1FM0 D;  3MFG A;  4OZB A;  4ZYN A;  1QT9 A;  2PVO D;  5JHA A;  4QAY A;  2DNF A;  5E6N A;  3QX1 A;  2FBW B;  1VR9 A;  4IUM B;  4GU2 A;  3NY5 A;  4A3O A;  1X1M A;  2HJ8 A;  2PE6 B;  2D07 B;  3ZJU A;  1E8W A;  1S3S G;  4GIV A;  4HEA 1;  1UEL A;  1YX6 B;  2WXP A;  1T5X D;  3Q8A A;  3NZS A;  2JYT A;  3V62 A;  2XK5 A;  3VTV A;  1FD6 A;  2K5P A;  3AM9 A;  2L7R A;  4TKN A;  5E6O A;  1F77 A;  1CK1 A;  4K7U A;  1QOA A;  2IGH A;  1RYJ A;  4HRO A;  2A4Z A;  2L0F A;  2SAK A;  4KSK C;  1T0R C;  3C0R B;  4RF0 A;  4DXA B;  2CHX A;  1WR6 E;  4P6V F;  3T8M A;  4GDK A;  3LXF A;  4B6W A;  2PJH A;  3AB5 A;  4A3P A;  2DZM A;  1KTK A;  4C7Z A;  4IW0 A;  4KV2 A;  2AL3 A;  2FCM A;  3DBR B;  3DHG C;  3AEE B;  4ZDV A;  2BBC A;  2RPQ A;  4TQ1 A;  2XK5 B;  1BML C;  2QIL A;  2WXR A;  2K25 A;  2O6V D;  3ZTC A;  1E8Y A;  4F7Z A;  2BF8 B;  2JRH A;  4KKJ A;  3FIL A;  3VFK A;  1NVI D;  2LUM A;  4EOY A;  1JRO A;  1C4A A;  4LNI A;  2KJR A;  1JWS D;  2C5L C;  1SE2 A;  4YTN B;  2AX5 A;  2WQY B;  2AWT A;  3Q8E A;  4WQM A;  4GDK B;  5BYQ A;  4PYZ A;  4ANW A;  2EKE C;  1WXQ A;  2CJO A;  4JQW C;  1WRD B;  4LDT D;  4OVZ A;  4KZC A;  1ZPS A;  1OQY A;  3O13 A;  2K22 A;  4OVV A;  3IHP C;  3UF8 A;  4ZRJ A;  2OJW A;  4US9 A;  4EZL A;  2ZCB A;  3QC8 B;  2IO2 B;  5CTR C;  3UIO B;  1YNT E;  4HDO A;  2MCN B;  3P4Q B;  1GPX A;  3FIL B;  2KQ7 A;  1TS4 A;  4EEW A;  1Z2M A;  4RFB A;  4EFO A;  3IT4 B;  3HVZ A;  1EU4 A;  3SR6 A;  3AN1 A;  5HHD G;  3GE3 C;  2KTR A;  3FAH A;  1EWC A;  2JU6 X;  3N32 A;  3C19 A;  4K7W A;  1WGK A;  2WXN A;  2KC2 A;  1YN5 A;  2V3S A;  3MJ5 A;  1GNU A;  2N9K A;  2YEP B;  1N5W A;  3JVZ X;  2RR9 A;  4DXG A;  2JT4 B;  4WJQ A;  3DDC B;  4FLH A;  1FXT B;  3LB8 C;  2C60 A;  3A33 B;  3SEB A;  1TS3 A;  4EE2 A;  3OWE B;  3FKY A;  4WUR A;  1TZ1 A;  1MHH E;  2BKR B;  2IDY A;  1UBQ A;  3APF A;  2LJ5 A;  3Q8F A;  3IAS 1;  2KTR B;  1DYQ A;  4NPN A;  1YN3 A;  1TYG B;  2X8X X;  3TSS A;  2ZPY A;  2LEK A;  2NVU I;  3GZN I;  1ENF A;  3ZGZ A;  1PQS A;  2FCN A;  2ZVO A;  1C79 A;  1L4Z B;  1H4R A;  2KO3 A;  2PW9 A;  4MJS