2M2DA

Human programmed cell death 1 receptor
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
MPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDSRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 1
publication title Structure and interactions of the human programmed cell death 1 receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2m2dA00
4XZUA 1FZMA 2YS4A 4YDJA 4DGVL 1IT9L 1ZA6B 2Z91A 4HHAB 4U2YA 4POZD 4YHPA 1PLGH 2DQGL 2ESVD 3EO0B 5E8PA 1MHPH 1QRND 2E9BA 3HS0A 1TFHA 3M17A 4ZUWA 3MGOB 4I1NB 2OR7A 4ELMB 4KRNA 2P5ED 5HHOB 5E00B 4Z7NE 3ZDYF 1AFVL 1I85A 5T1LD 3TNNA 1MLBB 3IDIB 4QHMA 2R1YB 4XVSL 4KTDH 2IANA 5HJ3A 3HR5A 2HP4A 3AB0C 4U1HB 2EE3A 4XX1E 1PFCA 4HQQH 4KRMB 2NYYD 4L3EB 4PJIE 3D25B 5LXGL 4BUGA 4PB9L 4UUJA 4LSPH 2ZOKA 4JRWA 4L3CB 2ADIB 5DHVA 1KC5H 3DX7A 3BW9A 4OZFB 4PRPE 1WEJH 2HN7B 1AY1H 3DJ9A 1EO8H 1F2XK 3EDJA 5T3ZL 4G42B 2UZYB 2HFEB 4D8PA 3FFCE 2VDLH 1AO7B 3K74B 4NM8L 2HJKA 5HHMD 3UTSD 5GQBA 2GFBB 4MD0B 5F93C 4R96A 5I8OH 1T7YA 5E1HB 2OI9B 3BOVA 5J11C 4J4PD 3RVVD 3EHBD 4A6YB 2YKLH 4FFZH 4QRPB 5MHSD 4GW4B 4D0CA 5BCAA 1B0RA 2YWYA 2W65B 3VFSB 3VMNA 2QQLH 2WUCL 3TBTA 3QI9C 3E3QC 2ED8A 5TPWL 4R4NC 1A5FL 2CKBB 1R0AH 1H8SA 3UEZA 3BHBA 3OXRB 3ESVF 1IKFH 1FC2D 3X14A 4IRZH 4MJ6B 3P0VL 4XP6H 1GXEA 2ID5A 1E0OB 1SEBB 2UYLB 2EEDA 2AI0L 1J1OL 4AEIH 2HFFB 1U8QA 4JHAH 1BX2A 4K8RC 1BQLL 3QIBA 3AB0B 3ARDD 2COQA 2W0KA 2A74A 1A7NL 2Q20A 2EDTA 3LQMA 2BVPB 2FR4A 5HY9A 3X3GL 2O5YH 3FQUB 2FLRT 2YRZA 5KW9H 4LP5A 4U49A 2X10A 4I0PD 3UTTE 3TPUA 1F90L 1IZKA 3RWDA 4R2GC 4L4TB 1KJ2H 3VXSB 3GI8L 1JL8A 4GMTH 5GRVL 5LGHH 2XRAL 4QRSA 3IJYA 3QEHA 2E6JA 2ZCKL 5J11B 5FYJL 2DLHA 3FONA 4OF6A 4GSDL 4OZIA 2BNRA 1FL5B 5E2JA 3VG9C 1G7JA 1H3TA 1TJHL 3KLDA 2XFXB 2VZOA 