2M1MA

Solution structure of the psiaa4 oligomerization domain reveals interaction modes for transcription factors in early auxin response
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
HEADVGGIFVKVSMDGAPYLRKIDLRVYGGYSELLKALETMFKLTIGEYSEREGYKGSEYAPTYEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGTEAKGLGCGVGSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Auxin-induced protein IAA4
publication title Solution structure of the PsIAA4 oligomerization domain reveals interaction modes for transcription factors in early auxin response.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Transcription
total genus 21
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2012-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2m1mA00
4W9GA 2LXCA 2Z0DB 5J2RA 2LRWA 4CO7A 4DHJD 3GZNI 1V5OA 3LDZE 5AZGA 3HHMA 4HPMB 2NBVB 3OJ3A 2KDIA 1SE9A 4W9EA 2O2VA 3HM6X 4NPNA 4GDLB 4K1RB 4II2B 2KTRA 4II3B 3DVNV 2REXA 2M17A 1RFAA 3H9DA 3D32A 4KZCA 1IP9A 5KHOA 1KM7A 2DHZA 1UH6A 2MA9B 2JZ3B 3B0AA 3WAMA 1UBQA 2JRHA 3PLVA 4P7IA 1WJNA 2BKFA 2EKEC 4M8NA 4WJNA 2J0MA 2KOXA 2J0KA 4PS3A 2O6VA 3PRMB 3KYCD 4HDQA 3RUIB 1TTNA 3ML8A 3BINA 1F9JA 3KW5B 2C7MB 4KDIC 2A5UA 1WGGA 1GG3A 2CKHB 3DVNU 4IWQA 2AL3A 2BYEA 4LCDE 1V2YA 3T9LA 1T0YA 2D2QA 1LXDA 5JHAA 5BO4B 1WM3A 1SGHA 3WALA 1GC6A 1WX9A 1PQSA 4AWJA 2KD0A 2KFKA 3HM3A 5C1ZA 3A9KA 3VTVA 1FXTB 5LLIA 1Q1OA 2K8HA 2FCMA 1YIWA 4BKSA 1WY8A 2WDTB 2KDBA 4LJOB 3QCAA 2XBBC 2KANA 4ZRIA 2MBHA 2WX1A 2G4DB 4GDKA 3W1SA 3PV1A 2XEWA 3HIZA 2JWZA 4MGKE 1C3TA 3PHXB 1WRDB 1E8YA 4DDID 2C7HA 1WJUA 2L05A 3W1YA 1WJ6A 3ZW3A 4BOSC 3NOBA 1V9JA 4LDTD 2NPTB 1E7VA 1I35A 4FJYA 1GUAB 1E5WA 3PSEB 3QWZB 4MJSB 2BYFA 2BPSA 3ML9A 1Q0WB 1UGMA 3QX1A 1E8ZA 3L0WB 1WGRA 1WF9A 4K81A 3ZNID 1V6EA 2KFKB 3AU5A 2CHZA 4TKNA 2IO3B 1EUVB 3A9KB 3KUZA 2KWVB 4IM3A 4NJ6A 5DPWA 2ZZPB 2DX5B 2K8CA 4LDTB 5AZFA 1EF5A 4B9KA 3ZUNA 1D3ZA 3MTNB 2GBJA 4MGZE 1WI0A 2GBKA 2J7QB 4W9CA 3VQIA 3ZRCA 3VHTC 2K6QA 4NAWA 4ZDVA 2BWFA 3PRPB 3ZDTA 3H6NA 2BF8B 2L0TA 3VH3B 2KQSA 2L3ZA 4KIKA 4RM9A 1P3QU 3ZTCA 2MP2A 1RAXA 4GOCA 3KYDD 2DZIA 1E8XA 3K9OB 3QC8B 4WJPA 4DBGA 1AARA 1LM8B 2KTFA 1WFYA 2FAZA 2DYBA 4JQWC 2LJ5A 4B6WA 5LXHA 3DQVA 3OAWA 2LVQA 4BBNC 2LVPA 5G55A 4DWFA 1H8CA 2KDEB 4EZKA 2KNBA 5C23A 3QJZA 4AOFA 5L83A 5JHBA 2NR2A 4ANXA 4FN2A 3ECIA 3DOWA 3ZIMA 3VFKA 4TUUA 1XD3B 4URKA 5D94A 5EDSA 2L8JA 1X1MA 2MSED 4IM2A 3CSFA 4OVUA 3R7QA 3KUCB 3JSVA 2N9PC 4AJYB 2LRUA 2KLCA 2KX0A 3ZTDA 4X57B 5E6PA 3VUYA 4EEWA 1YX6B 5CHFA 2BYVE 2WX0A 4K7SA 2DZMA 2C7NB 2RPQA 2MCNB 3QHTA 1LQBA 1EO6A 1P0RA 1YQBA 4LJPB 2LASA 1WMHB 2B3AA 4W9DA 1OEYA 1XQQA 3NS8A 3UQAA 2I1JA 2A4ZA 4G11A 1V81A 4WJQA 3DVGY 2DAJA 3QAQA 4KSLC 4PYZA 3M3JA 4DHZB 1VCBA 4HCPB 3ZNZB 1WYWB 1WZ0A 3ZVVA 2WYQA 4HWIB 2GMIC 3L17A 4RM8A 3K9PB 1KLVA 3RZFA 3A9JA 3CF6E 2RD0A 2M8SA 2N7EA 4WWNA 2CS4A 3CMMB 3H7SA 3A1QB 2Z59B 4JLCA 3PTFC 3I3TB 2RSUA 3S2AA 4AJWA 4NNJB 3PZDA 5CHWA 3WAPA 2KJ6A 1E7UA 2ZEQA 4HDOA 3VUWA 3H7PA 2MBBB 3PVLA 1IYFA 3JVZX 4KVGB 1UZXB 5D7GA 2MWSB 4DXAB 3L13A 3KH0A 2D10A 5DCNA 3AULA 1WE7A 4N9F4 4HVBA 3WIMA 2O2VB 1R4MI 4WWOA 4KV2A 3QA8A 4PYUA 1EF1A 2KTRB 4GXBA 4BVUC 1M94A 4W9JA 3SD5A 2DZKA 3U7DA 1K8RB 2ZNVB 3R3MA 4OVVA 2JVCA 1H4RA 2NBUA 1RRBA 2N1WA 1UELA 5DPSA 3L08A 2KDFB 5D6JB 1WXMA 2N9EB 2NVUI 4DDGD 4HCNB 1TZ1A 4M8MA 3SHQA 2LVOA 1WR6E 2O6VB 2LGDA 2IYDB 3DCGA 4NY0A 3ZDMC 2GBRA 3IVFA 1WM2A 2G4SA 2R2OA 1V86A 2ZNVC 3Q3FA 4HLEA 2HTHA 1Z2MA 5TR5A 4I6NB 2KWCA 4HK2A 2KK8A 3N30A 2MBQA 4WAAA 3V6EB 2IZVB 3IHPC 3JW0X 4E74A 4G50A 2FCSA 1WX8A 2MBEA 3QIJA 3V61A 2XK5A 1BT0A 1P98A 5DPTA 1YD8U 1J19A 2N1VA 4K7UA 2CHWA 3WAOA 2HD5B 2MRPA 4I6PA 2C60A 2W9NA 4EKUA 3RZWC 1GNUA 2KFJA 3VXWA 4FHKA 4IUMB 2J0JA 3PS6A 3U8ZA 2QHOA 4BKGA 1L7YA 2RGFA 4WQOB 4GDKB 4IWPA 3Q3JA 3SDLC 2KMAA 1Q5WB 4ANWA 3VTUA 1WGHA 1L2NA 3RT3B 3A4SC 2IY1B 3O65B 2IO0B 2LGYA 2ZCBA 2M4NA 2JXXA 1J0GA 2ZJDA 2D11A 4NQKE 1S3SG 2KKCA 2V1YA 1IPGA 4YL8A 3ZNGC 2ZVOA 4XC2A 3ALBA 3UF8A 4W9HA 2CR5A 4JGHB 2KJHB 1SIFA 2KXJA 4PS7A 3IBEA 4ICVA 4MELA 1MG8A 3TCAA 4A3OA 2DENB 2KC2A 4JIOU 3VH4B 4GB9A 4FA6A 5AEKB 1CMXB 2ZVNA 1G6JA 4AP4C 4DK5A 1GJZA 2JY6A 2YVCA 3WA0A 3R66C 3PRZA 2JRIB 2D3GA 1OGWA 2FUHB 3UIOB 1YJ1A 4IW0A 3X23A 2KO3A 3L10B 2JUOA 4KZ0A 4NAWB 2V4LA 2NCNA 3DVGX 4TV3A 5G2NA 3VTWA 2D07B 3RYTA 2C9WB 1A5RA 3KUDB 3VAWA 3WANA 1U4AA 4W9IA 4KIKB 4GDLA 4FHJA 4XX5A 1Y8RC 4J6IA 2MP2B 1ISNA 3APDA 3N3KB 3X0WA 1UBIA 3MHSD 3ONSA 4TQ1A 1KOTA 3UQBA 3VDZA 4FADA 3ENEA 4MSMB 2PJHA 3NZUA 2Z0EB 1VD2A 4A20A 2G3QB 1ZKHA 3BY4B 3NZSA 4BOZB 3PGEA 1WR1A 2KN5A 2CHXA 3R7RA 2WWZA 2NBWB 3DDCB 3LJ3A 2V3SA 3U30A 4DHZE 1TBEA 2MX2A 2UYZB 1E8WA 1JRUA 1QZEA 2LWPA 2IBIB 1TGZB 3DPDA 3QK0A 2N7DA 5GMVA 2K25A 2Y5BB 2GBMA 1ZGUB 2RR9A 4FULA 2HE7A 3M62B 2FCNA 2LI5A 3PHWB 3V62A 2IO2B 3AU4A 3PT2B 4EUTA 2BGFA 3JSVB 4CYEA 4G0NB 4M0WB 4ZRKA 5J18A 2K8BA 5DPRA 3OJ4B 4IWOA 4W9LA 3B1LX 4HJKA 2LXAA 4IC7B 4DHJB 2ZPNA 3T8MA 5L95C 2FIFA 4MEMA 4XZ4A 3TJPA 1YX5B 1NI2A 4RMAA 4WJOA 3DBSA 2O6VD 1WE6A 2L00B 3VUXA 2KC1A 4ZYNA 4GIVA 4JL9A 3N32A 3MJWA 3A33B 4IG7B 1GC7A 5LXIB 5CX3A 3NHEB 1P1AA 2MW5A 4MDKE 2K39A 1WZ3A 4GSWA 2NPTA 3JYUA 4W9KA 4KSKC 3AXCA 4ASWC 3A9JB 4EOYA 3PLUA 4ICUA 4MSQB 4MJSA 4BBNF 1ZW7A 2L7RA 2N4FA 3ZO5B 4K7WA 3GOEA 2R2QA 1Z5SB 4E71A 4F7ZA 3AI5A 5FR6A 2L76A 2IY0B 2OJRA 4EFOA 5CTRC 1WX7A 3IFWB 4BKSD 2M0XA 4FJZA 3RULA 2MBOA 3CSTA 2DZJA 3H7PB 3NY5A 4NQLB 4F1SA 4MH0E 3OLMD 4NJ7A 4EZJA 4MGYE 3M63B 2LZ6A 2AYOB 4ANVA 3DBHI 4PS8A 1WXSA 1V80A 1UD7A 1RLFA 2N9XA 2FCQA 3V60A 1OTRB 2KMCA 3UIPB 2KLGA 3PPAA 4TQ0A 1HE8A 1WXAA 3TL5A 2MLBA 3C0RB 1P9DU 2KVRA 1V5TA 2LD9A 2ZCCA 3ZRFA 4W9FA 4HXDA 2BWES 2DAFA 1OQYA 2LGXA 4FLHA 3TMPB 1R4NI 4KDLB 5E6NA 3QARA 3ZLZA 3M95A 5KHQA 4BFRA 2I1KA 2OOBB 3L16A 3A4RA 1OEYJ 4GMVA 2AWTA 5JZEB 2DYMA 2YLMA 2FNJB 2KJRA 5E6OA 1KJTA 2PPHA 3APFA 3QQ8B 4G3XB 3RCZA 2K6DB 4CHKA 4GU2A 2PE9A 5HKHA 3W1SC 3ZNHB 3PREA 5JH5C 1V49A 2NS5A 3L54A 4E3CA 2XK5B 4WWPA 4FJVB 1E90A 2HJ8A 2PEAA 4BKTA 2IO1B 1LFDA 4GGQA 2EMSA 1WGYA 4F8CB 3KVFB 2CU1A 1WXVA 2KHWB 3APCA 3EC8A 3IG3A 4MM3A 3P2BA 3SU8X 2KX3A 3UGBB 3EHVA 2PE6B 2C5LC 5D2MB 5AZHA 5IAAC 5J17A 1NDDA 2GBNA 3TIXA 4B95A 5IA7A 2L0FA 3TBLD 2KWUB 1C1YB 3EECA 1WIAA 4MGIE 2EMTA 1WMHA 3ZKJC 1J8CA 4ZRJA 2M1MA 2KZRA 2GOWA 2JZZA 3VVWB 2ASQA 1WGDA 4GN1A 1I42A 2VRRB 2UWQA 2ZPYA 2LUEA 2JPHA 4EZLA 4ANUA 2JT4B 2AL6A 2G45B 2JF5A 2BKRB 3V6CB 1NBFC 5CHVC 4FBJB 4AUQC 3B08A 4I6LB 1WH3A 2KQ7A 2AEHA 2FIDA 1XT9B 2DYOA 3HK0A 3DBLI 4HPLB 1S1QB 1WJ4A 2MQJA 4A3PA 2K1FA 3EFUA 3DBRI 4IM0A 3RD2A 3H1UA 3UINB 3A1QA
chains in the Genus database with same CATH superfamily