A;  4RM8 A;  1DGJ A;  4IWP A;  3PLU A;  4HXD A;  4FA6 A;  3ECI A;  2QHO A;  3AEF B;  1YJ1 A;  2ZW1 A;  4NJ7 A;  3AH7 A;  1SGH A;  3PZ7 A;  2JZP A;  3VRA B;  3RUL A;  1QOF A;  4HPP A;  2YVC A;  1WJN A;  1T6B X;  1V5T A;  2L8J A;  4WAA A;  4MSQ B;  2QCZ A;  1XF5 L;  3KYC D;  4M8N A;  1ACC A;  1MJD A;  1J7C A;  2FIF A;  3TBL D;  3AE9 B;  4J3O D;  4KSL C;  2V3P A;  3ZTD A;  4KIK A;  4MJS B;  3VRB B;  4I6L B;  2Y5C A;  3Q3F A;  1IYF A;  4GN1 A;  4BKS D;  2H88 B;  1YN4 A;  1XCT L;  3KWL A;  1WJ6 A;  2KX0 A;  3A4R A;  1NI2 A;  1OTR B;  2J53 A;  3AI5 A;  4ARC A;  1NI3 A;  1I42 A;  3TJP A;  3ZW3 A;  2CHZ A;  2KWU B;  1D5X C;  1CMX B;  2KT7 A;  2VH2 A;  1SBB B;  3DVG Y;  3O65 B;  1WE6 A;  4C80 A;  5D3I B;  5G5H A;  1ZGU B;  5LXI B;  5AUI A;  4HLE A;  2WDT B;  1OQR A;  2QEJ C;  1DOX A;  1XEE A;  3R7Q A;  3V6E B;  3HHM A;  1L6U A;  5H8Y E;  1Q5W B;  2G4S A;  1P7E A;  3CSF A;  3BYY B;  3RNG C;  4RGT A;  5AZG A;  3PTF C;  3ZDM C;  3NG0 A;  2J52 A;  2KN4 A;  5HKH A;  4Q2J A;  3A4S C;  3WAO A;  4H2A A;  3Q3O C;  4D2K A;  4BFR A;  3A9J A;  4RF1 A;  4REZ A;  2J0M A;  3RN9 C;  1K52 A;  3AE5 B;  3AE6 B;  5T8I A;  1FEH A;  1OEY J;  1WJ4 A;  2L32 A;  5EE0 A;  3R66 C;  2ACZ B;  1MG4 A;  3VDZ A;  1P9D U;  1AWD A;  5AZF A;  1LFD A;  2NCN A;  2IBI B;  4JLC A;  2N9P C;  4USA A;  4B9K A;  2M0A A;  1V2Y A;  1I4H A;  3N30 A;  2R2Q A;  1I4P A;  2N7D A;  1XLP A;  4YSY B;  3GB1 A;  3RD2 A;  1E10 A;  3SD5 A;  1I4X A;  5C23 A;  2JVC A;  4E3C A;  4EUT A;  1HTO A;  3V3X A;  4AOF A;  4L23 A;  2WDV B;  3PGE A;  4A9A A;  3ZJV A;  1UWX A;  1JWB D;  3NS8 A;  3P63 A;  4RGN A;  3R2T A;  1S1Q B;  2M17 A;  1E9M A;  2NTT A;  2O2V A;  1YQB A;  2AL6 A;  1KJT A;  2C7M B;  3H7P A;  4LJP B;  3B0A A;  4IKG A;  4NJ6 A;  4B0M A;  3PZ8 A;  4CYE A;  2WS3 B;  4MAC A;  4ANV A;  3V60 A;  2JYE A;  5BMH A;  2KWD A;  1UWM A;  4LNK A;  2LD9 A;  2C9W B;  5JHB A;  2RPV A;  3AED B;  2PIA A;  2FCS A;  1HEZ E;  2GI9 A;  2W9N A;  1KF6 B;  4PK1 A;  4ANU A;  1M94 A;  2D2Q A;  2J42 A;  5EE3 A;  3B2F A;  3EHV A;  1C1Y B;  3AE7 B;  1SE3 A;  3WA0 