1QR1A 3EYOA 5J3HC 3UBXB 3RVTC 1DBML 1DN0B 4NFCA 2MOVA 5C09E 1OM3L 2VDNH 4OLWH 3GBNH 1ZT4A 3SOBH 3QDJE 4JHZA 2VLRD 2Z8VC 3GSQB 1WV7T 3ARBC 5CWSB 1BVKB 5DVOA 5BXFA 5I18H 1FG9C 2GJ6B 4S1RL 1IKNC 4F7EA 4FS0A 4FRWA 3PV6B 1OQOA 3MBED 3KJ4B 1CE1L 1DBJH 1SYVA 3MOAL 1U2HA 5JNYB 5INCA 3G08A 5ISZD 2WQRA 3QH3A 1A7QL 2ARWA 1J0ZA 2R69L 1UA6H 3QCUH 1J0JA 4G8IB 2K9UA 5E2UH 1NGPL 2VB5A 2VLJE 3DV6B 4R2GB 2VITA 1EIBA 4XCYB 2E7BA 4XRCA 2NY3D 1SY6H 4YAQA 5E94B 3HG1D 3FN9A 1Q0YL 3PWJB 1EMTH 2H2SC 1VEOA 3F7YB 3H3PH 4PJHA 4G3YH 4H26A 2GUOB 5CP7B 2HVKB 1QEWA 3WLBB 1GOHA 2JK5B 1C08B 4DGVH 1IT9H 3LKPB 4XP5H 1RY7B 3VG9B 1QYGL 1HHIB 1RI8A 3HRZB 5IIEA 3V4PL 4F8QA 3MYJB 4YH6A 2VLKA 1HYSC 4MS8D 3BN9D 3KWWB 2HLFC 1DUYB 3HE7A 1G7LA 3DETD 5BOZG 3RIAK 2KZWA 3ARBB 4NQCA 4BKLB 5C08B 1SM3H 3KLAB 3UC0L 3DX9A 4HH9A 2E8YA 2AABL 3VCLA 4YR6A 1JUFB 1E6JL 1VDGA 1GZQB 4QO1A 4PB9H 1RUPH 5FYKD 3OKOB 5HBBA 2CLZB 3VXNB 3UCRA 4OBRA 1PKOA 2G2RB 2B7DT 3QDME 4QF1A 4HKJB 4OGAD 5DGRA 3TZVD 4APQC 4PGCB 3H9YA 1IGTB 4S10A 4NM8H 4X6EA 5EIQA 5JHDD 4JZNB 2XPGA 4A2MA 4U05A 5E0QA 2XOTA 2XXCB 4U6HA 4QTHA 5JHLL 1S7WB 1AR1C 5CKAA 5D2NA 5E99H 1VKXB 4BH8A 4PJGE 1TZHA 43CAB 4U33A 3P73B 1MJ7L 2NY4D 1QO3B 1XT5A 2WUCH 5I2IA 1YPZF 1F4XL 1A5FH 4HWNA 1ODAA 2HJLB 3UX9B 1YEGL 3RWFA 4TRPL 1TVBB 4LFHD 5DT1L 4I77L 1I4FB 5JDJA 4WFEE 4X6CF 3SEPA 1JPSH 2EIBA 4XMKL 2AI0H 1J1OH 4HS3B 4M7LT 2HFGL 4UOJA 4R4ND 4N1CA 1CD1B 1CFBA 1XGRB 3BZFA 4RMSA 1WITA 3FMGH 2FRGP 2QADC 2IAMA 4FQ1H 4P23C 4H8WL 3X13A 2L4OA 2WNGA 1WBYB 3PGFL 2NTSP 5IROA 3BUTA 5A1AA 3TFKD 1OTSD 3DI3B 1KN2H 3GBMH 3TV3L 43C9A 1XF1A 1ZA3A 5LGKA 5J1SC 3QNXA 4APQB 4ORZC 1F90H 1NC2A 2EDLA 2Y72A 3IKCA 2J8UF 4WCYH 4XNXL 1UGNA 3FAXA 2QQNL 1YDPA 3ZYJA 1F97A 5DHVH 4LSVL 4MAUL 4XVTL 