4N59A 5J2RA 4CO7A 1D5MC 3Q8AA 2WNMA 1EU4A 3HHMA 4AQ7A 1KH0A 4NPNA 4GDLB 2OEDA 1TS3A 2KTRA 1L4DB 1RFAA 3H9DA 3D32A 5KHOA 4US9A 5GXGB 4LNIA 1UH6A 3WAMA 1UBQA 3Q8BA 2EKEC 4IDIA 2WDRB 2YEPF 3KYCD 1TTNA 3BK1A 3ML8A 1VZ8A 4KDIC 2KMMA 2XN9C 1ZXHA 3T9LA 2D2QA 5JHAA 3NVWA 4S0RA 1GB1A 3SR6A 3A9KA 3VTVA 1FXTB 2K8HA 2FCMA 1YIWA 4BKSA 2MBHA 2WX1A 2E3TA 2G4DB 3W1SA 1NYRA 2L05A 1WJUA 2L1AA 3NOBA 1V9JA 2NPTB 1E5WA 2BPSA 1C9FA 1E8ZA 1WGRA 3DHHC 2X38A 2KFKB 4TKNA 2K8CA 4MGZE 3NG0A 2K6QA 4IOIE 1PGAA 4ZDVA 3ZDTA 2BF8B 4RM9A 2G1EA 4ZRQA 3K9OB 1UWMA 1ET9A 2B76B 3GB1A 2FAZA 2LJ5A 3OAWA 1H8CA 4EZKA 5C23A 1AN8A 2MHJA 4M00A 2D3CA 1QF6A 2WDQB 2LMCA 1IGDA 4IM2A 4OVUA 3R7QA 3JSVA 2BT6A 3VUYA 1YX6B 1DOYA 2RPQA 2RDHA 2MCNB 4LJPB 4ZHOA 3GE8C 1SEBD 2I1JA 4K3CA 3HVZA 1P7EA 3TEZA 3EUB2 4WJQA 3QAQA 2DAJA 3OWEB 1JWMD 1VCBA 1WZ0A 3RZFA 3A9JA 2Y5CA 4RFBA 3CMMB 3H7SA 3CIRB 3P4SB 4YXDB 4AJWA 5CHWA 3WAPA 1E7UA 4XE0A 3H7PA 1IYFA 5C2TB 3JVZX 4DXAB 4L2YA 1XF5L 1UUPA 3Q8EA 4N9F4 2K5PA 2O2VB 4WWOA 2JZPA 2DNFA 4GXBA 4BVUC 1D4BA 1K52A 1L0VB 2NBUA 1JWBD 1RRBA 2N1WA 2JU6X 1WWTA 1TS5A 1ET6A 1C79A 4DDGD 1K53A 1TZ1A 1A70A 2RPVA 2O6VB 2IYDB 3DCGA 3ZDMC 2GBRA 3IVFA 3Q8FA 1TYGB 3Q3FA 4HLEA 2HTHA 5TR5A 1FXAA 4D2KA 2KK8A 2Y5PA 4BZAA 2N9KA 4ZYSA 1EWCA 2YEPB 1DYQA 4RF0A 1F52A 3N1XC 3RZWC 1GNUA 1SJHD 2KFJA 1ZP0B 3UI3A 5AUKA 1PFDA 1FRRA 3SDLC 2KMAA 1K50A 3H8HA 5D3DA 1L2NA 3W5VB 3O65B 2LGYA 4LNFA 1YMHE 2ZVOA 1VJKA 3UF8A 2CR5A 4PS7A 4A3OA 3WCQA 2ICIA 3VH4B 4FA6A 1CMXB 2ZVNA 1G6JA 4AP4C 1ZXIA 1GJZA 2GI9A 4DXFA 3R66C 3AEAB 3X23A 2KO3A 2JUOA 1T0RC 2PLPA 3KUDB 1XLPA 4FHJA 3NS1A 1ISNA 1PGBA 1UBIA 3ONSA 2AQ2B 3VDZA 2D3AA 3ENEA 1E0ZA 3NZSA 2CHXA 3KWLA 2NBWB 2V3SA 3U30A 1JW9D 2LWPA 3DPDA 1JWUD 2UU7A 3QK0A 1V1OA 1ZGUB 2HE7A 1R4MB 5EE1A 4A8XC 4CYEA 4M0WB 4W9LA 1N61A 4DHJB 3N1ZC 4MEMA 4WAFA 3TJPA 3DBSA 3LXFA 3P1MA 3VUXA 2KC1A 3MJWA 3PO0A 1ZPSA 1P1AA 1HTOA 5IN7A 4JE3B 1SE4A 3JYUA 1GPXA 4MSQB 1I4GA 4BBNF 4K7WA 3J9CA 3GOEA 2R2QA 1Z5SB 2L76A 3TEXA 3RPFC 3IFWB 1WRIA 5D3IB 3BVMA 4NJ7A 2LZ6A 1D6EC 3MC8A 1V80A 1UD7A 1RLFA 2N9XA 3HVDA 3UIPB 3PPAA 1HE8A 3Q69A 3ZRFA 2ZCCA 2KVRA 3TMPB 1R4NI 3QARA 4C7YA 2I1KA 2AX5A 3VRBB 5JZEB 1YN5A 1EU3A 1YJJA 2KJRA 2YLMA 5E6OA 4RGTA 2LUMA 1KJTA 3QQ8B 3APFA 2PE9A 2WQYB 1JMLA 4MACA 4C4VA 2NS5A 2VH1A 4E3CA 4FJVB 1E90A 1YJIA 1LFDA 1WGYA 3KVFB 1WXVA 3APCA 3IG3A 4DQOC 3EHVA 2WXKA 2RMMA 4RH6A 2ACZB 2GB1A 2EMTA 3VVWB 2GOWA 2IGHA 4OHJA 1I42A 2VRRB 4YSXB 2I38A 2JPHA 2G45B 4FBJB 1NBFC 3AEFB 4I6LB 4L1BA 4LNKA 2FIDA 3HK0A 3DBLI 4N58A 1S1QB 2V3PA 3N1YC 4A3PA 2DLBA 3DBRI 4LLGM 4WQMA 3AN1A 4W9GA 2LXCA 3RNCC 2LRWA 1I4RA 4N6EB 2R61A 1KTKA 5AZGA 3Q3OC 1FCLA 1FXIA 2KDIA 1SE9A 2N0SB 5TSSA 4NZLB 2PMVA 2PIAA 1OFFA 2MJ3A 4HRSA 1C77A 1IP9A 2DHZA 1L6VA 2JZ3B 1SE2A 3B0AA 2KOXA 3U4EG 3PRMB 5BYSA 3RUIB 1ZUD2 3EGRA 3BINA 1F9JA 2A5UA 1GG3A 3DVNU 4IWQA 4A6QA 3TUOA 2BYEA 2XNAC 3DBHB 4LCDE 4KGSA 1KRHA 3NRZA 1T0YA 1LXDA 1SGHA 4AWJA 1WX9A 2WGSA 3AE8B 5LLIA 1Q1OA 1N63A 3QCAA 1N62A 3PV1A 3L4PA 3PHXB 4ZOHC 1E8YA 4DXGA 2C7HA 4BOSC 1WJ6A 3R2IA 4LDTD 4FJYA 3PSEB 1Q0WB 1UGMA 2KT7A 3ZNID 5FKAC 1C78A 2X8XX 2CHZA 3A9KB 5IP4D 3FAHA 1FRDA 5DPWA 2DX5B 4LDTB 1K51A 4B9KA 1IBXB 3ZUNA 1D3ZA 3MTNB 1D5ZC 3VQIA 4LK0M 1MFWA 4XYCA 3AB5A 3P42A 4GOCA 2OJWA 3VR8B 1E8XA 3QC8B 1YOVB 3FILA 4JQWC 4HPPA 4B6WA 4BBNC 5G55A 5HG2A 2KNBA 3P63A 1TKYA 4AOFA 3DOWA 3RNFC 1DOIA 5D94A 5EDSA 2MSED 3CSFA 5IO9A 3FKYA 3KUCB 1HTQA 4K3BA 1SE3A 5CHFA 2C7NB 1XEEA 1KLUD 1EO6A 4H2AA 1YQBA 3GS2A 3BWUD 1WMHB 4W9DA 1OEYA 1XQQA 1T0SC 1QQRA 3UQAA 4G11A 1V81A 2WLBA 3MFGA 2QSDA 4FXCA 2GMIC 4RM8A 3K9PB 2W54A 2RD0A 1ZOYB 2WDVB 3RMKC 3A1QB 4JLCA 4NNJB 3PZDA 3PZ7A 3CWIA 3VUWA 3W2DA 3TEWA 3SFEB 3AULA 1WE7A 3WIMA 1XO3A 1FPYA 1SIJA 2KWDA 2FBWB 4KV2A 2FUG1 3TSSA 4W9JA 3SD5A 2DZKA 3U7DA 3R3MA 2JVCA 1T3QA 3L08A 2KDFB 5D6JB 2N9EB 1MJDA 4M8MA 1WR6E 2LGDA 2WXIA 1QT9A 4NY0A 1V86A 1C4CA 4OW0A 4HK2A 4WH4A 2KACA 3V6EB 3U52E 2K3UA 5T8IA 3NZ3A 3P4QB 3QIJA 4USAA 3RNAC 3V61A 2XK5A 5I4DA 2MJDA 1J19A 4K7UA 2LGIA 2MRPA 2C60A 2HJ1A 3U8ZA 2J0JA 4BKGA 1L7YA 4WQOB 4GDKB 1GB4A 1KF6B 5JXVA 1Q5WB 1WGHA 2LHEA 3C8YA 4O1NA 3ZJVA 2WXGA 1C4PA 3A4SC 2IY1B 4WIPA 4KGTA 1RM6C 2L32A 2JXXA 2INCC 2D11A 2LGSA 2ON8A 3B2FA 1IPGA 3ZJUA 3ZNGC 3ALBA 1SIFA 4ICVA 3TCAA 2KC2A 4RCOA 1TS4A 5AEKB 4DK5A 4HJGE 2YVCA 3WA0A 1XLOA 3PRZA 2JRIB 3UIOB 4IW0A 3BK2A 4KZ0A 4NAWB 3DVGX 2NCNA 2NMQA 4TV3A 5G2NA 3VTWA 2D07B 1A5RA 1BXTA 4RGNA 1U4AA 4KIKB 4GDLA 3AE5B 1CJEA 2MP2B 3X0WA 3MHSD 3UQBA 1VLBA 2PJHA 3NZUA 3GE3C 4A20A 1ZKHA 4Q2JA 4BOZB 5BMHA 3ZJTA 2WWZA 3DDCB 4DHZE 1TBEA 3Q3NC 5H92C 3LYYA 2N7DA 1HZ5A 1XLQA 1QOGA 2VZKB 4FULA 4KKIA 2LI5A 3PHWB 1CZPA 3EFCA 3Q8CA 2IO2B 3PT2B 5BYRA 4ZRKA 5J18A 1P7FA 2K8BA 3OJ4B 4IWOA 1FO4A 3B1LX 1J7CA 2I2YA 1C76A 2ZPNA 3T8MA 2FIFA 3AE9B 1AWDA 1NI2A 2O6VD 4ZYNA 1PYWD 2WXLA 3AE4B 5BMGA 4IG7B 1J7AA 1FNWA 3NHEB 2MW5A 2K39A 1OQQA 2NPTA 4ASWC 4KSKC 3AXCA 4EOYA 3PLUA 4JWUC 5HI1A 5FR6A 2DWQA 3AEEB 4RF1A 2H88B 5CTRC 2H89B 3RULA 4MH0E 1FD6A 4UDUC 4MGYE 2WU5B 2AYOB 4PS8A 1WXSA 2PTLA 4PT5A 2ZW0A 3TL5A 2MLBA 2LD9A 4EE2A 2KVZA 4YTPB 3BIID 4LTUA 1T5XD 4KDLB 1ENFA 3L16A 3A4RA 1OEYJ 5IKCM 4GMVA 2BTEA 2DYMA 1HXYD 2PPHA 3RCZA 4G3XB 3AEDB 2M56B 4WWMA 5HKHA 2WP9B 4OZAA 3PREA 5JH5C 1V49A 3L54A 2JWUA 2WXHA 3DWMA 2HJ8A 2PEAA 1TS2A 4F8CB 1F2RI 1MI0A 2IDYA 3KQ4A 3NVYA 2L52A 4B0EA 4BAXA 3AE2B 3Q6BA 3UGBB 2PE6B 5HFYA 2C5LC 5IAAC 1JQ4A 5J17A 3TIXA 3RFZB 2Z8LA 2KWUB 2D3BA 3AM9A 5EE9A 3N20C 2KZRA 2JZZA 2INDC 1RWSA 2KYWA 2LUEA 1VZ6A 2JT4B 2AL6A 3V6CB 1WH3A 2AEHA 1UF0A 1XT9B 5G5GA 2K1FA 2BB5A 4IM0A 3UINB 2VH2A 1EWYC 4ZRPA 5EE0A 1L4ZB 4DHJD 3GZNI 2G9HD 4HPMB 2NBVB 4JX1C 2QMTA 2O2VA 3HM6X 1YNTE 1DGJA 4K1RB 3MC9A 4II2B 4US8A 2M17A 2BQQA 2GLSA 4KZCA 1TJEA 1KM7A 4A55A 2W3SA 2JRHA 4WJNA 3RN9C 2J0MA 2J0KA 3N9YC 2INPE 2O6VA 2HTME 4P6VF 1J7BA 2C7MB 2AQ1B 1NEKB 4ARCA 1V2YA 4IKGA 1V97A 1JCKB 1E6EB 1PQSA 5C1ZA 1WY8A 2WDTB 2KANA 3DWGC 4A90A 2JWZA 1PGXA 4OVZA 2WXRA 1SB3C 1WRDB 1CK1A 4DDID 3W1YA 3ZW3A 2Q5WD 3R2TA 3IAS1 1HQRD 4MJSB 3ZXRA 1VZ7A 3R8BA 2V0GA 3L0WB 1WF9A 4K81A 1V6EA 2IO3B 1EUVB 4NJ6A 2ZZPB 1EF5A 4TMAB 1WI0A 2INNE 3ZRCA 3PRPB 3H6NA 2L3ZA 1FEHA 1V1PB 3ZTCA 1RAXA 3KYDD 2DZIA 1IUEA 3BVZA 4DBGA 4WJPA 1LM8B 4YT0B 4RGMA 3DBLB 2JYEA 3DBRB 1AYFA 5L83A 5JHBA 2NR2A 4ANXA 2W3RA 3ZIMA 4KX6B 3URYA 1XD3B 3AEBB 1X1MA 2N9PC 5FK9C 4AJYB 2BYTA 2KLCA 4M0WA 3ZTDA 4X57B 4MM3B 3EA6A 4EEWA 2LHDA 2BYVE 2WS3B 4K7SA 2DZMA 3Q3MC 1FM0D 3QHTA 1LQBA 1P0RA 3AV8A 2LASA 1VDVA 2QDFA 2B3AA 3NS8A 3T3NA 2A4ZA 3BZDB 3DVGY 4KSLC 4P16A 3M3JA 4PYZA 4DHZB 3ZNZB 1WYWB 3ZVVA 4HWIB 3L17A 3CF6E 2CS4A 1ZDXA 3PTFC 1KLGD 2KJ6A 4KVGB 1UZXB 2MWSB 3L13A 3I57A 3KH0A 5DCNA 4HVBA 3ZYYX 1ZE3D 4PYUA 2KTRB 1FNVA 1M94A 1K8RB 4QAYA 4OVVA 3DHGC 1UNSA 2W55A 5IOIA 4ITKA 3ETRA 1WXMA 2NVUI 3U7ZA 1E9MA 3IT6B 3MP9A 1MHXA 2G4SA 1N6ZA 1PUTA 1Z2MA 3N30A 2MBQA 3IHPC 1TKGA 4REZA 4E74A 1JWAD 2FCSA 1EM7A 2MBEA 1BT0A 1P98A 5DPTA 1YD8U 2N1VA 2K0PA 3RNBC 4I6PA 2W9NA 2KN4A 3VXWA 2N7JA 2RGFA 2PVOD 2BS2B 4IWPA 2MJEA 2Y3AA 4ANWA 3VRAB 3RT3B 1FNUA 2ZCBA 2HDEA 1J0GA 3PZ8A 4NQKE 2V1YA 1I4HA 2IJ0A 4XC2A 3AE1B 4W9HA 4JGHB 4AS1A 3IBEA 4MELA 1Q10A 4JIOU 3Q2AC 1YQ4B 3BYYB 5MPOA 4GLSC 1OGWA 5FR3A 1YJ1A 1NYQA 3L10B 1NVID 2V4LA 4L23A 5BMIA 2C9WB 2KDMA 1HZ6A 2EKIA 4W9IA 4ZHPA 4XX5A 1Y8RC 4J6IA 1N5WA 3N3KB 3APDA 3SFDB 1CQVA 2M19A 4FADA 4YSZB 4MSMB 5H8YE 1MHHE 4XDDA 4A9AA 1VD2A 2G3QB 3BY4B 3PGEA 1WR1A 1D5XC 1JRPA 2UYZB 3BVGA 1E8WA 1MPEA 1TGZB 2MEKA 3TEYA 2Y5BB 2RR9A 1JWSD 2FCNA 3V62A 3ZQ4A 3AU4A 4EUTA 3JSVB 2OHFA 5DPRA 4HKQA 2WU2B 4HJKA 4IC7B 4XZ4A 4WJOA 1WE6A 3Q14C 5EE3A 2LJIA 1ROEA 3A33B 4C56C 5LXIB 1FFUA 1I4PA 5CX3A 4ACFA 4MDKE 4LNNA 2BVCA 2JX5A 3A9JB 1ZW7A 2L7RA 3ZO5B 2BS4B 2ONQA 4E71A 4F7ZA 2IY0B 2IGDA 2QCZA 2BW2A 1WX7A 3AE3B 2M0XA 3CSTA 3H7PB 1FIQA 4F1SA 2WXPA 