A;  2LGS A;  1SJH D;  1SE9 A;  1MHX A;  1V8C A;  1NEN B;  3NUH B;  4W9L A;  2GRI A;  5TSS A;  1I4Q A;  2HD5 B;  3H7P B;  3ZVV A;  4K7S A;  1JRU A;  1WRI A;  2KMC A;  4KGR A;  4II2 B;  1YD8 U;  1QOB A;  3M3J A;  2W82 A;  4FAD A;  5FR6 A;  3QIJ A;  2RDH A;  3K9P B;  3E56 A;  3L16 A;  2AQ1 B;  2MJ3 A;  1WZ0 A;  2VRR B;  4LTU A;  3HK0 A;  2XN9 C;  2KHW B;  5KHQ A;  2L00 B;  1UF0 A;  3RI7 C;  2MJD A;  2LUE A;  3IVF A;  2IY1 B;  4WJO A;  1QF6 A;  3TMP B;  2DAJ A;  2DEN B;  3KUD B;  1R7S A;  3ZIM A;  4CO7 A;  3MHZ A;  3EGR A;  5JH5 C;  3A9K A;  1JWM D;  2KDI A;  3CST A;  2KAC A;  5BMI A;  1VCB A;  2KVZ A;  2KTF A;  1HXY D;  1WSP A;  3AU4 A;  1F0Z A;  2DZJ A;  3T3O A;  2C7N B;  3H8H A;  2DZK A;  4MH8 A;  4A6Q A;  3NJT A;  3AMZ A;  4DK5 A;  1SJE D;  2B3A A;  3AUL A;  3B2G A;  2KFK A;  1HZ5 A;  2KQ4 X;  3Q2A C;  1YQ4 B;  2H89 B;  1VZ7 A;  3A9K B;  2N1W A;  5IP4 D;  1BT0 A;  2ZZP B;  2WLB A;  2W55 A;  2WU5 B;  1OEY A;  1YIW A;  2PE9 A;  3HVD A;  3AEA B;  2D3G A;  4W9I A;  3BVM A;  3NS1 A;  1R4M I;  2E6X A;  3FC4 A;  3H1U A;  3Q3M C;  3S2A A;  3W1Y A;  1V86 A;  1WGG A;  5AEK B;  2IGG A;  3MC8 A;  3R2I A;  2KFK B;  3U4E G;  4PS8 A;  3VH4 B;  2V3N A;  2LGD A;  4IWQ A;  1QQR A;  4LNO A;  2MJE A;  1T0Q C;  2D3B A;  2DYO A;  1XT9 B;  5C2T B;  1FRR A;  4ACF A;  2MBH A;  2N9X A;  1NEK B;  5LLI A;  1E90 A;  1TS5 A;  4AJY B;  3NVZ A;  5EE1 A;  1LXD A;  1V81 A;  2PTL A;  1D5Z C;  3NOB A;  1F9J A;  4JGH B;  2N9E B;  2WP9 B;  4JWU C;  5E6J A;  5D7G A;  1GG3 A;  3LYY A;  3ZNI D;  2MSE D;  3TIX A;  2KJH B;  2BS4 B;  1C77 A;  2NPT B;  1WF9 A;  2A5U A;  3B9J A;  3BIN A;  1ZUD 2;  2LAS A;  1BXT A;  2DHZ A;  3WCQ A;  1KLG D;  4RM9 A;  4FHK A;  2INP E;  1TY0 A;  3MP9 A;  5KHO A;  4NQK E;  1XLO A;  2L05 A;  1R4M B;  2MLB A;  4ARI A;  1R4N I;  4DHZ E;  3VH3 B;  2K8C A;  5DPR A;  2IPK D;  3AEG B;  3WAL A;  2BKF A;  5BMG A;  3VTU A;  1RM6 C;  1JAL A;  3DWG C;  1N62 A;  1EU3 A;  3KH0 A;  4ANX A;  2MHJ A;  3VXW A;  3U2S C;  1V1P A;  4ZHO A;  2K3U A;  3UQB A;  4CQN A;  4YTM B;  2CS4 A;  4RCO A;  4TSS A;  