4X6BA 4W70A 4PGEA 2D7NA 2HVJA 3GFUA 3Q6FB 1XFPA 5FYJH 2ZUVA 4AT6B 1V7NL 4ZTPL 3OJVC 1UZ8A 1TCMA 1JNHB 1PY9A 5J89A 2X1OA 4PBXA 1K4DB 1W72B 4FOMA 3U79A 1CFTA 1HZHL 4LLVB 3PWUB 2C26A 3TH2T 1QNZL 1DBMH 2KKQA 1INQA 1U42A 3M1BA 1LK2B 3QUYC 1OM3H 1SBBA 4L8SC 1U2CA 1C5DA 4NN7C 2NLJB 2X40A 3TYFB 4D0DA 2XA8L 1WC7B 1WZMA 5DD6B 2BSTA 3ZDZE 4HFUH 4GKOA 4I3RH 1JPGA 2NY1D 4WDIA 3QWOA 4S1RH 4UV4L 3EO9H 2QADB 4KKCD 1I1RA 4OT1L 4PGDB 1YEIL 2Q8BH 4IHOB 3FJTA 1Q9OB 1ZS8A 4HZLB 1CE1H 1MCPH 4LBEB 3ZKSD 4EVNB 3DXAA 4PJEE 5B3NA 3UAJC 4W4NA 5C0AB 5B8CA 1AXSB 1KPRB 3BYTA 3H9SD 1A7QH 3NOIA 2IGFH 3QEGH 2R69H 3HZKA 1NGPH 1ND0B 3WIHA 1B0GA 4RSVA 3PWLA 4UT7L 2YPLA 5D5MB 1Q0YH 2H26B 1PZ5A 3UJTL 2NW3A 2V9TA 4LRNL 5EO1B 3GSVA 4PJ8A 3MMEB 1YN7B 3SCMD 3HN3A 1NGXA 1HILA 4XBEL 5JDSB 2BY1A 3GGWB 4X9IA 1ZHKB 3FOLB 3K46A 2LABA 1Y6KR 4LNRA 4I18A 2W1NA 4HKZA 5F3BB 3QUYB 4L8SB 4NN7B 3RPKA 1T5XB 4X6DB 4Y19A 1G9NL 4MDIA 1T2QH 4OAWB 5I6XC 1FZKB 1JMXA 2IH3B 2P49B 5EIVA 3C87A 3T09A 3VA2C 3I6KB 5HGDB 1RK1B 3SKUD 3VE0B 1I7RB 1F13A 4ZXBC 4EI6A 1C16B 4NHUB 3F58L 3KPPA 3GSNB 2AABH 3FQWA 1A2YA 3SKMA 1U95A 1T7WA 3G6JB 1OGAE 3FQTB 4OFIA 1BQHB 5EA0H 1U8HA 4JM4L 1AI1L 5EBWB 3SGDI 1IC4L 3WV0A 4ONGL 1P69B 3MRBA 5ID0B 5J1AB 3O8XC 2F58L 2BOBA 1FV1B 4YQXL 1Q1JL 4DK6A 5HYJD 2B4CL 3LOWA 3RIFF 4OM1L 3OJDB 4ERSL 2VR4A 4RNRA 4OQTL 1VFBA 3ZDYE 5F3HB 1NUNB 4LHQB 3RWCA 2QLVB 3QQ9D 4RWHA 5AWNH 4HLJA 4IMKC 3SGDH 2H1PL 2VQUA 1SJHA 3O6FA 2C1PB 2B39A 4K7PL 1FLRL 3P0YH 3OHXA 1NBYA 4NRZA 1D5IL 3V0AC 4HWZA 3KPMB 4GW1B 4U1SB 2ADFL 1EEUA 4ZS7L 4DN4L 5DT1H 4I77H 1NCNA 4Z8FL 1K8IB 4DCQB 5I6XB 4G8GA 5IK3B 5L2JA 5EIIB 3HZMB 3BESR 1TCRA 2NXZC 4ZAKC 3KXFB 4YBQC 4ZXBB 2PYED 3ILQC 3B9KA 5IB5A 4LEXH 2QL1A 3VFUB 4J3VA 1CICD 5F1IA 2RQ8A 