4EZJA 1IBXA 3M63B 2W82A 1E7PB 2KMCA 2KLGA 3P4PB 1WXAA 2AQ3B 1V5TA 4HXDA 2BWES 1OQYA 3I9V1 1TZOA 2LEKA 5E6NA 3HRDD 3ZLZA 3M95A 5KHQA 2OOBB 4YTNB 3U2SC 2FNJB 4HEA1 5AUIA 2K6DB 4GU2A 4YWGG 1F0ZA 3ZNHB 2QJLA 3T3OA 3E9SA 4C7ZA 2CU1A 2KHWB 2KX3A 4NJCA 4XWTA 5D2MB 5AZHA 2WXQA 2WXOA 3ABVB 1TY0A 2IPKD 2GBNA 4B95A 5IA7A 2L0FA 3EECA 1C1YB 1J8CA 1WMHA 4XWWA 2KAJA 2M1MA 1WGDA 4GN1A 1C4AA 2UWQA 4EZLA 4ANUA 2BS3B 5CHVC 2J4XA 2KQ7A 3B2GA 2DYOA 2VZKD 4HPLB 1XCQL 1WJ4A 2MQJA 3W9CB 3EFUA 3RD2A 3RNGC 3A1QA 1WSPA 4WURA 2Z0DB 3C19A 1XLNA 1V5OA 2BB6A 3ZGZA 3LDZE 1N60A 3OJ3A 4W9EA 4XDCA 4M02A 4II3B 3DVNV 2REXA 4JWSC 5HHDG 2PVGC 3V3XA 1GOZA 4YTMB 2SAKA 2MA9B 4P7IA 3PLVA 2BBCA 2V4IB 4C00A 1WJNA 2BKFA 4M8NA 4PS3A 1SF0A 4HDQA 1YQ3B 1QKZA 1RFKA 3KW5B 4C80A 1WGGA 2CKHB 4MT5A 4KGRA 2NTSA 2AL3A 1I4QA 5BO4B 1WM3A 3WALA 2MH7A 1GC6A 2KD0A 2KFKA 3HM3A 3O13A 2GRIA 1JROA 2KDBA 4LJOB 2XBBC 4ZRIA 1TY2A 4GDKA 1IGCA 1VRAB 2XEWA 3HIZA 2CJNA 1T6BX 4MGKE 1C3TA 1YN3A 1I35A 1BUIC 1E7VA 1GUAB 1GAQB 3RI7C 3QWZB 2BYFA 3ML9A 1F1HA 3QX1A 1N5XA 1JALA 3AU5A 3KUZA 2KWVB 4IM3A 1LO5D 5AZFA 3B9JA 2GBJA 3AMZA 2GBKA 2J7QB 4W9CA 2JQRB 3VHTC 4NAWA 1WXQA 2BWFA 1ACCA 2L0TA 3VH3B 2IGGA 2KQSA 4KIKA 1F2RC 1TIFA 4S17A 1P3QU 2MP2A 2KQ4X 1TT5B 1T0QC 1AARA 2KTFA 3FC4A 1WFYA 2DYBA 5LXHA 3DQVA 2LVQA 3NJTA 2LVPA 4DWFA 2KDEB 4R3DA 3VR9B 3GZNB 3QJZA 4NAMA 4FN2A 3ECIA 4C4VB 1QOBA 3VFKA 4TUUA 4M01A 4URKA 2L8JA 1V8CA 3OG5A 2LRUA 2KX0A 1HA5A 5E6PA 3HUIA 2WX0A 3AE7B 1PDXA 1QOAA 1YN4A 4MH8A 1B9RA 3BYTB 4RNAA 1AW7A 2L83A 2WXJA 3AEGB 1XCTL 4HCPB 3V05A 2WYQA 1OQRA 2QILA 3IXSA 1KLVA 4P1BC 2M8SA 2JYTA 2N7EA 4WWNA 2WXNA 2Z59B 3S2AA 3I3TB 2RSUA 2ZEQA 2WHIA 4HDOA 4JPSA 3I5JC 2MBBB 3PVLA 5D7GA 2D10A 1B1ZA 1R4MI 3QA8A 1EF1A 1I7HA 2ZNVB 2K9XA 1SSNA 1H4RA 3KWVA 1R4NB 1UELA 5DPSA 4CQNA 1FCCC 1BMLC 4OZBA 2CJOA 4HCNB 4HKZE 1L0YB 3MHZA 3SHQA 2LVOA 1WM2A 2R2OA 2ZNVC 2M0AA 3MJ5A 4I6NB 2KWCA 1I4XA 4WAAA 2NTTA 2IZVB 3JW0X 4G50A 1WX8A 2JXTA 2CHWA 2N9LA 2HD5B 3WAOA 4EKUA 2CU3A 3LB8C 4FHKA 4IUMB 3PS6A 2QHOA 3Q3JA 3IAM1 3VTUA 4KKJA 1L0XB 2IO0B 2J42A 1QOFA 2M4NA 2ZJDA 1S3SG 2KKCA 4YL8A 1UWXA 2KJHB 4J3OD 2KXJA 1MG8A 2DENB 2QIEB 2SEBD 5G5HA 4GB9A 1RYJA 1NENB 2ZW1A 3IT4B 3NUHB 3NVZA 2JY6A 3KLSX 1FFVA 1MG4A 4ARIA 2D3GA 2FUHB 1FMAD 1UGJA 4RGOS 1ESFA 3I63C 1QLBB 1HEZE 1NI3A 2PW9A 3RYTA 2PKOA 3VAWA 3WANA 1F77A 4TQ1A 1KOTA 1SXTA 3FILB 5C3JB 2Z0EB 2QC8A 2KN5A 3R7RA 3LJ3A 2MX2A 1SJED 1JRUA 1QZEA 2IBIB 3NVVA 5GMVA 1L6UA 2K25A 2GBMA 2DBYA 3M62B 3ZXVA 2BGFA 2RDGA 4G0NB 1WYGA 1VR9A 4HROA 2LXAA 4OZCA 1MVKA 1Y56A 5L95C 4XGAB 1YX5B 4RMAA 1R7SA 2L00B 2QEJC 4GIVA 2K22A 4JL9A 3N32A 3P4RB 1GC7A 1E10A 1SBBB 1WZ3A 1KFYB 2TSSA 4GSWA 4W9KA 3AE6B 2E6XA 2RDBC 3AH7A 4ICUA 4MJSA 2N4FA 3GP7A 2J53A 1M4VA 2EELA 3AI5A 2OJRA 4EFOA 4BKSD 4FJZA 2MBOA 4NQLB 2DZJA 3NY5A 3DHIC 3OLMD 4ANVA 3DBHI 2WXMA 1WGKA 3RNEC 1XXGA 2FCQA 3V60A 1OTRB 4TQ0A 3SEBA 2JSVX 3C0RB 1P9DU 5BYQA 1V1PA 4W9FA 2DAFA 2LGXA 4FLHA 5LNK1 2WXFA 1QILA 2V3NA 4BFRA 2AWTA 3W5UB 1L5PA 4CHKA 2V9HA 1LGRA 2J52A 3W1SC 4P1CC 2XK5B 4WWPA 2D5GA 3MC0B 5E6JA 4BKTA 3AECB 2IO1B 4GGQA 2EMSA 3EC8A 4MM3A 4B0MA 3P2BA 3SU8X 4LNOA 4PK1A 1NDDA 3TBLD 4MGIE 1WIAA 3ZKJC 4TSSA 4ZRJA 1TKEA 2ASQA 2FE8A 3E56A 2ZPYA 2JF5A 2BKRB 4YSYB 4AUQC 3B08A 1DOXA 1ZDVA 2LFIA 1STEA 3H1UA
chains in the Genus database with same CATH topology
4W9GA 2LXCA 2Z0DB 5J2RA 2LRWA 4CO7A 4DHJD 3GZNI 1V5OA 3LDZE 5AZGA 3HHMA 4HPMB 2NBVB 3OJ3A 2KDIA 1SE9A 4W9EA 2O2VA 3HM6X 4NPNA 4GDLB 4K1RB 4II2B 2KTRA 4II3B 3DVNV 2REXA 2M17A 1RFAA 3H9DA 3D32A 4KZCA 1IP9A 5KHOA 1KM7A 2DHZA 1UH6A 2MA9B 2JZ3B 3B0AA 3WAMA 1UBQA 2JRHA 3PLVA 4P7IA 1WJNA 2BKFA 2EKEC 4M8NA 4WJNA 2J0MA 2KOXA 2J0KA 4PS3A 2O6VA 3PRMB 3KYCD 4HDQA 3RUIB 1TTNA 3ML8A 3BINA 1F9JA 3KW5B 2C7MB 4KDIC 2A5UA 1WGGA 1GG3A 2CKHB 3DVNU 4IWQA 2AL3A 2BYEA 4LCDE 1V2YA 3T9LA 1T0YA 2D2QA 1LXDA 5JHAA 5BO4B 1WM3A 1SGHA 3WALA 1GC6A 1WX9A 1PQSA 4AWJA 2KD0A 2KFKA 3HM3A 5C1ZA 3A9KA 3VTVA 1FXTB 5LLIA 1Q1OA 2K8HA 2FCMA 1YIWA 4BKSA 1WY8A 2WDTB 2KDBA 4LJOB 3QCAA 2XBBC 2KANA 4ZRIA 2MBHA 2WX1A 2G4DB 4GDKA 3W1SA 3PV1A 2XEWA 3HIZA 2JWZA 4MGKE 1C3TA 3PHXB 1WRDB 1E8YA 4DDID 2C7HA 1WJUA 2L05A 3W1YA 1WJ6A 3ZW3A 4BOSC 3NOBA 1V9JA 4LDTD 2NPTB 1E7VA 1I35A 4FJYA 1GUAB 1E5WA 3PSEB 3QWZB 4MJSB 2BYFA 2BPSA 3ML9A 1Q0WB 1UGMA 3QX1A 1E8ZA 3L0WB 1WGRA 1WF9A 4K81A 3ZNID 1V6EA 2KFKB 3AU5A 2CHZA 4TKNA 2IO3B 1EUVB 3A9KB 3KUZA 2KWVB 4IM3A 4NJ6A 5DPWA 2ZZPB 2DX5B 2K8CA 4LDTB 5AZFA 1EF5A 4B9KA 3ZUNA 1D3ZA 3MTNB 2GBJA 4MGZE 1WI0A 2GBKA 2J7QB 4W9CA 3VQIA 3ZRCA 3VHTC 2K6QA 4NAWA 4ZDVA 2BWFA 3PRPB 3ZDTA 3H6NA 2BF8B 2L0TA 3VH3B 2KQSA 2L3ZA 4KIKA 4RM9A 1P3QU 3ZTCA 2MP2A 1RAXA 4GOCA 3KYDD 2DZIA 1E8XA 3K9OB 3QC8B 4WJPA 4DBGA 1AARA 1LM8B 2KTFA 1WFYA 2FAZA 2DYBA 4JQWC 2LJ5A 4B6WA 5LXHA 3DQVA 3OAWA 2LVQA 4BBNC 2LVPA 5G55A 4DWFA 1H8CA 2KDEB 4EZKA 2KNBA 5C23A 3QJZA 4AOFA 5L83A 5JHBA 2NR2A 4ANXA 4FN2A 3ECIA 3DOWA 3ZIMA 3VFKA 4TUUA 1XD3B 4URKA 5D94A 5EDSA 2L8JA 1X1MA 2MSED 4IM2A 3CSFA 4OVUA 3R7QA 3KUCB 3JSVA 2N9PC 4AJYB 2LRUA 2KLCA 2KX0A 3ZTDA 4X57B 5E6PA 3VUYA 4EEWA 1YX6B 5CHFA 2BYVE 2WX0A 4K7SA 2DZMA 2C7NB 2RPQA 2MCNB 3QHTA 1LQBA 1EO6A 1P0RA 1YQBA 4LJPB 2LASA 1WMHB 2B3AA 4W9DA 1OEYA 1XQQA 3NS8A 3UQAA 2I1JA 2A4ZA 4G11A 1V81A 4WJQA 3DVGY 2DAJA 3QAQA 4KSLC 4PYZA 3M3JA 4DHZB 1VCBA 4HCPB 3ZNZB 1WYWB 1WZ0A 3ZVVA 2WYQA 4HWIB 2GMIC 3L17A 4RM8A 3K9PB 1KLVA 3RZFA 3A9JA 3CF6E 2RD0A 2M8SA 2N7EA 4WWNA 2CS4A 3CMMB 3H7SA 3A1QB 2Z59B 4JLCA 3PTFC 3I3TB 2RSUA 3S2AA 4AJWA 4NNJB 3PZDA 5CHWA 3WAPA 2KJ6A 1E7UA 2ZEQA 4HDOA 3VUWA 3H7PA 2MBBB 3PVLA 1IYFA 3JVZX 4KVGB 1UZXB 5D7GA 2MWSB 4DXAB 3L13A 3KH0A 2D10A 5DCNA 3AULA 1WE7A 4N9F4 4HVBA 3WIMA 2O2VB 1R4MI 4WWOA 4KV2A 3QA8A 4PYUA 1EF1A 2KTRB 4GXBA 4BVUC 1M94A 4W9JA 3SD5A 2DZKA 3U7DA 1K8RB 2ZNVB 3R3MA 4OVVA 2JVCA 1H4RA 2NBUA 1RRBA 2N1WA 1UELA 5DPSA 3L08A 2KDFB 5D6JB 1WXMA 2N9EB 2NVUI 4DDGD 4HCNB 1TZ1A 4M8MA 3SHQA 2LVOA 1WR6E 2O6VB 2LGDA 2IYDB 3DCGA 4NY0A 3ZDMC 2GBRA 3IVFA 1WM2A 2G4SA 2R2OA 1V86A 2ZNVC 3Q3FA 4HLEA 2HTHA 1Z2MA 5TR5A 4I6NB 2KWCA 4HK2A 2KK8A 3N30A 2MBQA 4WAAA 3V6EB 2IZVB 3IHPC 3JW0X 4E74A 4G50A 2FCSA 1WX8A 2MBEA 3QIJA 3V61A 2XK5A 1BT0A 1P98A 5DPTA 1YD8U 1J19A 2N1VA 4K7UA 2CHWA 3WAOA 2HD5B 2MRPA 4I6PA 2C60A 2W9NA 4EKUA 3RZWC 1GNUA 2KFJA 3VXWA 4FHKA 4IUMB 2J0JA 3PS6A 3U8ZA 2QHOA 4BKGA 1L7YA 2RGFA 4WQOB 4GDKB 4IWPA 3Q3JA 3SDLC 2KMAA 1Q5WB 4ANWA 3VTUA 1WGHA 1L2NA 3RT3B 3A4SC 2IY1B 3O65B 2IO0B 2LGYA 2ZCBA 2M4NA 2JXXA 1J0GA 2ZJDA 2D11A 4NQKE 1S3SG 2KKCA 2V1YA 1IPGA 4YL8A 3ZNGC 2ZVOA 4XC2A 3ALBA 3UF8A 4W9HA 2CR5A 4JGHB 2KJHB 1SIFA 2KXJA 4PS7A 3IBEA 4ICVA 4MELA 1MG8A 3TCAA 4A3OA 2DENB 2KC2A 4JIOU 3VH4B 4GB9A 4FA6A 5AEKB 1CMXB 2ZVNA 1G6JA 4AP4C 4DK5A 1GJZA 2JY6A 2YVCA 3WA0A 3R66C 3PRZA 2JRIB 2D3GA 1OGWA 2FUHB 3UIOB 1YJ1A 4IW0A 3X23A 2KO3A 3L10B 2JUOA 4KZ0A 4NAWB 2V4LA 2NCNA 3DVGX 4TV3A 5G2NA 3VTWA 2D07B 3RYTA 2C9WB 1A5RA 3KUDB 3VAWA 3WANA 1U4AA 4W9IA 4KIKB 4GDLA 4FHJA 4XX5A 1Y8RC 4J6IA 2MP2B 1ISNA 3APDA 3N3KB 3X0WA 1UBIA 3MHSD 3ONSA 4TQ1A 1KOTA 3UQBA 3VDZA 4FADA 3ENEA 4MSMB 2PJHA 3NZUA 2Z0EB 1VD2A 4A20A 2G3QB 1ZKHA 3BY4B 3NZSA 4BOZB 3PGEA 1WR1A 2KN5A 2CHXA 3R7RA 2WWZA 2NBWB 3DDCB 3LJ3A 2V3SA 3U30A 4DHZE 1TBEA 2MX2A 2UYZB 1E8WA 