2UWQ A;  4US8 A;  3KWV A;  1ZXH A;  2PVG C;  3CMM B;  4A55 A;  5LNK 1;  4FHJ A;  1TY2 A;  4IDI A;  1N5X A;  2M56 B;  5GMV A;  2KYW A;  4IM3 A;  1V1O A;  1I4R A;  3RYT A;  2L3Z A;  3MC9 A;  5I4D A;  3LJ3 A;  2NBW B;  1AAR A;  2JXT A;  3NVY A;  2V0G A;  3CWI A;  2FID A;  2M0X A;  1AW7 A;  2BQQ A;  4ZYS A;  4C56 C;  2GBM A;  1V1P B;  3B08 A;  1HTQ A;  2KKC A;  2KX3 A;  3P2B A;  2L83 A;  2LXA A;  2WWZ A;  4C00 A;  2UU7 A;  2KMM A;  2GBK A;  2W3S A;  1JRP A;  2LRU A;  2LGI A;  1WXA A;  2KWV B;  3Q8B A;  1KH0 A;  2GBJ A;  5LXH A;  2WGS A;  4XGA B;  4DHJ B;  5CHF A;  3ZRF A;  4I6P A;  1D5M C;  5IKC M;  1P1A A;  3APD A;  1E7P B;  3W1S A;  5DPS A;  4ASW C;  2K8H A;  2Z59 B;  1AN8 A;  2JQR B;  2IO0 B;  2BYF A;  2ZVN A;  1YJJ A;  2PEA A;  3HM6 X;  4MGY E;  3DQV A;  1KRH A;  1XQQ A;  2VZK B;  3ML9 A;  4BKT A;  2BYT A;  1ZE3 D;  3DBH I;  3L17 A;  4BZA A;  2MEK A;  4FJZ A;  2NS5 A;  1BUI C;  2ICI A;  3JW0 X;  3I57 A;  3SFD B;  1XD3 B;  1FNU A;  1WE7 A;  3T3N A;  2LVO A;  1L0X B;  3EEC A;  4FJV B;  1HQR D;  5IOI A;  4DHZ B;  2YLM A;  4W9K A;  4XE0 A;  3TEY A;  2BGF A;  2W3R A;  4KDI C;  3EC8 A;  2WNM A;  1JCK B;  4OHJ A;  3JYU A;  1XCQ L;  3QQ8 B;  3EA6 A;  2BS2 B;  2M19 A;  2Z0D B;  4HCP B;  4AQ7 A;  2LZ6 A;  2J4X A;  2JX5 A;  5G5G A;  2ZJD A;  2LMC A;  4M8M A;  4HVB A;  3Q3N C;  3RPF C;  2WHI A;  4HJG E;  3NZ3 A;  3PLV A;  1KFY B;  2GB1 A;  1M4V A;  3HRD D;  2AQ2 B;  2QIE B;  3DBH B;  3DOW A;  4M0W A;  2BTE A;  3L13 A;  2XEW A;  2R61 A;  1NDD A;  3N3K B;  1WR1 A;  4YL8 A;  1A5R A;  3VQI A;  2I2Y A;  3IFW B;  2N1V A;  4IWO A;  3Q8C A;  2L76 A;  4WQO B;  3VUX A;  2JY6 A;  3GZN B;  1UNS A;  1PYW D;  2FNJ B;  1Y56 A;  3RZW C;  1VLB A;  2BWE S;  3M62 B;  3ZXV A;  4IOI E;  1PUT A;  2MRP A;  4TUU A;  1N60 A;  3PRE A; 
#chains in the Genus database with same CATH homology