3JV6A 2YZ1A 5I16B 4F8TA 3RWIA 1A4JB 3T2OA 3GMRA 5GS2H 1HXMA 1NC4B 1XF4A 1JHLL 4P23D 3M45A 2VZ1A 2ZUWA 5GRVK 3MV7E 3O8XB 5DSCA 5IVXF 4PJFF 1FL6B 4QXUH 5LGJA 2A9ML 2FBOJ 4XNXH 4DVBB 4ZNEE 4UT9L 3H9HA 2QQNH 3ZTJG 3S35X 3VGEA 2WM0A 1E27A 4MAUH 4XVTH 2X4QA 4S1QH 2AV1A 1S7QA 5DYOA 1KBGL 4M6NL 1V7NH 4PRIB 3VWKD 1LDSA 4TSAL 1T7VA 1FE8L 3U0PA 2I27N 5EZJA 4CN4A 4P5TA 1WAAE 4FTVD 4O2CB 1HZHH 4C4KO 2YRPA 4M48L 3OPZH 2EXYC 5IW6B 1QNZH 1WWBX 4S0TD 5HGBB 5J13B 5D7IA 2XA8H 4L8DA 3FFDA 2OSLA 3GJEA 4KRLB 1A9EB 5CD3B 1A3RL 3VFNB 3GUTA 5T1MB 8FABA 1YNTA 4PJBF 2NXZB 4ZAKB 3U7YL 4KQ4L 1FZJB 4Q0XH 5HYSB 4X7TA 3FQRA 4OT1H 3KYMA 1OAQL 1YEIH 4YHKL 4WUUE 3VRJB 3WXWL 4MZ3A 3FQNB 2RHEA 5JIHA 4LLUA 4KK8D 3WUWB 2AK4B 4WY7H 5EO0B 4DW2H 1OTUD 3H7BB 2A83A 3A67L 1X5XA 1KJMB 3CD4A 4KMQA 2YD5A 3O3AA 1HH9B 1NMCC 2WQ8A 3I84A 3N1MC 1I1YA 1QBBA 4PGJA 1KJ2B 1YYLL 3HI6H 4M8QB 4QYOB 5ESQB 2VMFA 2AJVL 5HPMA 1KT2A 3IJHB 1QFWH 4X5XA 4R4FL 2XZCL 4OUOA 4MSWA 5IEKB 3KNBB 1I8MA 1BD2D 1RULH 2E9WA 3UJTH 4JVWA 1N5AB 1KXTB 2IPTH 4JFHE 4LRNH 4WO4C 4P3DA 1O7SA 5IR1B 3MRRA 3RGHA 1RIVL 2J3SA 3P9MB 1IGIL 4XCCL 5D1QD 2EYRB 4HV8A 2P8MB 5CSZA 3SE4C 4EDXB 2R2HB 2ORBL 4POYA 1GHFH 1TQCC 3T3PF 3DMMA 1G7MA 1FH5L 4PRHE 4Y16C 4LSDA 2H9GB 2FX8L 4NQEE 2VE6A 2FX7H 1G9NH 3F5WA 3FT4A 5LQBL 4TNWK 2IFFL 2C4FU 5CIPA 3BE1L 3FO9B 4U6XA 5HDBF 1VACA 3IDXL 1VGKA 3QUMB 1V3KA 2EYSB 3UTZB 4GRMB 3ME0A 1JVKA 3DECA 2OTWB 4E0RB 1YMMD 3QO1A 4LLWB 5KS9A 2QR0A 2HG5A 3MRFB 1RZGB 3PXJA 5MEQB 5IB2A 3INUL 4OZFG 2ICES 4JKWA 4O9HL 4DEPB 3W11D 1KTLA 1U91B 2V2XA 1H5BC 4OGXL 1EFXA 3MRPB 5FYJU 1IEBB 4JM4H 1AI1H 4ZUSA 1NMCB 1N2RB 4Y4KA 1FVEB 2OJZL 1KTKE 3FO2B 3I75B 1LP9F 1GGBL 1HDMA 1EBAA 4MAYD 4MWFA 4WFGE 1N3NB 2WUBL 1QLFA 3S3PA 4M3KB 2ZUUA 2R1XA 