1JRUA 1QZEA 2LWPA 2IBIB 1TGZB 3DPDA 3QK0A 2N7DA 5GMVA 2K25A 2Y5BB 2GBMA 1ZGUB 2RR9A 4FULA 2HE7A 3M62B 2FCNA 2LI5A 3PHWB 3V62A 2IO2B 3AU4A 3PT2B 4EUTA 2BGFA 3JSVB 4CYEA 4G0NB 4M0WB 4ZRKA 5J18A 2K8BA 5DPRA 3OJ4B 4IWOA 4W9LA 3B1LX 4HJKA 2LXAA 4IC7B 4DHJB 2ZPNA 3T8MA 5L95C 2FIFA 4MEMA 4XZ4A 3TJPA 1YX5B 1NI2A 4RMAA 4WJOA 3DBSA 2O6VD 1WE6A 2L00B 3VUXA 2KC1A 4ZYNA 4GIVA 4JL9A 3N32A 3MJWA 3A33B 4IG7B 1GC7A 5LXIB 5CX3A 3NHEB 1P1AA 2MW5A 4MDKE 2K39A 1WZ3A 4GSWA 2NPTA 3JYUA 4W9KA 4KSKC 3AXCA 4ASWC 3A9JB 4EOYA 3PLUA 4ICUA 4MSQB 4MJSA 4BBNF 1ZW7A 2L7RA 2N4FA 3ZO5B 4K7WA 3GOEA 2R2QA 1Z5SB 4E71A 4F7ZA 3AI5A 5FR6A 2L76A 2IY0B 2OJRA 4EFOA 5CTRC 1WX7A 3IFWB 4BKSD 2M0XA 4FJZA 3RULA 2MBOA 3CSTA 2DZJA 3H7PB 3NY5A 4NQLB 4F1SA 4MH0E 3OLMD 4NJ7A 4EZJA 4MGYE 3M63B 2LZ6A 2AYOB 4ANVA 3DBHI 4PS8A 1WXSA 1V80A 1UD7A 1RLFA 2N9XA 2FCQA 3V60A 1OTRB 2KMCA 3UIPB 2KLGA 3PPAA 4TQ0A 1HE8A 1WXAA 3TL5A 2MLBA 3C0RB 1P9DU 2KVRA 1V5TA 2LD9A 2ZCCA 3ZRFA 4W9FA 4HXDA 2BWES 2DAFA 1OQYA 2LGXA 4FLHA 3TMPB 1R4NI 4KDLB 5E6NA 3QARA 3ZLZA 3M95A 5KHQA 4BFRA 2I1KA 2OOBB 3L16A 3A4RA 1OEYJ 4GMVA 2AWTA 5JZEB 2DYMA 2YLMA 2FNJB 2KJRA 5E6OA 1KJTA 2PPHA 3APFA 3QQ8B 4G3XB 3RCZA 2K6DB 4CHKA 4GU2A 2PE9A 5HKHA 3W1SC 3ZNHB 3PREA 5JH5C 1V49A 2NS5A 3L54A 4E3CA 2XK5B 4WWPA 4FJVB 1E90A 2HJ8A 2PEAA 4BKTA 2IO1B 1LFDA 4GGQA 2EMSA 1WGYA 4F8CB 3KVFB 2CU1A 1WXVA 2KHWB 3APCA 3EC8A 3IG3A 4MM3A 3P2BA 3SU8X 2KX3A 3UGBB 3EHVA 2PE6B 2C5LC 5D2MB 5AZHA 5IAAC 5J17A 1NDDA 2GBNA 3TIXA 4B95A 5IA7A 2L0FA 3TBLD 2KWUB 1C1YB 3EECA 1WIAA 4MGIE 2EMTA 1WMHA 3ZKJC 1J8CA 4ZRJA 2M1MA 2KZRA 2GOWA 2JZZA 3VVWB 2ASQA 1WGDA 4GN1A 1I42A 2VRRB 2UWQA 2ZPYA 2LUEA 2JPHA 4EZLA 4ANUA 2JT4B 2AL6A 2G45B 2JF5A 2BKRB 3V6CB 1NBFC 5CHVC 4FBJB 4AUQC 3B08A 4I6LB 1WH3A 2KQ7A 2AEHA 2FIDA 1XT9B 2DYOA 3HK0A 3DBLI 4HPLB 1S1QB 1WJ4A 2MQJA 4A3PA 2K1FA 3EFUA 3DBRI 4IM0A 3RD2A 3H1UA 3UINB 3A1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9G A;  2LXC A;  2Z0D B;  5J2R A;  2LRW A;  4CO7 A;  4DHJ D;  3GZN I;  1V5O A;  3LDZ E;  5AZG A;  3HHM A;  4HPM B;  2NBV B;  3OJ3 A;  2KDI A;  1SE9 A;  4W9E A;  2O2V A;  3HM6 X;  4NPN A;  4GDL B;  4K1R B;  4II2 B;  2KTR A;  4II3 B;  3DVN V;  2REX A;  2M17 A;  1RFA A;  3H9D A;  3D32 A;  4KZC A;  1IP9 A;  5KHO A;  1KM7 A;  2DHZ A;  1UH6 A;  2MA9 B;  2JZ3 B;  3B0A A;  3WAM A;  1UBQ A;  2JRH A;  3PLV A;  4P7I A;  1WJN A;  2BKF A;  2EKE C;  4M8N A;  4WJN A;  2J0M A;  2KOX A;  2J0K A;  4PS3 A;  2O6V A;  3PRM B;  3KYC D;  4HDQ A;  3RUI B;  1TTN A;  3ML8 A;  3BIN A;  1F9J A;  3KW5 B;  2C7M B;  4KDI C;  2A5U A;  1WGG A;  1GG3 A;  2CKH B;  3DVN U;  4IWQ A;  2AL3 A;  2BYE A;  4LCD E;  1V2Y A;  3T9L A;  1T0Y A;  2D2Q A;  1LXD A;  5JHA A;  5BO4 B;  1WM3 A;  1SGH A;  3WAL A;  1GC6 A;  1WX9 A;  1PQS A;  4AWJ A;  2KD0 A;  2KFK A;  3HM3 A;  5C1Z A;  3A9K A;  3VTV A;  1FXT B;  5LLI A;  1Q1O A;  2K8H A;  2FCM A;  1YIW A;  4BKS A;  1WY8 A;  2WDT B;  2KDB A;  4LJO B;  3QCA A;  2XBB C;  2KAN A;  4ZRI A;  2MBH A;  2WX1 A;  2G4D B;  4GDK A;  3W1S A;  3PV1 A;  2XEW A;  3HIZ A;  2JWZ A;  4MGK E;  1C3T A;  3PHX B;  1WRD B;  1E8Y A;  4DDI D;  2C7H A;  1WJU A;  2L05 A;  3W1Y A;  1WJ6 A;  3ZW3 A;  4BOS C;  3NOB A;  1V9J A;  4LDT D;  2NPT B;  1E7V A;  1I35 A;  4FJY A;  1GUA B;  1E5W A;  3PSE B;  3QWZ B;  4MJS B;  2BYF A;  2BPS A;  3ML9 A;  1Q0W B;  1UGM A;  3QX1 A;  1E8Z A;  3L0W B;  1WGR A;  1WF9 A;  4K81 A;  3ZNI D;  1V6E A;  2KFK B;  3AU5 A;  2CHZ A;  4TKN A;  2IO3 B;  1EUV B;  3A9K B;  3KUZ A;  2KWV B;  4IM3 A;  4NJ6 A;  5DPW A;  2ZZP B;  2DX5 B;  2K8C A;  4LDT B;  5AZF A;  1EF5 A;  4B9K A;  3ZUN A;  1D3Z A;  3MTN B;  2GBJ A;  4MGZ E;  1WI0 A;  2GBK A;  2J7Q B;  4W9C A;  3VQI A;  3ZRC A;  3VHT C;  2K6Q A;  4NAW A;  4ZDV A;  2BWF A;  3PRP B;  3ZDT A;  3H6N A;  2BF8 B;  2L0T A;  3VH3 B;  2KQS A;  2L3Z A;  4KIK A;  4RM9 A;  1P3Q U;  3ZTC A;  2MP2 A;  1RAX A;  4GOC A;  3KYD D;  2DZI A;  1E8X A;  3K9O B;  3QC8 B;  4WJP A;  4DBG A;  1AAR A;  1LM8 B;  2KTF A;  1WFY A;  2FAZ A;  2DYB A;  4JQW C;  2LJ5 A;  4B6W A;  5LXH A;  3DQV A;  3OAW A;  2LVQ A;  4BBN C;  2LVP A;  5G55 A;  4DWF A;  1H8C A;  2KDE B;  4EZK A;  2KNB A;  5C23 A;  3QJZ A;  4AOF A;  5L83 A;  5JHB A;  2NR2 A;  4ANX A;  4FN2 A;  3ECI A;  3DOW A;  3ZIM A;  3VFK A;  4TUU A;  1XD3 B;  4URK A;  5D94 A;  5EDS A;  2L8J A;  1X1M A;  2MSE D;  4IM2 A;  3CSF A;  4OVU A;  3R7Q A;  3KUC B;  3JSV A;  2N9P C;  4AJY B;  2LRU A;  2KLC A;  2KX0 A;  3ZTD A;  4X57 B;  5E6P A;  3VUY A;  4EEW A;  1YX6 B;  5CHF A;  2BYV E;  2WX0 A;  4K7S A;  2DZM A;  2C7N B;  2RPQ A;  2MCN B;  3QHT A;  1LQB A;  1EO6 A;  1P0R A;  1YQB A;  4LJP B;  2LAS A;  1WMH B;  2B3A A;  4W9D A;  1OEY A;  1XQQ A;  3NS8 A;  3UQA A;  2I1J A;  2A4Z A;  4G11 A;  1V81 A;  4WJQ A;  3DVG Y;  2DAJ A;  3QAQ A;  4KSL C;  4PYZ A;  3M3J A;  4DHZ B;  1VCB A;  4HCP B;  3ZNZ B;  1WYW B;  1WZ0 A;  3ZVV A;  2WYQ A;  4HWI B;  2GMI C;  3L17 A;  4RM8 A;  3K9P B;  1KLV A;  3RZF A;  3A9J A;  3CF6 E;  2RD0 A;  2M8S A;  2N7E A;  4WWN A;  2CS4 A;  3CMM B;  3H7S A;  3A1Q B;  2Z59 B;  4JLC A;  3PTF C;  3I3T B;  2RSU A;  3S2A A;  4AJW A;  4NNJ B;  3PZD A;  5CHW A;  3WAP A;  2KJ6 A;  1E7U A;  2ZEQ A;  4HDO A;  3VUW A;  3H7P A;  2MBB B;  3PVL A;  1IYF A;  3JVZ X;  4KVG B;  1UZX B;  5D7G A;  2MWS B;  4DXA B;  3L13 A;  3KH0 A;  2D10 A;  5DCN A;  3AUL A;  1WE7 A;  4N9F 4;  4HVB A;  3WIM A;  2O2V B;  1R4M I;  4WWO A;  4KV2 A;  3QA8 A;  4PYU A;  1EF1 A;  2KTR B;  4GXB A;  4BVU C;  1M94 A;  4W9J A;  3SD5 A;  2DZK A;  3U7D A;  1K8R B;  2ZNV B;  3R3M A;  4OVV A;  2JVC A;  1H4R A;  2NBU A;  1RRB A;  2N1W A;  1UEL A;  5DPS A;  3L08 A;  2KDF B;  5D6J B;  1WXM A;  2N9E B;  2NVU I;  4DDG D;  4HCN B;  1TZ1 A;  4M8M A;  3SHQ A;  2LVO A;  1WR6 E;  2O6V B;  2LGD A;  2IYD B;  3DCG A;  4NY0 A;  3ZDM C;  2GBR A;  3IVF A;  1WM2 A;  2G4S A;  2R2O A;  1V86 A;  2ZNV C;  3Q3F A;  4HLE A;  2HTH A;  1Z2M A;  5TR5 A;  4I6N B;  2KWC A;  4HK2 A;  2KK8 A;  3N30 A;  2MBQ A;  4WAA A;  3V6E B;  2IZV B;  3IHP C;  3JW0 X;  4E74 A;  4G50 A;  2FCS A;  1WX8 A;  2MBE A;  3QIJ A;  3V61 A;  2XK5 A;  1BT0 A;  1P98 A;  5DPT A;  1YD8 U;  1J19 A;  2N1V A;  4K7U A;  2CHW A;  3WAO A;  2HD5 B;  2MRP A;  4I6P A;  2C60 A;  2W9N A;  4EKU A;  3RZW C;  1GNU A;  2KFJ A;  3VXW A;  4FHK A;  4IUM B;  2J0J A;  3PS6 A;  3U8Z A;  2QHO A;  4BKG A;  1L7Y A;  2RGF A;  4WQO B;  4GDK B;  4IWP A;  3Q3J A;  3SDL C;  2KMA A;  1Q5W B;  4ANW A;  3VTU A;  1WGH A;  1L2N A;  3RT3 B;  3A4S C;  2IY1 B;  3O65 B;  2IO0 B;  2LGY A;  2ZCB A;  2M4N A;  2JXX A;  1J0G A;  2ZJD A;  2D11 A;  4NQK E;  1S3S G;  2KKC A;  2V1Y A;  1IPG A;  4YL8 A;  3ZNG C;  2ZVO A;  4XC2 A;  3ALB A;  3UF8 A;  4W9H A;  2CR5 A;  4JGH B;  2KJH B;  1SIF A;  2KXJ A;  4PS7 A;  3IBE A;  4ICV A;  4MEL A;  1MG8 A;  3TCA A;  4A3O A;  2DEN B;  2KC2 A;  4JIO U;  3VH4 B;  4GB9 A;  4FA6 A;  5AEK B;  1CMX B;  2ZVN A;  1G6J A;  4AP4 C;  4DK5 A;  1GJZ A;  2JY6 A;  2YVC A;  3WA0 A;  3R66 C;  3PRZ A;  2JRI B;  2D3G A;  1OGW A;  2FUH B;  3UIO B;  1YJ1 A;  4IW0 A;  3X23 A;  2KO3 A;  3L10 B;  2JUO A;  4KZ0 A;  4NAW B;  2V4L A;  2NCN A;  3DVG X;  4TV3 A;  5G2N A;  3VTW A;  