 4ANU A;  3L10 B;  1M94 A;  2D2Q A;  4MGZ E;  2M1M A;  3ZUN A;  3ZNH B;  1EUV B;  2NPT A;  3BY4 B;  5AZH A;  4WWP A;  4M0W B;  1WX7 A;  1WXM A;  4E71 A;  4DWF A;  4FBJ B;  3EHV A;  5J18 A;  1C1Y B;  1UBI A;  3ZLZ A;  1V5O A;  3WA0 A;  3EFU A;  4KIK B;  4KVG B;  1SE9 A;  2D10 A;  2AEH A;  4AP4 C;  4W9L A;  4ZYN A;  2RD0 A;  1L7Y A;  4K81 A;  2HD5 B;  3H7P B;  5JHA A;  3ZVV A;  2RGF A;  1Y8R C;  2MQJ A;  4K7S A;  4PYU A;  5E6N A;  1JRU A;  3QX1 A;  2KMC A;  4EKU A;  4II2 B;  4ICU A;  4TV3 A;  1Q1O A;  2K39 A;  4W9H A;  1YD8 U;  4HK2 A;  1WI0 A;  3M3J A;  4IUM B;  3U7D A;  2JXX A;  1WZ3 A;  4GU2 A;  4BBN C;  3NY5 A;  4FAD A;  1D3Z A;  4A3O A;  4BOZ B;  1X1M A;  3DBS A;  2WX1 A;  2DX5 B;  2HJ8 A;  2N7E A;  3QIJ A;  5D2M B;  5E6P A;  2PE6 B;  5FR6 A;  2D07 B;  3K9P B;  3W1S C;  1E8W A;  3OJ4 B;  3L16 A;  3Q3J A;  1S3S G;  2VRR B;  1WZ0 A;  2KAN A;  4GIV A;  3HK0 A;  1Q0W B;  2KHW B;  3OAW A;  1I35 A;  2FAZ A;  2JZZ A;  5KHQ A;  2KMA A;  1E5W A;  2L00 B;  2MA9 B;  2MWS B;  3H9D A;  1UEL A;  2DAF A;  1KLV A;  1YX6 B;  2LUE A;  1L2N A;  2I1K A;  3ENE A;  3SDL C;  3NZS A;  3U8Z A;  4GXB A;  3V62 A;  3IVF A;  2IY1 B;  4WJO A;  2XK5 A;  3TMP B;  2DAJ A;  1V9J A;  2DEN B;  4MGK E;  5IA7 A;  1G6J A;  3VTV A;  3KUD B;  3ZIM A;  4JIO U;  4CO7 A;  5JH5 C;  4WJP A;  2KJ6 A;  1OGW A;  3A9K A;  2L7R A;  3D32 A;  2O6V A;  2BPS A;  4TKN A;  5E6O A;  5CHV C;  2KDI A;  3APC A;  4K7U A;  2XBB C;  3PRM B;  2JPH A;  2MBQ A;  3CST A;  4XZ4 A;  4BKG A;  5C1Z A;  3T9L A;  3HM3 A;  4OVU A;  2A4Z A;  1WX9 A;  2IO1 B;  2CR5 A;  2L0F A;  4KSK C;  2GBN A;  1VCB A;  3C0R B;  1P0R A;  2KC1 A;  3PT2 B;  4DXA B;  4FN2 A;  2KTF A;  2CHX A;  1WR6 E;  3PS6 A;  4II3 B;  3T8M A;  4GDK A;  1LM8 B;  3AU4 A;  4B6W A;  2PJH A;  2DZJ A;  2V4L A;  2C7N B;  4A3P A;  2DZM A;  2DZK A;  3DVG X;  2ZPN A;  1V49 A;  2LVQ A;  4IW0 A;  4DK5 A;  2B3A A;  4KV2 A;  2AL3 A;  1WMH A;  3AUL A;  1YX5 B;  2FCM A;  2NBV B;  4W9C A;  2KFK A;  4ZDV A;  2RPQ A;  2KDE B;  4WWN A;  4TQ1 A;  2XK5 B;  3A1Q A;  3A9J B;  3M95 A;  2K6Q A;  2ZNV B;  1WGR A;  3A9K B;  5G2N A;  3RCZ A;  2K25 A;  3SU8 X;  2O6V D;  2O6V B;  4W9J A;  1T0Y A;  2N1W A;  1E8Y A;  4K1R B;  3KYD D;  2KN5 A;  2BF8 B;  2JRH A;  3ONS A;  4GSW A;  3ZTC A;  4F7Z A;  3VFK A;  1BT0 A;  2ZZP B;  2J0J