2B4CH 4OM1H 1JGDA 2DQUL 1DN2A 4GKZA 2X6MA 1AC0A 2V17L 4ERSH 4RFEA 3HZYA 2DLGA 4LSQL 1IQWL 4WO4B 5HXMA 4WI8A 4NZRH 4V2BA 4YGVB 3WIHH 5JIIA 4KKBC 1FLRH 1VPOL 4Y5YA 4PJXA 3F6LA 1D5IH 4IOIB 3OX8A 2I60L 2ADFH 2GW5A 1QRKA 3MV8D 4ZS7H 4DN4H 3WN5A 3ARED 4Z8FH 2BC4B 5FKPB 3SY0B 2WIIA 3TN0B 1NCDH 5DQDL 1UVQA 4P4KD 1S9VB 5JO5A 3TCLA 3JWDL 1RHHA 2GYSA 1A6TB 2OK0H 3MRMB 3FB6B 1Z3GL 2O5XL 5H2BA 1JZ8A 3ZT5A 1ZTXL 1MCIA 1AC6A 1HH6B 3WUZA 1JHLH 2F54B 1XCQA 3ROLA 4KZDL 3N50A 1FBIL 3TBSB 4MB4A 3D39B 2EKSA 2A9MH 3EOBB 2X4PA 2J2ZA 5HGHA 4UT9H 1DQJA 1AKJA 1T0PB 2LE9A 3K7UA 1UEYA 1R5VA 4GBXA 2P7TA 2GAZB 1NAKL 2X4TA 4M6NH 1WTGT 5CGTA 1CXLA 5BRZB 2RR3A 5IB3A 3V6FB 1MHCA 4UB0H 5KAQG 1CDJA 3IFLL 1KPUB 1FE8H 2F53E 1LNUB 3UBXG 4L29A 2FSEA 1QACA 1FZMB 2OBGA 3BIAX 4M48H 1Y18A 5E2VL 4YDJB 2XV6B 2QQQA 4MNQE 1UH4A 4UNUA 32C2A 3GO1H 3H42H 1JFQH 3L3IA 3VGAC 3CMGA 1A3RH 1CFQB 4OM0L 5E2WL 3M17B 4ZUWB 2J8UE 3U7YH 2HT2D 4KQ4H 2Q7YA 1J7VR 4JPWH 2EXYD 3C8DA 1P4BL 3AC0A 4HIEA 4QWWC 1UEMA 3PQYE 2DYPB 2OQJB 4ISVA 4WWKC 5DI8A 3WXWH 2OX5A 5FO9B 2IJ0C 5CAYB 3TNNB 4Z7UF 2E7LA 4QHMB 1NCCH 2IANB 4PLJC 5HJ3B 5BZWA 3A67H 1O5DT 2AXFA 4NZJA 4PJIA 4R8WH 3PJSA 2BK8A 1INEL 5D72L 2FCBA 3V6OE 5KN5A 2ZOKB 5DHVB 4LGSB 3QIUC 3NIFF 4PB0L 3F12A 4PRPA 2HTLD 1QFPA 2XZCH 3FN0L 2PTTA 2P8LA 5EU4A 4PP2A 3BAEH 3FFCA 4M7LL 4N90D 2HJKB 1X5AA 3MLXL 5D4QA 4OFKA 4POUB 4UV7L 3Q5OA 5H94A 3ZYOA 2OJEA 3KPOA 4GXUM 1JE6A 1L6ZA 4R96B 2EC9U 1IGIH 2WMPA 1R3HB 1N0XH 1NPUA 4FXKA 5EORL 4N9GB 3HE6D 3CFJA 4RZCA 4WV1A 3AM8A 4OZGE 2DQIL 1B0RB 1FH5H 4QHNA 3QFDB 3C5ZA 3S7GA 3TBTB 1QSEB 1FC1A 3VGAB 1VGEH 3BHBB 3BE1H 4Y1AD 1ZHLB 3IDXH 3CIQA 4Y16D 2R0ZL 3SDDC 4LSUL 4WWKB 4NBZB 4F58H 1AGFB 3BVNB 1NFDE 5DD3L 5GRUL 5DQ9B 4Y88A 5E5RB 3INUH 4KJWC 