2D07 B;  3RYT A;  2C9W B;  1A5R A;  3KUD B;  3VAW A;  3WAN A;  1U4A A;  4W9I A;  4KIK B;  4GDL A;  4FHJ A;  4XX5 A;  1Y8R C;  4J6I A;  2MP2 B;  1ISN A;  3APD A;  3N3K B;  3X0W A;  1UBI A;  3MHS D;  3ONS A;  4TQ1 A;  1KOT A;  3UQB A;  3VDZ A;  4FAD A;  3ENE A;  4MSM B;  2PJH A;  3NZU A;  2Z0E B;  1VD2 A;  4A20 A;  2G3Q B;  1ZKH A;  3BY4 B;  3NZS A;  4BOZ B;  3PGE A;  1WR1 A;  2KN5 A;  2CHX A;  3R7R A;  2WWZ A;  2NBW B;  3DDC B;  3LJ3 A;  2V3S A;  3U30 A;  4DHZ E;  1TBE A;  2MX2 A;  2UYZ B;  1E8W A;  1JRU A;  1QZE A;  2LWP A;  2IBI B;  1TGZ B;  3DPD A;  3QK0 A;  2N7D A;  5GMV A;  2K25 A;  2Y5B B;  2GBM A;  1ZGU B;  2RR9 A;  4FUL A;  2HE7 A;  3M62 B;  2FCN A;  2LI5 A;  3PHW B;  3V62 A;  2IO2 B;  3AU4 A;  3PT2 B;  4EUT A;  2BGF A;  3JSV B;  4CYE A;  4G0N B;  4M0W B;  4ZRK A;  5J18 A;  2K8B A;  5DPR A;  3OJ4 B;  4IWO A;  4W9L A;  3B1L X;  4HJK A;  2LXA A;  4IC7 B;  4DHJ B;  2ZPN A;  3T8M A;  5L95 C;  2FIF A;  4MEM A;  4XZ4 A;  3TJP A;  1YX5 B;  1NI2 A;  4RMA A;  4WJO A;  3DBS A;  2O6V D;  1WE6 A;  2L00 B;  3VUX A;  2KC1 A;  4ZYN A;  4GIV A;  4JL9 A;  3N32 A;  3MJW A;  3A33 B;  4IG7 B;  1GC7 A;  5LXI B;  5CX3 A;  3NHE B;  1P1A A;  2MW5 A;  4MDK E;  2K39 A;  1WZ3 A;  4GSW A;  2NPT A;  3JYU A;  4W9K A;  4KSK C;  3AXC A;  4ASW C;  3A9J B;  4EOY A;  3PLU A;  4ICU A;  4MSQ B;  4MJS A;  4BBN F;  1ZW7 A;  2L7R A;  2N4F A;  3ZO5 B;  4K7W A;  3GOE A;  2R2Q A;  1Z5S B;  4E71 A;  4F7Z A;  3AI5 A;  5FR6 A;  2L76 A;  2IY0 B;  2OJR A;  4EFO A;  5CTR C;  1WX7 A;  3IFW B;  4BKS D;  2M0X A;  4FJZ A;  3RUL A;  2MBO A;  3CST A;  2DZJ A;  3H7P B;  3NY5 A;  4NQL B;  4F1S A;  4MH0 E;  3OLM D;  4NJ7 A;  4EZJ A;  4MGY E;  3M63 B;  2LZ6 A;  2AYO B;  4ANV A;  3DBH I;  4PS8 A;  1WXS A;  1V80 A;  1UD7 A;  1RLF A;  2N9X A;  2FCQ A;  3V60 A;  1OTR B;  2KMC A;  3UIP B;  2KLG A;  3PPA A;  4TQ0 A;  1HE8 A;  1WXA A;  3TL5 A;  2MLB A;  3C0R B;  1P9D U;  2KVR A;  1V5T A;  2LD9 A;  2ZCC A;  3ZRF A;  4W9F A;  4HXD A;  2BWE S;  2DAF A;  1OQY A;  2LGX A;  4FLH A;  3TMP B;  1R4N I;  4KDL B;  5E6N A;  3QAR A;  3ZLZ A;  3M95 A;  5KHQ A;  4BFR A;  2I1K A;  2OOB B;  3L16 A;  3A4R A;  1OEY J;  4GMV A;  2AWT A;  5JZE B;  2DYM A;  2YLM A;  2FNJ B;  2KJR A;  5E6O A;  1KJT A;  2PPH A;  3APF A;  3QQ8 B;  4G3X B;  3RCZ A;  2K6D B;  4CHK A;  4GU2 A;  2PE9 A;  5HKH A;  3W1S C;  3ZNH B;  3PRE A;  5JH5 C;  1V49 A;  2NS5 A;  3L54 A;  4E3C A;  2XK5 B;  4WWP A;  4FJV B;  1E90 A;  2HJ8 A;  2PEA A;  4BKT A;  2IO1 B;  1LFD A;  4GGQ A;  2EMS A;  1WGY A;  4F8C B;  3KVF B;  2CU1 A;  1WXV A;  2KHW B;  3APC A;  3EC8 A;  3IG3 A;  4MM3 A;  3P2B A;  3SU8 X;  2KX3 A;  3UGB B;  3EHV A;  2PE6 B;  2C5L C;  5D2M B;  5AZH A;  5IAA C;  5J17 A;  1NDD A;  2GBN A;  3TIX A;  4B95 A;  5IA7 A;  2L0F A;  3TBL D;  2KWU B;  1C1Y B;  3EEC A;  1WIA A;  4MGI E;  2EMT A;  1WMH A;  3ZKJ C;  1J8C A;  4ZRJ A;  2M1M A;  2KZR A;  2GOW A;  2JZZ A;  3VVW B;  2ASQ A;  1WGD A;  4GN1 A;  1I42 A;  2VRR B;  2UWQ A;  2ZPY A;  2LUE A;  2JPH A;  4EZL A;  4ANU A;  2JT4 B;  2AL6 A;  2G45 B;  2JF5 A;  2BKR B;  3V6C B;  1NBF C;  5CHV C;  4FBJ B;  4AUQ C;  3B08 A;  4I6L B;  1WH3 A;  2KQ7 A;  2AEH A;  2FID A;  1XT9 B;  2DYO A;  3HK0 A;  3DBL I;  4HPL B;  1S1Q B;  1WJ4 A;  2MQJ A;  4A3P A;  2K1F A;  3EFU A;  3DBR I;  4IM0 A;  3RD2 A;  3H1U A;  3UIN B;  3A1Q A; 
#chains in the Genus database with same CATH topology
 4N59 A;  5J2R A;  4CO7 A;  1D5M C;  3Q8A A;  2WNM A;  1EU4 A;  3HHM A;  4AQ7 A;  1KH0 A;  4NPN A;  4GDL B;  2OED A;  1TS3 A;  2KTR A;  1L4D B;  1RFA A;  3H9D A;  3D32 A;  5KHO A;  4US9 A;  5GXG B;  4LNI A;  1UH6 A;  3WAM A;  1UBQ A;  3Q8B A;  2EKE C;  4IDI A;  2WDR B;  2YEP F;  3KYC D;  1TTN A;  3BK1 A;  3ML8 A;  1VZ8 A;  4KDI C;  2KMM A;  2XN9 C;  1ZXH A;  3T9L A;  2D2Q A;  5JHA A;  3NVW A;  4S0R A;  1GB1 A;  3SR6 A;  3A9K A;  3VTV A;  1FXT B;  2K8H A;  2FCM A;  1YIW A;  4BKS A;  2MBH A;  2WX1 A;  2E3T A;  2G4D B;  3W1S A;  1NYR A;  2L05 A;  1WJU A;  2L1A A;  3NOB A;  1V9J A;  2NPT B;  1E5W A;  2BPS A;  1C9F A;  1E8Z A;  1WGR A;  3DHH C;  2X38 A;  2KFK B;  4TKN A;  2K8C A;  4MGZ E;  3NG0 A;  2K6Q A;  4IOI E;  1PGA A;  4ZDV A;  3ZDT A;  2BF8 B;  4RM9 A;  2G1E A;  4ZRQ A;  3K9O B;  1UWM A;  1ET9 A;  2B76 B;  3GB1 A;  2FAZ A;  2LJ5 A;  3OAW A;  1H8C A;  4EZK A;  5C23 A;  1AN8 A;  2MHJ A;  4M00 A;  2D3C A;  1QF6 A;  2WDQ B;  2LMC A;  1IGD A;  4IM2 A;  4OVU A;  3R7Q A;  3JSV A;  2BT6 A;  3VUY A;  1YX6 B;  1DOY A;  2RPQ A;  2RDH A;  2MCN B;  4LJP B;  4ZHO A;  3GE8 C;  1SEB D;  2I1J A;  4K3C A;  3HVZ A;  1P7E A;  3TEZ A;  3EUB 2;  4WJQ A;  3QAQ A;  2DAJ A;  3OWE B;  1JWM D;  1VCB A;  1WZ0 A;  3RZF A;  3A9J A;  2Y5C A;  4RFB A;  3CMM B;  3H7S A;  3CIR B;  3P4S B;  4YXD B;  4AJW A;  5CHW A;  3WAP A;  1E7U A;  4XE0 A;  3H7P A;  1IYF A;  5C2T B;  3JVZ X;  4DXA B;  4L2Y A;  1XF5 L;  1UUP A;  3Q8E A;  4N9F 4;  2K5P A;  2O2V B;  4WWO A;  2JZP A;  2DNF A;  4GXB A;  4BVU C;  1D4B A;  1K52 A;  1L0V B;  2NBU A;  1JWB D;  1RRB A;  2N1W A;  2JU6 X;  1WWT A;  1TS5 A;  1ET6 A;  1C79 A;  4DDG D;  1K53 A;  1TZ1 A;  1A70 A;  2RPV A;  2O6V B;  2IYD B;  3DCG A;  3ZDM C;  2GBR A;  3IVF A;  3Q8F A;  1TYG B;  3Q3F A;  4HLE A;  2HTH A;  5TR5 A;  1FXA A;  4D2K A;  2KK8 A;  2Y5P A;  4BZA A;  2N9K A;  4ZYS A;  1EWC A;  2YEP B;  1DYQ A;  4RF0 A;  1F52 A;  3N1X C;  3RZW C;  1GNU A;  1SJH D;  2KFJ A;  1ZP0 B;  3UI3 A;  5AUK A;  1PFD A;  1FRR A;  3SDL C;  2KMA A;  1K50 A;  3H8H A;  5D3D A;  1L2N A;  3W5V B;  3O65 B;  2LGY A;  4LNF A;  1YMH E;  2ZVO A;  1VJK A;  3UF8 A;  2CR5 A;  4PS7 A;  4A3O A;  3WCQ A;  2ICI A;  3VH4 B;  4FA6 A;  1CMX B;  2ZVN A;  1G6J A;  4AP4 C;  1ZXI A;  1GJZ A;  2GI9 A;  4DXF A;  3R66 C;  3AEA B;  3X23 A;  2KO3 A;  2JUO A;  1T0R C;  2PLP A;  3KUD B;  1XLP A;  4FHJ A;  3NS1 A;  1ISN A;  1PGB A;  1UBI A;  3ONS A;  2AQ2 B;  3VDZ A;  2D3A A;  3ENE A;  1E0Z A;  3NZS A;  2CHX A;  3KWL A;  2NBW B;  2V3S A;  3U30 A;  1JW9 D;  2LWP A;  3DPD A;  1JWU D;  2UU7 A;  3QK0 A;  1V1O A;  1ZGU B;  2HE7 A;  1R4M B;  5EE1 A;  4A8X C;  4CYE A;  4M0W B;  4W9L A;  1N61 A;  4DHJ B;  3N1Z C;  4MEM A;  4WAF A;  3TJP A;  3DBS A;  3LXF A;  3P1M A;  3VUX A;  2KC1 A;  3MJW A;  3PO0 A;  1ZPS A;  1P1A A;  1HTO A;  5IN7 A;  4JE3 B;  1SE4 A;  3JYU A;  1GPX A;  4MSQ B;  1I4G A;  4BBN F;  4K7W A;  3J9C A;  3GOE A;  2R2Q A;  1Z5S B;  2L76 A;  3TEX A;  3RPF C;  3IFW B;  1WRI A;  5D3I B;  3BVM A;  4NJ7 A;  2LZ6 A;  1D6E C;  3MC8 A;  1V80 A;  1UD7 A;  1RLF A;  2N9X A;  3HVD A;  3UIP B;  3PPA A;  1HE8 A;  3Q69 A;  3ZRF A;  2ZCC A;  2KVR A;  3TMP B;  1R4N I;  3QAR A;  4C7Y A;  2I1K A;  2AX5 A;  3VRB B;  5JZE B;  1YN5 A;  1EU3 A;  1YJJ A;  2KJR A;  2YLM A;  5E6O A;  4RGT A;  2LUM A;  1KJT A;  3QQ8 B;  3APF A;  2PE9 A;  2WQY B;  1JML A;  4MAC A;  4C4V A;  2NS5 A;  2VH1 A;  4E3C A;  4FJV B;  1E90 A;  1YJI A;  1LFD A;  1WGY A;  3KVF B;  1WXV A;  3APC A;  3IG3 A;  4DQO C;  3EHV A;  2WXK A;  2RMM A;  4RH6 A;  2ACZ B;  2GB1 A;  2EMT A;  3VVW B;  2GOW A;  2IGH A;  4OHJ A;  1I42 A;  2VRR B;  4YSX B;  2I38 A;  2JPH A;  2G45 B;  4FBJ B;  1NBF C;  3AEF B;  4I6L B;  4L1B A;  