A;  1E7U A;  3RZF A;  4EOY A;  1OEY A;  1YIW A;  2PE9 A;  3WAM A;  2D3G A;  2WX0 A;  2KJR A;  2C5L C;  5DPW A;  4MEM A;  4W9I A;  4AUQ C;  4DDI D;  3X23 A;  2FCQ A;  2AWT A;  3JSV A;  4GDK B;  4MDK E;  3DVN U;  3KW5 B;  4PYZ A;  3WAN A;  1GC7 A;  4ANW A;  5BO4 B;  3VUY A;  2EKE C;  3I3T B;  4RMA A;  1MG8 A;  4IM0 A;  4JQW C;  2ASQ A;  1R4M I;  1WRD B;  1EO6 A;  1WIA A;  4LDT D;  3H1U A;  4LDT B;  4KZC A;  5CHW A;  3VUW A;  4N9F 4;  1OQY A;  1WMH B;  1WX8 A;  2I1J A;  4OVV A;  3S2A A;  3W1Y A;  1V86 A;  3IHP C;  1WGG A;  3UF8 A;  3VVW B;  2HTH A;  5AEK B;  3ZO5 B;  3H6N A;  4ZRJ A;  2KFK B;  4EZL A;  3U30 A;  2ZCB A;  4PS8 A;  4HCN B;  3VH4 B;  3M63 B;  1ZW7 A;  1VD2 A;  3QC8 B;  4MGI E;  2IO2 B;  5CTR C;  2LGD A;  4DBG A;  3UIO B;  3DVN V;  4IWQ A;  3R7R A;  4BBN F;  1HE8 A;  1NBF C;  4HDO A;  4FUL A;  2MCN B;  1UH6 A;  3CF6 E;  4KDL B;  2O2V B;  3DCG A;  2DYO A;  1XT9 B;  3V61 A;  5JZE B;  2KQ7 A;  2MBH A;  2N9X A;  5LLI A;  4W9F A;  1E90 A;  2EMT A;  4EEW A;  2KZR A;  4WWO A;  1Z2M A;  4AJY B;  4GOC A;  4EFO A;  1ISN A;  1LXD A;  1V81 A;  3H7S A;  3ALB A;  3NOB A;  4URK A;  5L95 C;  1F9J A;  1H8C A;  3UIN B;  2KTR A;  3JSV B;  4JGH B;  4JL9 A;  2N9E B;  3PPA A;  2IO3 B;  2R2O A;  3KUZ A;  3N32 A;  2NBU A;  2G3Q B;  2G45 B;  4K7W A;  2Z0E B;  2KC2 A;  5D7G A;  2V3S A;  1GG3 A;  2RSU A;  1GNU A;  2LXC A;  4GGQ A;  3ZNI D;  2IYD B;  2MSE D;  2KFJ A;  3TIX A;  1RLF A;  2KJH B;  3JVZ X;  2RR9 A;  3TL5 A;  2NPT B;  1WF9 A;  1Z5S B;  2A5U A;  4NQL B;  1LQB A;  1TTN A;  3L08 A;  2AYO B;  3BIN A;  2JT4 B;  2J7Q B;  4HPM B;  2LAS A;  4WJQ A;  4AJW A;  3DDC B;  4GDL A;  3MTN B;  2DHZ A;  1FXT B;  4FLH A;  4A20 A;  4RM9 A;  4FHK A;  3VAW A;  2C60 A;  2JWZ A;  3AXC A;  3A33 B;  3R3M A;  4NQK E;  5CX3 A;  5KHO A;  2L05 A;  2MLB A;  2KOX A;  2OOB B;  3MJW A;  4ICV A;  4HPL B;  1TZ1 A;  2JUO A;  4J6I A;  3QHT A;  1R4N I;  2BKR B;  2GOW A;  3LDZ E;  4DHZ E;  1UBQ A;  3VH3 B;  3APF A;  2LJ5 A;  4GB9 A;  2K8C A;  5DPR A;  2MX2 A;  2KTR B;  2KD0 A;  5D94 A;  4NPN A;  3WAL A;  3VTW A;  