4LNK A;  2FID A;  3HK0 A;  3DBL I;  4N58 A;  1S1Q B;  2V3P A;  3N1Y C;  4A3P A;  2DLB A;  3DBR I;  4LLG M;  4WQM A;  3AN1 A;  4W9G A;  2LXC A;  3RNC C;  2LRW A;  1I4R A;  4N6E B;  2R61 A;  1KTK A;  5AZG A;  3Q3O C;  1FCL A;  1FXI A;  2KDI A;  1SE9 A;  2N0S B;  5TSS A;  4NZL B;  2PMV A;  2PIA A;  1OFF A;  2MJ3 A;  4HRS A;  1C77 A;  1IP9 A;  2DHZ A;  1L6V A;  2JZ3 B;  1SE2 A;  3B0A A;  2KOX A;  3U4E G;  3PRM B;  5BYS A;  3RUI B;  1ZUD 2;  3EGR A;  3BIN A;  1F9J A;  2A5U A;  1GG3 A;  3DVN U;  4IWQ A;  4A6Q A;  3TUO A;  2BYE A;  2XNA C;  3DBH B;  4LCD E;  4KGS A;  1KRH A;  3NRZ A;  1T0Y A;  1LXD A;  1SGH A;  4AWJ A;  1WX9 A;  2WGS A;  3AE8 B;  5LLI A;  1Q1O A;  1N63 A;  3QCA A;  1N62 A;  3PV1 A;  3L4P A;  3PHX B;  4ZOH C;  1E8Y A;  4DXG A;  2C7H A;  4BOS C;  1WJ6 A;  3R2I A;  4LDT D;  4FJY A;  3PSE B;  1Q0W B;  1UGM A;  2KT7 A;  3ZNI D;  5FKA C;  1C78 A;  2X8X X;  2CHZ A;  3A9K B;  5IP4 D;  3FAH A;  1FRD A;  5DPW A;  2DX5 B;  4LDT B;  1K51 A;  4B9K A;  1IBX B;  3ZUN A;  1D3Z A;  3MTN B;  1D5Z C;  3VQI A;  4LK0 M;  1MFW A;  4XYC A;  3AB5 A;  3P42 A;  4GOC A;  2OJW A;  3VR8 B;  1E8X A;  3QC8 B;  1YOV B;  3FIL A;  4JQW C;  4HPP A;  4B6W A;  4BBN C;  5G55 A;  5HG2 A;  2KNB A;  3P63 A;  1TKY A;  4AOF A;  3DOW A;  3RNF C;  1DOI A;  5D94 A;  5EDS A;  2MSE D;  3CSF A;  5IO9 A;  3FKY A;  3KUC B;  1HTQ A;  4K3B A;  1SE3 A;  5CHF A;  2C7N B;  1XEE A;  1KLU D;  1EO6 A;  4H2A A;  1YQB A;  3GS2 A;  3BWU D;  1WMH B;  4W9D A;  1OEY A;  1XQQ A;  1T0S C;  1QQR A;  3UQA A;  4G11 A;  1V81 A;  2WLB A;  3MFG A;  2QSD A;  4FXC A;  2GMI C;  4RM8 A;  3K9P B;  2W54 A;  2RD0 A;  1ZOY B;  2WDV B;  3RMK C;  3A1Q B;  4JLC A;  4NNJ B;  3PZD A;  3PZ7 A;  3CWI A;  3VUW A;  3W2D A;  3TEW A;  3SFE B;  3AUL A;  1WE7 A;  3WIM A;  1XO3 A;  1FPY A;  1SIJ A;  2KWD A;  2FBW B;  4KV2 A;  2FUG 1;  3TSS A;  4W9J A;  3SD5 A;  2DZK A;  3U7D A;  3R3M A;  2JVC A;  1T3Q A;  3L08 A;  2KDF B;  5D6J B;  2N9E B;  1MJD A;  4M8M A;  1WR6 E;  2LGD A;  2WXI A;  1QT9 A;  4NY0 A;  1V86 A;  1C4C A;  4OW0 A;  4HK2 A;  4WH4 A;  2KAC A;  3V6E B;  3U52 E;  2K3U A;  5T8I A;  3NZ3 A;  3P4Q B;  3QIJ A;  4USA A;  3RNA C;  3V61 A;  2XK5 A;  5I4D A;  2MJD A;  1J19 A;  4K7U A;  2LGI A;  2MRP A;  2C60 A;  2HJ1 A;  3U8Z A;  2J0J A;  4BKG A;  1L7Y A;  4WQO B;  4GDK B;  1GB4 A;  1KF6 B;  5JXV A;  1Q5W B;  1WGH A;  2LHE A;  3C8Y A;  4O1N A;  3ZJV A;  2WXG A;  1C4P A;  3A4S C;  2IY1 B;  4WIP A;  4KGT A;  1RM6 C;  2L32 A;  2JXX A;  2INC C;  2D11 A;  2LGS A;  2ON8 A;  3B2F A;  1IPG A;  3ZJU A;  3ZNG C;  3ALB A;  1SIF A;  4ICV A;  3TCA A;  2KC2 A;  4RCO A;  1TS4 A;  5AEK B;  4DK5 A;  4HJG E;  2YVC A;  3WA0 A;  1XLO A;  3PRZ A;  2JRI B;  3UIO B;  4IW0 A;  3BK2 A;  4KZ0 A;  4NAW B;  3DVG X;  2NCN A;  2NMQ A;  4TV3 A;  5G2N A;  3VTW A;  2D07 B;  1A5R A;  1BXT A;  4RGN A;  1U4A A;  4KIK B;  4GDL A;  3AE5 B;  1CJE A;  2MP2 B;  3X0W A;  3MHS D;  3UQB A;  1VLB A;  2PJH A;  3NZU A;  3GE3 C;  4A20 A;  1ZKH A;  4Q2J A;  4BOZ B;  5BMH A;  3ZJT A;  2WWZ A;  3DDC B;  4DHZ E;  1TBE A;  3Q3N C;  5H92 C;  3LYY A;  2N7D A;  1HZ5 A;  1XLQ A;  1QOG A;  2VZK B;  4FUL A;  4KKI A;  2LI5 A;  3PHW B;  1CZP A;  3EFC A;  3Q8C A;  2IO2 B;  3PT2 B;  5BYR A;  4ZRK A;  5J18 A;  1P7F A;  2K8B A;  3OJ4 B;  4IWO A;  1FO4 A;  3B1L X;  1J7C A;  2I2Y A;  1C76 A;  2ZPN A;  3T8M A;  2FIF A;  3AE9 B;  1AWD A;  1NI2 A;  2O6V D;  4ZYN A;  1PYW D;  2WXL A;  3AE4 B;  5BMG A;  4IG7 B;  1J7A A;  1FNW A;  3NHE B;  2MW5 A;  2K39 A;  1OQQ A;  2NPT A;  4ASW C;  4KSK C;  3AXC A;  4EOY A;  3PLU A;  4JWU C;  5HI1 A;  5FR6 A;  2DWQ A;  3AEE B;  4RF1 A;  2H88 B;  5CTR C;  2H89 B;  3RUL A;  4MH0 E;  1FD6 A;  4UDU C;  4MGY E;  2WU5 B;  2AYO B;  4PS8 A;  1WXS A;  2PTL A;  4PT5 A;  2ZW0 A;  3TL5 A;  2MLB A;  2LD9 A;  4EE2 A;  2KVZ A;  4YTP B;  3BII D;  4LTU A;  1T5X D;  4KDL B;  1ENF A;  3L16 A;  3A4R A;  1OEY J;  5IKC M;  4GMV A;  2BTE A;  2DYM A;  1HXY D;  2PPH A;  3RCZ A;  4G3X B;  3AED B;  2M56 B;  4WWM A;  5HKH A;  2WP9 B;  4OZA A;  3PRE A;  5JH5 C;  1V49 A;  3L54 A;  2JWU A;  2WXH A;  3DWM A;  2HJ8 A;  2PEA A;  1TS2 A;  4F8C B;  1F2R I;  1MI0 A;  2IDY A;  3KQ4 A;  3NVY A;  2L52 A;  4B0E A;  4BAX A;  3AE2 B;  3Q6B A;  3UGB B;  2PE6 B;  5HFY A;  2C5L C;  5IAA C;  1JQ4 A;  5J17 A;  3TIX A;  3RFZ B;  2Z8L A;  2KWU B;  2D3B A;  3AM9 A;  5EE9 A;  3N20 C;  2KZR A;  2JZZ A;  2IND C;  1RWS A;  2KYW A;  2LUE A;  1VZ6 A;  2JT4 B;  2AL6 A;  3V6C B;  1WH3 A;  2AEH A;  1UF0 A;  1XT9 B;  5G5G A;  2K1F A;  2BB5 A;  4IM0 A;  3UIN B;  2VH2 A;  1EWY C;  4ZRP A;  5EE0 A;  1L4Z B;  4DHJ D;  3GZN I;  2G9H D;  4HPM B;  2NBV B;  4JX1 C;  2QMT A;  2O2V A;  3HM6 X;  1YNT E;  1DGJ A;  4K1R B;  3MC9 A;  4II2 B;  4US8 A;  2M17 A;  2BQQ A;  2GLS A;  4KZC A;  1TJE A;  1KM7 A;  4A55 A;  2W3S A;  2JRH A;  4WJN A;  3RN9 C;  2J0M A;  2J0K A;  3N9Y C;  2INP E;  2O6V A;  2HTM E;  4P6V F;  1J7B A;  2C7M B;  2AQ1 B;  1NEK B;  4ARC A;  1V2Y A;  4IKG A;  1V97 A;  1JCK B;  1E6E B;  1PQS A;  5C1Z A;  1WY8 A;  2WDT B;  2KAN A;  3DWG C;  4A90 A;  2JWZ A;  1PGX A;  4OVZ A;  2WXR A;  1SB3 C;  1WRD B;  1CK1 A;  4DDI D;  3W1Y A;  3ZW3 A;  2Q5W D;  3R2T A;  3IAS 1;  1HQR D;  4MJS B;  3ZXR A;  1VZ7 A;  3R8B A;  2V0G A;  3L0W B;  1WF9 A;  4K81 A;  1V6E A;  2IO3 B;  1EUV B;  4NJ6 A;  2ZZP B;  1EF5 A;  4TMA B;  1WI0 A;  2INN E;  3ZRC A;  3PRP B;  3H6N A;  2L3Z A;  1FEH A;  1V1P B;  3ZTC A;  1RAX A;  3KYD D;  2DZI A;  1IUE A;  3BVZ A;  4DBG A;  4WJP A;  1LM8 B;  4YT0 B;  4RGM A;  3DBL B;  2JYE A;  3DBR B;  1AYF A;  5L83 A;  5JHB A;  2NR2 A;  4ANX A;  2W3R A;  3ZIM A;  4KX6 B;  3URY A;  1XD3 B;  3AEB B;  1X1M A;  2N9P C;  5FK9 C;  4AJY B;  2BYT A;  2KLC A;  4M0W A;  3ZTD A;  4X57 B;  4MM3 B;  3EA6 A;  4EEW A;  2LHD A;  2BYV E;  2WS3 B;  4K7S A;  2DZM A;  3Q3M C;  1FM0 D;  3QHT A;  1LQB A;  1P0R A;  3AV8 A;  2LAS A;  1VDV A;  2QDF A;  2B3A A;  3NS8 A;  3T3N A;  2A4Z A;  3BZD B;  3DVG Y;  4KSL C;  4P16 A;  3M3J A;  4PYZ A;  4DHZ B;  3ZNZ B;  1WYW B;  3ZVV A;  4HWI B;  3L17 A;  3CF6 E;  2CS4 A;  1ZDX A;  3PTF C;  1KLG D;  2KJ6 A;  4KVG B;  1UZX B;  2MWS B;  3L13 A;  3I57 A;  3KH0 A;  5DCN A;  4HVB A;  3ZYY X;  1ZE3 D;  4PYU A;  2KTR B;  1FNV A;  1M94 A;  1K8R B;  4QAY A;  4OVV A;  3DHG C;  1UNS A;  2W55 A;  5IOI A;  4ITK A;  3ETR A;  1WXM A;  2NVU I;  3U7Z A;  1E9M A;  3IT6 B;  3MP9 A;  1MHX A;  2G4S A;  1N6Z A;  1PUT A;  1Z2M A;  3N30 A;  2MBQ A;  3IHP C;  1TKG A;  4REZ A;  4E74 A;  1JWA D;  2FCS A;  1EM7 A;  2MBE A;  1BT0 A;  1P98 A;  5DPT A;  1YD8 U;  2N1V A;  2K0P A;  3RNB C;  4I6P A;  2W9N A;  2KN4 A;  3VXW A;  2N7J A;  2RGF A;  2PVO D;  2BS2 B;  4IWP A;  2MJE A;  2Y3A A;  4ANW A;  3VRA B;  3RT3 B;  1FNU A;  2ZCB A;  2HDE A;  1J0G A;  3PZ8 A;  4NQK E;  2V1Y A;  1I4H A;  2IJ0 A;  4XC2 A;  3AE1 B;  4W9H A;  4JGH B;  4AS1 A;  3IBE A;  4MEL A;  1Q10 A;  4JIO U;  3Q2A C;  1YQ4 B;  3BYY B;  5MPO A;  4GLS C;  1OGW A;  5FR3 A;  1YJ1 A;  1NYQ A;  3L10 B;  1NVI D;  2V4L A;  4L23 A;  5BMI A;  2C9W B;  2KDM A;  1HZ6 A;  2EKI A;  4W9I A;  4ZHP A;  4XX5 A;  1Y8R C;  4J6I A;  1N5W A;  3N3K B;  3APD A;  3SFD B;  1CQV A;  2M19 A;  4FAD A;  4YSZ B;  4MSM B;  5H8Y E;  1MHH E;  4XDD A;  4A9A A;  1VD2 A;  2G3Q B;  3BY4 B;  3PGE A;  1WR1 A;  1D5X C;  1JRP A;  2UYZ B;  3BVG A;  1E8W A;  1MPE A;  1TGZ B;  2MEK A;  3TEY A;  2Y5B B;  2RR9 A;  1JWS D;  2FCN A;  3V62 A;  3ZQ4 A;  3AU4 A;  4EUT A;  3JSV B;  2OHF A;  5DPR A;  4HKQ A;  2WU2 B;  4HJK A;  4IC7 B;  4XZ4 A;  4WJO A;  1WE6 A;  3Q14 C;  5EE3 A;  2LJI A;  1ROE A;  3A33 B;  4C56 C;  5LXI B;  1FFU A;  1I4P A;  5CX3 A;  4ACF A;  4MDK E;  4LNN A;  2BVC A;  2JX5 A;  3A9J B;  1ZW7 A;  2L7R A;  3ZO5 B;  2BS4 B;  2ONQ A;  4E71 A;  4F7Z A;  2IY0 B;  2IGD A;  2QCZ A;  2BW2 A;  1WX7 A;  3AE3 B;  2M0X A;  3CST A;  3H7P B;  1FIQ A;  4F1S A;  2WXP A;  4EZJ A;  1IBX A;  3M63 B;  2W82 A;  1E7P B;  2KMC A;  2KLG A;  3P4P B;  1WXA A;  2AQ3 B;  1V5T A;  4HXD A;  2BWE S;  1OQY A;  3I9V 1;  1TZO A;  2LEK A;  5E6N A;  3HRD D;  3ZLZ A;  3M95 A;  5KHQ A;  2OOB B;  4YTN B;  3U2S C;  2FNJ B;  4HEA 1;  5AUI A;  2K6D B;  4GU2 A;  4YWG G;  1F0Z A;  3ZNH B;  2QJL A;  3T3O A;  3E9S A;  4C7Z A;  2CU1 A;  2KHW B;  2KX3 A;  4NJC A;  4XWT A;  5D2M B;  5AZH A;  2WXQ A;  2WXO A;  3ABV B;  1TY0 A;  2IPK D;  2GBN A;  4B95 A;  5IA7 A;  2L0F A;  3EEC A;  1C1Y B;  1J8C A;  1WMH A;  4XWW A;  2KAJ A;  2M1M A;  1WGD A;  4GN1 A;  1C4A A;  2UWQ A;  4EZL A;  4ANU A;  2BS3 B;  5CHV C;  2J4X A;  2KQ7 A;  3B2G A;  2DYO A;  2VZK D;  4HPL B;  1XCQ L;  1WJ4 A;  2MQJ A;  3W9C B;  3EFU A;  3RD2 A;  3RNG C;  3A1Q A;  1WSP A;  4WUR A;  2Z0D B;  3C19 A;  1XLN A;  1V5O A;  2BB6 A;  3ZGZ A;  3LDZ E;  1N60 A;  3OJ3 A;  4W9E A;  4XDC A;  4M02 A;  4II3 B;  3DVN V;  2REX A;  4JWS C;  5HHD G;  2PVG C;  3V3X A;  1GOZ A;  4YTM B;  2SAK A;  2MA9 B;  4P7I A;  3PLV A;  2BBC A;  2V4I B;  4C00 A;  1WJN A;  2BKF A;  4M8N A;  4PS3 A;  1SF0 A;  4HDQ A;  1YQ3 B;  1QKZ A;  1RFK A;  3KW5 B;  4C80 A;  1WGG A;  2CKH B;  4MT5 A;  4KGR A;  2NTS A;  2AL3 A;  1I4Q A;  5BO4 B;  1WM3 A;  3WAL A;  2MH7 A;  1GC6 A;  2KD0 A;  2KFK A;  3HM3 A;  3O13 A;  2GRI A;  1JRO A;  2KDB A;  4LJO B;  2XBB C;  4ZRI A;  1TY2 A;  4GDK A;  1IGC A;  1VRA B;  2XEW A;  3HIZ A;  2CJN A;  1T6B X;  4MGK E;  1C3T A;  1YN3 A;  1I35 A;  1BUI C;  1E7V A;  1GUA B;  1GAQ B;  3RI7 C;  3QWZ B;  2BYF A;  3ML9 A;  1F1H A;  3QX1 A;  1N5X A;  1JAL A;  3AU5 A;  3KUZ A;  2KWV B;  4IM3 A;  1LO5 D;  5AZF A;  3B9J A;  2GBJ A;  3AMZ A;  2GBK A;  2J7Q B;  4W9C A;  2JQR B;  3VHT C;  4NAW A;  1WXQ A;  2BWF A;  1ACC A;  2L0T A;  3VH3 B;  2IGG A;  2KQS A;  4KIK A;  1F2R C;  1TIF A;  4S17 A;  1P3Q U;  2MP2 A;  2KQ4 X;  1TT5 B;  1T0Q C;  1AAR A;  2KTF A;  3FC4 A;  1WFY A;  2DYB A;  5LXH A;  3DQV A;  2LVQ A;  3NJT A;  2LVP A;  4DWF A;  2KDE B;  4R3D A;  3VR9 B;  3GZN B;  3QJZ A;  4NAM A;  4FN2 A;  3ECI A;  4C4V B;  1QOB A;  3VFK A;  4TUU A;  4M01 A;  4URK A;  2L8J A;  1V8C A;  3OG5 A;  2LRU A;  2KX0 A;  1HA5 A;  5E6P A;  3HUI A;  2WX0 A;  3AE7 B;  1PDX A;  1QOA A;  1YN4 A;  4MH8 A;  1B9R A;  3BYT B;  4RNA A;  1AW7 A;  2L83 A;  2WXJ A;  3AEG B;  1XCT L;  4HCP B;  3V05 A;  2WYQ A;  1OQR A;  2QIL A;  3IXS A;  1KLV A;  4P1B C;  2M8S A;  2JYT A;  2N7E A;  4WWN A;  2WXN A;  2Z59 B;  3S2A A;  3I3T B;  2RSU A;  2ZEQ A;  2WHI A;  4HDO A;  4JPS A;  3I5J C;  2MBB B;  3PVL A;  5D7G A;  2D10 A;  1B1Z A;  1R4M I;  3QA8 A;  1EF1 A;  1I7H A;  2ZNV B;  2K9X A;  1SSN A;  1H4R A;  3KWV A;  1R4N B;  1UEL A;  5DPS A;  4CQN A;  1FCC C;  1BML C;  4OZB A;  2CJO A;  4HCN B;  4HKZ E;  1L0Y B;  3MHZ A;  3SHQ A;  2LVO A;  1WM2 A;  2R2O A;  2ZNV C;  2M0A A;  3MJ5 A;  4I6N B;  2KWC A;  1I4X A;  4WAA A;  2NTT A;  2IZV B;  3JW0 X;  4G50 A;  1WX8 A;  2JXT A;  2CHW A;  2N9L A;  2HD5 B;  3WAO A;  4EKU A;  2CU3 A;  3LB8 C;  4FHK A;  4IUM B;  3PS6 A;  2QHO A;  3Q3J A;  3IAM 1;  3VTU A;  4KKJ A;  1L0X B;  2IO0 B;  2J42 A;  1QOF A;  2M4N A;  2ZJD A;  1S3S G;  2KKC A;  4YL8 A;  1UWX A;  2KJH B;  4J3O D;  2KXJ A;  1MG8 A;  2DEN B;  2QIE B;  2SEB D;  5G5H A;  4GB9 A;  1RYJ A;  1NEN B;  2ZW1 A;  3IT4 B;  3NUH B;  3NVZ A;  2JY6 A;  3KLS X;  1FFV A;  1MG4 A;  4ARI A;  2D3G A;  2FUH B;  1FMA D;  1UGJ A;  4RGO S;  1ESF A;  3I63 C;  1QLB B;  1HEZ E;  1NI3 A;  2PW9 A;  3RYT A;  2PKO A;  3VAW A;  3WAN A;  1F77 A;  4TQ1 A;  1KOT A;  1SXT A;  3FIL B;  5C3J B;  2Z0E B;  2QC8 A;  2KN5 A;  3R7R A;  3LJ3 A;  2MX2 A;  1SJE D;  1JRU A;  1QZE A;  2IBI B;  3NVV A;  5GMV A;  1L6U A;  2K25 A;  2GBM A;  2DBY A;  3M62 B;  3ZXV A;  2BGF A;  2RDG A;  4G0N B;  1WYG A;  1VR9 A;  4HRO A;  2LXA A;  4OZC A;  1MVK A;  1Y56 A;  5L95 C;  4XGA B;  1YX5 B;  4RMA A;  1R7S A;  2L00 B;  2QEJ C;  4GIV A;  2K22 A;  4JL9 A;  3N32 A;  3P4R B;  1GC7 A;  1E10 A;  1SBB B;  1WZ3 A;  1KFY B;  2TSS A;  4GSW A;  4W9K A;  3AE6 B;  2E6X A;  2RDB C;  3AH7 A;  4ICU A;  4MJS A;  2N4F A;  3GP7 A;  2J53 A;  1M4V A;  2EEL A;  3AI5 A;  2OJR A;  4EFO A;  4BKS D;  4FJZ A;  2MBO A;  4NQL B;  2DZJ A;  3NY5 A;  3DHI C;  3OLM D;  4ANV A;  3DBH I;  2WXM A;  1WGK A;  3RNE C;  1XXG A;  2FCQ A;  3V60 A;  1OTR B;  4TQ0 A;  3SEB A;  2JSV X;  3C0R B;  1P9D U;  5BYQ A;  1V1P A;  4W9F A;  2DAF A;  2LGX A;  4FLH A;  5LNK 1;  2WXF A;  1QIL A;  2V3N A;  4BFR A;  2AWT A;  3W5U B;  1L5P A;  4CHK A;  2V9H A;  1LGR A;  2J52 A;  3W1S C;  4P1C C;  2XK5 B;  4WWP A;  2D5G A;  3MC0 B;  5E6J A;  4BKT A;  3AEC B;  2IO1 B;  4GGQ A;  2EMS A;  3EC8 A;  4MM3 A;  4B0M A;  3P2B A;  3SU8 X;  4LNO A;  4PK1 A;  1NDD A;  3TBL D;  4MGI E;  1WIA A;  3ZKJ C;  4TSS A;  4ZRJ A;  1TKE A;  2ASQ A;  2FE8 A;  3E56 A;  2ZPY A;  2JF5 A;  2BKR B;  4YSY B;  4AUQ C;  3B08 A;  1DOX A;  1ZDV A;  2LFI A;  1STE A;  3H1U A; 
#chains in the Genus database with same CATH homology
 4W9G A;  2LXC A;  2Z0D B;  5J2R A;  2LRW A;  4CO7 A;  4DHJ D;  3GZN I;  1V5O A;  3LDZ E;  5AZG A;  3HHM A;  4HPM B;  2NBV B;  3OJ3 A;  2KDI A;  1SE9 A;  4W9E A;  2O2V A;  3HM6 X;  4NPN A;  4GDL B;  4K1R B;  4II2 B;  2KTR A;  4II3 B;  3DVN V;  2REX A;  2M17 A;  1RFA A;  3H9D A;  3D32 A;  4KZC A;  1IP9 A;  5KHO A;  1KM7 A;  2DHZ A;  1UH6 A;  2MA9 B;  2JZ3 B;  3B0A A;  3WAM A;  1UBQ A;  2JRH A;  3PLV A;  4P7I A;  1WJN A;  2BKF A;  2EKE C;  4M8N A;  4WJN A;  2J0M A;  2KOX A;  2J0K A;  4PS3 A;  2O6V A;  3PRM B;  3KYC D;  4HDQ A;  3RUI B;  1TTN A;  3ML8 A;  3BIN A;  1F9J A;  3KW5 B;  2C7M B;  4KDI C;  2A5U A;  1WGG A;  1GG3 A;  2CKH B;  3DVN U;  4IWQ A;  2AL3 A;  2BYE A;  4LCD E;  1V2Y A;  3T9L A;  1T0Y A;  2D2Q A;  1LXD A;  5JHA A;  5BO4 B;  1WM3 A;  1SGH A;  3WAL A;  1GC6 A;  1WX9 A;  1PQS A;  4AWJ A;  2KD0 A;  2KFK A;  3HM3 A;  5C1Z A;  3A9K A;  3VTV A;  1FXT B;  5LLI A;  1Q1O A;  2K8H A;  2FCM A;  1YIW A;  4BKS A;  1WY8 A;  2WDT B;  2KDB A;  4LJO B;  3QCA A;  2XBB C;  2KAN A;  4ZRI A;  2MBH A;  2WX1 A;  2G4D B;  4GDK A;  3W1S A;  3PV1 A;  2XEW A;  3HIZ A;  2JWZ A;  4MGK E;  1C3T A;  3PHX B;  1WRD B;  1E8Y A;  4DDI D;  2C7H A;  1WJU A;  2L05 A;  3W1Y A;  1WJ6 A;  3ZW3 A;  4BOS C;  3NOB A;  1V9J A;  4LDT D;  2NPT B;  1E7V A;  1I35 A;  4FJY A;  1GUA B;  1E5W A;  3PSE B;  3QWZ B;  4MJS B;  2BYF A;  2BPS A;  3ML9 A;  1Q0W B;  1UGM A;  3QX1 A;  1E8Z A;  3L0W B;  1WGR A;  1WF9 A;  4K81 A;  