2D11 A;  5EDS A;  2ZPY A;  2MW5 A;  2KDB A;  2NVU I;  1E8X A;  3GZN I;  2BKF A;  2LI5 A;  3L54 A;  3SHQ A;  2DYM A;  3VTU A;  2NR2 A;  2LGY A;  1PQS A;  2FCN A;  2KVR A;  2M8S A;  2ZNV C;  2ZVO A;  1GC6 A;  2JRI B;  4EZJ A;  1H4R A;  3KH0 A;  2KO3 A;  4ANX A;  2KLG A;  4RM8 A;  4MJS A;  3IG3 A;  3ZKJ C;  4CHK A;  4IWP A;  3PLU A;  4GDL B;  4HXD A;  4FA6 A;  3ECI A;  4BKS A;  4WJN A;  1UGM A;  4BVU C;  4KZ0 A;  3ZNG C;  2QHO A;  1IP9 A;  1YJ1 A;  2KDF B;  2MBB B;  2N4F A;  2V1Y A;  4NJ7 A;  2BWF A;  1EF5 A;  2EMS A;  4TQ0 A;  2Y5B B;  3VXW A;  1RFA A;  3PV1 A;  2LWP A;  4AWJ A;  1J19 A;  1SGH A;  3UQB A;  2M4N A;  3WIM A;  2BYE A;  3RUL A;  1KM7 A;  2CS4 A;  2UWQ A;  2J0K A;  2YVC A;  3UGB B;  2KLC A;  1WJN A;  4LJO B;  1V5T A;  2L8J A;  3QA8 A;  4MSQ B;  4WAA A;  1TGZ B;  1GUA B;  3UIP B;  3CMM B;  1K8R B;  3QAR A;  2PPH A;  3MHS D;  4FHJ A;  2CU1 A;  3KYC D;  2REX A;  4M8N A;  4W9E A;  2FIF A;  2MBE A;  5GMV A;  3TBL D;  2KQS A;  4KSL C;  4IM3 A;  5DPT A;  2UYZ B;  3RYT A;  2L3Z A;  3ZTD A;  4KIK A;  4MJS B;  5J17 A;  2K1F A;  3NZU A;  4GMV A;  2CKH B;  4I6L B;  1P3Q U;  3Q3F A;  3LJ3 A;  2NBW B;  1AAR A;  1IYF A;  1E8Z A;  4GN1 A;  1GJZ A;  4BKS D;  2KNB A;  2FID A;  2M0X A;  2WYQ A;  1UZX B;  3A1Q B;  4G3X B;  2GBM A;  3B08 A;  1WJ6 A;  2KX0 A;  2GBR A;  2KKC A;  3A4R A;  2KX3 A;  1NI2 A;  1OTR B;  3P2B A;  3QCA A;  2LXA A;  2IZV B;  2WWZ A;  2BYV E;  3AI5 A;  1QZE A;  2GBK A;  3NHE B;  4XX5 A;  3RT3 B;  4IG7 B;  3WAP A;  1WYW B;  1I42 A;  3B1L X;  3L0W B;  3PZD A;  3TJP A;  2LRU A;  4ZRK A;  2DYB A;  1WXA A;  2KWV B;  3ZW3 A;  2CHZ A;  3OJ3 A;  2GBJ A;  5LXH A;  4DHJ D;  4DHJ B;  2ZEQ A;  5CHF A;  4G50 A;  2KWU B;  3ZRF A;  4I6P A;  4F1S A;  1CMX B;  2C7H A;  4G11 A;  2OJR A;  4ZRI A;  1P1A A;  1WM3 A;  3APD A;  3DVG Y;  3O65 B;  3W1S A;  1WE6 A;  5DPS A;  3ML8 A;  4ASW C;  4I6N B;  2GMI C;  2K8H A;  1ZGU B;  4FJY A;  2Z59 B;  3RUI B;  2KWC A;  5LXI B;  2IO0 B;  4PS7 A;  2BYF A;  1U4A A;  2ZVN A;  4MSM B;  1WGH A;  4HLE A;  1RRB A;  2PEA A;  2WDT B;  3HM6 X;  1C3T A;  3DBR I;  4MGY E;  3DQV A;  1XQQ A;  2FUH B;  3GOE A;  3ML9 A;  4MM3 A;  4BKT A;  4P7I A;  2KXJ A;  3QK0 A;  3R7Q A;  3PHX B;  3DBH I;  3V6E B;  3L17 A;  3HHM A;  4FJZ A;  1Q5W B;  2G4S A;  2NS5 A;  3CSF A;  4PS3 A;  4E74 A;  3ZRC A;  3JW0 X;  5DCN A;  1XD3 B;  5AZG A;  3PTF C;  1WE7 A;  5L83 A;  3ZDM C;  3PRP B;  5TR5 A;  4IC7 B;  2LVO A;  3OLM D;  2DZI A;  2LVP A;  2CHW A;  3EEC A;  4FJV B;  2ZCC A;  3KUC B;  3ZNZ B;  4MEL A;  5HKH A;  3A4S C;  4DHZ B;  2YLM A;  1J8C A;  4W9K A;  3WAO A;  3TCA A;  1IPG A;  2BGF A;  3QWZ B;  5J2R A;  4KDI C;  3EC8 A;  4BFR A;  3A9J A;  3JYU A;  4DDG D;  4F8C B;  4W9D A;  2J0M A;  3QQ8 B;  2G4D B;  2Z0D B;  1J0G A;  1OEY J;  1WJ4 A;  2JF5 A;  3R66 C;  3VDZ A;  1TBE A;  4HCP B;  2IY0 B;  1WM2 A;  1P9D U;  3DBL I;  2LZ6 A;  4NY0 A;  1LFD A;  2NCN A;  2K8B A;  2IBI B;  5AZF A;  4JLC A;  3QAQ A;  1EF1 A;  2N9P C;  3PSE B;  2K6D B;  4B9K A;  4HJK A;  1V2Y A;  3HIZ A;  2MP2 A;  2ZJD A;  4M8M A;  4X57 B;  4HVB A;  2JZ3 B;  3N30 A;  2R2Q A;  1P98 A;  1WY8 A;  5G55 A;  2N7D A;  4HDQ A;  1WH3 A;  2KK8 A;  3RD2 A;  4NAW A;  1WFY A;  1V6E A;  3SD5 A;  4XC2 A;  5C23 A;  2JVC A;  2L0T A;  4E3C A;  3PLV A;  1KOT A;  4EUT A;  5IAA C;  3V6C B;  4G0N B;  1WJU A;  4AOF A;  4BOS C;  3PGE A;  3DOW A;  3L13 A;  4MH0 E;  2XEW A;  1WGD A;  3PHW B;  3PRZ A;  1V80 A;  3QJZ A;  1NDD A;  3N3K B;  2LRW A;  1WR1 A;  4YL8 A;  4B95 A;  3NS8 A;  1A5R A;  1S1Q B;  2M17 A;  2O2V A;  3VQI A;  1YQB A;  2AL6 A;  1KJT A;  4W9G A;  2C7M B;  3IFW B;  2N1V A;  3H7P A;  4IWO A;  3B0A A;  4LJP B;  4NJ6 A;  3X0W A;  1E7V A;  2MBO A;  1WXV A;  3ZDT A;  1UD7 A;  2L76 A;  4CYE A;  3VHT C;  1WXS A;  4WQO B;  1WGY A;  3VUX A;  4HWI B;  4EZK A;  2JY6 A;  4NNJ B;  4ANV A;  2MP2 B;  4LCD E;  2LGX A;  3V60 A;  3KVF B;  2HE7 A;  5D6J B;  2FNJ B;  2LD9 A;  2C9W B;  3IBE A;  5JHB A;  3UQA A;  3RZW C;  3K9O B;  1RAX A;  3AU5 A;  2BWE S;  3M62 B;  3PVL A;  2MRP A;  1ZKH A;  3DPD A;  2FCS A;  4NAW B;  4IM2 A;  4TUU A;  1SIF A;  2W9N A;  3PRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...