3ZNI D;  1V6E A;  2KFK B;  3AU5 A;  2CHZ A;  4TKN A;  2IO3 B;  1EUV B;  3A9K B;  3KUZ A;  2KWV B;  4IM3 A;  4NJ6 A;  5DPW A;  2ZZP B;  2DX5 B;  2K8C A;  4LDT B;  5AZF A;  1EF5 A;  4B9K A;  3ZUN A;  1D3Z A;  3MTN B;  2GBJ A;  4MGZ E;  1WI0 A;  2GBK A;  2J7Q B;  4W9C A;  3VQI A;  3ZRC A;  3VHT C;  2K6Q A;  4NAW A;  4ZDV A;  2BWF A;  3PRP B;  3ZDT A;  3H6N A;  2BF8 B;  2L0T A;  3VH3 B;  2KQS A;  2L3Z A;  4KIK A;  4RM9 A;  1P3Q U;  3ZTC A;  2MP2 A;  1RAX A;  4GOC A;  3KYD D;  2DZI A;  1E8X A;  3K9O B;  3QC8 B;  4WJP A;  4DBG A;  1AAR A;  1LM8 B;  2KTF A;  1WFY A;  2FAZ A;  2DYB A;  4JQW C;  2LJ5 A;  4B6W A;  5LXH A;  3DQV A;  3OAW A;  2LVQ A;  4BBN C;  2LVP A;  5G55 A;  4DWF A;  1H8C A;  2KDE B;  4EZK A;  2KNB A;  5C23 A;  3QJZ A;  4AOF A;  5L83 A;  5JHB A;  2NR2 A;  4ANX A;  4FN2 A;  3ECI A;  3DOW A;  3ZIM A;  3VFK A;  4TUU A;  1XD3 B;  4URK A;  5D94 A;  5EDS A;  2L8J A;  1X1M A;  2MSE D;  4IM2 A;  3CSF A;  4OVU A;  3R7Q A;  3KUC B;  3JSV A;  2N9P C;  4AJY B;  2LRU A;  2KLC A;  2KX0 A;  3ZTD A;  4X57 B;  5E6P A;  3VUY A;  4EEW A;  1YX6 B;  5CHF A;  2BYV E;  2WX0 A;  4K7S A;  2DZM A;  2C7N B;  2RPQ A;  2MCN B;  3QHT A;  1LQB A;  1EO6 A;  1P0R A;  1YQB A;  4LJP B;  2LAS A;  1WMH B;  2B3A A;  4W9D A;  1OEY A;  1XQQ A;  3NS8 A;  3UQA A;  2I1J A;  2A4Z A;  4G11 A;  1V81 A;  4WJQ A;  3DVG Y;  2DAJ A;  3QAQ A;  4KSL C;  4PYZ A;  3M3J A;  4DHZ B;  1VCB A;  4HCP B;  3ZNZ B;  1WYW B;  1WZ0 A;  3ZVV A;  2WYQ A;  4HWI B;  2GMI C;  3L17 A;  4RM8 A;  3K9P B;  1KLV A;  3RZF A;  3A9J A;  3CF6 E;  2RD0 A;  2M8S A;  2N7E A;  4WWN A;  2CS4 A;  3CMM B;  3H7S A;  3A1Q B;  2Z59 B;  4JLC A;  3PTF C;  3I3T B;  2RSU A;  3S2A A;  4AJW A;  4NNJ B;  3PZD A;  5CHW A;  3WAP A;  2KJ6 A;  1E7U A;  2ZEQ A;  4HDO A;  3VUW A;  3H7P A;  2MBB B;  3PVL A;  1IYF A;  3JVZ X;  4KVG B;  1UZX B;  5D7G A;  2MWS B;  4DXA B;  3L13 A;  3KH0 A;  2D10 A;  5DCN A;  3AUL A;  1WE7 A;  4N9F 4;  4HVB A;  3WIM A;  2O2V B;  1R4M I;  4WWO A;  4KV2 A;  3QA8 A;  4PYU A;  1EF1 A;  2KTR B;  4GXB A;  4BVU C;  1M94 A;  4W9J A;  3SD5 A;  2DZK A;  3U7D A;  1K8R B;  2ZNV B;  3R3M A;  4OVV A;  2JVC A;  1H4R A;  2NBU A;  1RRB A;  2N1W A;  1UEL A;  5DPS A;  3L08 A;  2KDF B;  5D6J B;  1WXM A;  2N9E B;  2NVU I;  4DDG D;  4HCN B;  1TZ1 A;  4M8M A;  3SHQ A;  2LVO A;  1WR6 E;  2O6V B;  2LGD A;  2IYD B;  3DCG A;  4NY0 A;  3ZDM C;  2GBR A;  3IVF A;  1WM2 A;  2G4S A;  2R2O A;  1V86 A;  2ZNV C;  3Q3F A;  4HLE A;  2HTH A;  1Z2M A;  5TR5 A;  4I6N B;  2KWC A;  4HK2 A;  2KK8 A;  3N30 A;  2MBQ A;  4WAA A;  3V6E B;  2IZV B;  3IHP C;  3JW0 X;  4E74 A;  4G50 A;  2FCS A;  1WX8 A;  2MBE A;  3QIJ A;  3V61 A;  2XK5 A;  1BT0 A;  1P98 A;  5DPT A;  1YD8 U;  1J19 A;  2N1V A;  4K7U A;  2CHW A;  3WAO A;  2HD5 B;  2MRP A;  4I6P A;  2C60 A;  2W9N A;  4EKU A;  3RZW C;  1GNU A;  2KFJ A;  3VXW A;  4FHK A;  4IUM B;  2J0J A;  3PS6 A;  3U8Z A;  2QHO A;  4BKG A;  1L7Y A;  2RGF A;  4WQO B;  4GDK B;  4IWP A;  3Q3J A;  3SDL C;  2KMA A;  1Q5W B;  4ANW A;  3VTU A;  1WGH A;  1L2N A;  3RT3 B;  3A4S C;  2IY1 B;  3O65 B;  2IO0 B;  2LGY A;  2ZCB A;  2M4N A;  2JXX A;  1J0G A;  2ZJD A;  2D11 A;  4NQK E;  1S3S G;  2KKC A;  2V1Y A;  1IPG A;  4YL8 A;  3ZNG C;  2ZVO A;  4XC2 A;  3ALB A;  3UF8 A;  4W9H A;  2CR5 A;  4JGH B;  2KJH B;  1SIF A;  2KXJ A;  4PS7 A;  3IBE A;  4ICV A;  4MEL A;  1MG8 A;  3TCA A;  4A3O A;  2DEN B;  2KC2 A;  4JIO U;  3VH4 B;  4GB9 A;  4FA6 A;  5AEK B;  1CMX B;  2ZVN A;  1G6J A;  4AP4 C;  4DK5 A;  1GJZ A;  2JY6 A;  2YVC A;  3WA0 A;  3R66 C;  3PRZ A;  2JRI B;  2D3G A;  1OGW A;  2FUH B;  3UIO B;  1YJ1 A;  4IW0 A;  3X23 A;  2KO3 A;  3L10 B;  2JUO A;  4KZ0 A;  4NAW B;  2V4L A;  2NCN A;  3DVG X;  4TV3 A;  5G2N A;  3VTW A;  2D07 B;  3RYT A;  2C9W B;  1A5R A;  3KUD B;  3VAW A;  3WAN A;  1U4A A;  4W9I A;  4KIK B;  4GDL A;  4FHJ A;  4XX5 A;  1Y8R C;  4J6I A;  2MP2 B;  1ISN A;  3APD A;  3N3K B;  3X0W A;  1UBI A;  3MHS D;  3ONS A;  4TQ1 A;  1KOT A;  3UQB A;  3VDZ A;  4FAD A;  3ENE A;  4MSM B;  2PJH A;  3NZU A;  2Z0E B;  1VD2 A;  4A20 A;  2G3Q B;  1ZKH A;  3BY4 B;  3NZS A;  4BOZ B;  3PGE A;  1WR1 A;  2KN5 A;  2CHX A;  3R7R A;  2WWZ A;  2NBW B;  3DDC B;  3LJ3 A;  2V3S A;  3U30 A;  4DHZ E;  1TBE A;  2MX2 A;  2UYZ B;  1E8W A;  1JRU A;  1QZE A;  2LWP A;  2IBI B;  1TGZ B;  3DPD A;  3QK0 A;  2N7D A;  5GMV A;  2K25 A;  2Y5B B;  2GBM A;  1ZGU B;  2RR9 A;  4FUL A;  2HE7 A;  3M62 B;  2FCN A;  2LI5 A;  3PHW B;  3V62 A;  2IO2 B;  3AU4 A;  3PT2 B;  4EUT A;  2BGF A;  3JSV B;  4CYE A;  4G0N B;  4M0W B;  4ZRK A;  5J18 A;  2K8B A;  5DPR A;  3OJ4 B;  4IWO A;  4W9L A;  3B1L X;  4HJK A;  2LXA A;  4IC7 B;  4DHJ B;  2ZPN A;  3T8M A;  5L95 C;  2FIF A;  4MEM A;  4XZ4 A;  3TJP A;  1YX5 B;  1NI2 A;  4RMA A;  4WJO A;  3DBS A;  2O6V D;  1WE6 A;  2L00 B;  3VUX A;  2KC1 A;  4ZYN A;  4GIV A;  4JL9 A;  3N32 A;  3MJW A;  3A33 B;  4IG7 B;  1GC7 A;  5LXI B;  5CX3 A;  3NHE B;  1P1A A;  2MW5 A;  4MDK E;  2K39 A;  1WZ3 A;  4GSW A;  2NPT A;  3JYU A;  4W9K A;  4KSK C;  3AXC A;  4ASW C;  3A9J B;  4EOY A;  3PLU A;  4ICU A;  4MSQ B;  4MJS A;  4BBN F;  1ZW7 A;  2L7R A;  2N4F A;  3ZO5 B;  4K7W A;  3GOE A;  2R2Q A;  1Z5S B;  4E71 A;  4F7Z A;  3AI5 A;  5FR6 A;  2L76 A;  2IY0 B;  2OJR A;  4EFO A;  5CTR C;  1WX7 A;  3IFW B;  4BKS D;  2M0X A;  4FJZ A;  3RUL A;  2MBO A;  3CST A;  2DZJ A;  3H7P B;  3NY5 A;  4NQL B;  4F1S A;  4MH0 E;  3OLM D;  4NJ7 A;  4EZJ A;  4MGY E;  3M63 B;  2LZ6 A;  2AYO B;  4ANV A;  3DBH I;  4PS8 A;  1WXS A;  1V80 A;  1UD7 A;  1RLF A;  2N9X A;  2FCQ A;  3V60 A;  1OTR B;  2KMC A;  3UIP B;  2KLG A;  3PPA A;  4TQ0 A;  1HE8 A;  1WXA A;  3TL5 A;  2MLB A;  3C0R B;  1P9D U;  2KVR A;  1V5T A;  2LD9 A;  2ZCC A;  3ZRF A;  4W9F A;  4HXD A;  2BWE S;  2DAF A;  1OQY A;  2LGX A;  4FLH A;  3TMP B;  1R4N I;  4KDL B;  5E6N A;  3QAR A;  3ZLZ A;  3M95 A;  5KHQ A;  4BFR A;  2I1K A;  2OOB B;  3L16 A;  3A4R A;  1OEY J;  4GMV A;  2AWT A;  5JZE B;  2DYM A;  2YLM A;  2FNJ B;  2KJR A;  5E6O A;  1KJT A;  2PPH A;  3APF A;  3QQ8 B;  4G3X B;  3RCZ A;  2K6D B;  4CHK A;  4GU2 A;  2PE9 A;  5HKH A;  3W1S C;  3ZNH B;  3PRE A;  5JH5 C;  1V49 A;  2NS5 A;  3L54 A;  4E3C A;  2XK5 B;  4WWP A;  4FJV B;  1E90 A;  2HJ8 A;  2PEA A;  4BKT A;  2IO1 B;  1LFD A;  4GGQ A;  2EMS A;  1WGY A;  4F8C B;  3KVF B;  2CU1 A;  1WXV A;  2KHW B;  3APC A;  3EC8 A;  3IG3 A;  4MM3 A;  3P2B A;  3SU8 X;  2KX3 A;  3UGB B;  3EHV A;  2PE6 B;  2C5L C;  5D2M B;  5AZH A;  5IAA C;  5J17 A;  1NDD A;  2GBN A;  3TIX A;  4B95 A;  5IA7 A;  2L0F A;  3TBL D;  2KWU B;  1C1Y B;  3EEC A;  1WIA A;  4MGI E;  2EMT A;  1WMH A;  3ZKJ C;  1J8C A;  4ZRJ A;  2M1M A;  2KZR A;  2GOW A;  2JZZ A;  3VVW B;  2ASQ A;  1WGD A;  4GN1 A;  1I42 A;  2VRR B;  2UWQ A;  2ZPY A;  2LUE A;  2JPH A;  4EZL A;  4ANU A;  2JT4 B;  2AL6 A;  2G45 B;  2JF5 A;  2BKR B;  3V6C B;  1NBF C;  5CHV C;  4FBJ B;  4AUQ C;  3B08 A;  4I6L B;  1WH3 A;  2KQ7 A;  2AEH A;  2FID A;  1XT9 B;  2DYO A;  3HK0 A;  3DBL I;  4HPL B;  1S1Q B;  1WJ4 A;  2MQJ A;  4A3P A;  2K1F A;  3EFU A;  3DBR I;  4IM0 A;  3RD2 A;  3H1U A;  3UIN B;  3A1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...