4O9HH 1AP2A 4LPXA 3N1QC 2XN9B 4ODVL 4Z95L 3RX8A 2A74B 3UJJH 3OF6D 1MQ8A 3JV5A 2FR4B 1RIUH 1MREH 5ENWB 3QIUB 5JPNA 5K33A 5B38B 1OT2A 3GIVA 4YEFA 4O2EA 3TPUB 1H3XA 3MSPA 3UTTA 5JR1H 4NNYA 2V17H 2BSSB 3RX7A 1FNFA 1D5ZA 4GRLA 3B2VH 5GJTL 3BMVA 3IJYB 1VPOH 3U83A 2BDNH 3FONB 4Z77A 3CFCH 5J4MA 5DEFA 4QOKD 1Z9MA 4YPJA 5E6IA 1DANU 4OZIB 2BNRB 5AZEH 4TUOA 4NKMA 4ZFGL 5A3ID 4E41E 4FQ2H 5C0JA 3EYOB 5DURD 1ZT7A 2XACC 1KIQA 5C09A 4DGYL 4FXLA 3NBNA 1ZT4B 1MEXH 1JF1A 3SDDB 5BVJA 3QDJA 4OKDA 2VN4A 3A6CH 5E5UB 3JWDH 5CUSH 4F7EB 1FNHA 3V52H 3DSFH 4G9DA 3B4NA 4F7PA 1Z3GH 5CIPH 4GXUN 1UYWL 4MA3A 3SBWC 1BF8A 5FM8A 4MQXD 3BP4A 3G08B 1JTTA 5M95B 3QFJD 4LOUC 5IBLD 1LMKA 3QH3B 4P57A 4YFLF 3R8QA 4I48A 2VDPH 1K6QL 4QHLA 2IQ9H 2VLJA 2VITB 5BVPH 5ITFB 2IBZY 2YUZA 4YAQB 4R9HA 2ESVE 3QJHA 4PGZA 1DQLL 2ATKA 4GRWF 1QA9A 1RK0B 3ARWA 4HIJB 3QDGD 5I9QC 2AJUL 2P5EE 5HI4D 1DQTA 5E2VH 4Z76A 3D1MC 5D2NC 3TEUA 1G0DA 5DC4B 1ZEAL 2CLVA 3W0WE 3C5SA 2AJXL 4P2OD 4F37F 4PBWD 1P7QB 1KTRL 4GO6B 4PJFE 4OM0H 3TIDA 5E2WH 5EOTA 4H0HB 4LL9A 3RJDA 3OL2A 4Z78A 3WYRA 1G7LB 5ALCL 3MNVA 4NQCB 3PGDA 4V1DB 1KCLA 3MA7A 4QLRA 3DX9B 2P46B 3LRHA 4BM7A 4HH9B 4X83A 3L1OL 3O45B 1ZKAA 4K3GA 5B39G 3VCLB 4YR6B 4X9FA 3EYFA 3TBWA 4JM2A 2X89D 1INEH 1I9JH 1CR9L 2NY5H 4F9LA 1RJLA 4Y5VA 5JW4M 3SDXB 3BXNB 1BFOB 5GRZA 2BNUA 1EERB 1HWHB 4QF1B 3QDMA 4QRUA 3UTPD 2ZOLA 5D7LB 2FECL 3LB6D 4X6EB 4P2YA 4CNIB 3RY4A 4UV7H 3RU8L 1UQSB 5ACMA 2ZNWA 1MSPA 2F15A 1F3JA 4BFGA 2Z35A 2XPGB 1DEDA 4OFPA 4YHNA 1IQDA 1BHGA 5T5NF 2KL6A 4YBHA 3TLRA 4QTHB 5I9QB 1RVFH 2E27L 4OUUA 5D2NB 4BH8B 4LKCB 4PJGA 4CVZB 2X4RB 2VDML 5ICZA 1ZHNA 3MFFB 4KDVA 3RWHA 5K93A 5I2IB 3VI4E 3ET9F 3OBAA 2D0HA 4QCIB 4NQDB 1CBVH 4JDZB 3MJ9A 1AQDB 4R7DB 3RWFB 1LILA 5HI3C 4O51A 4KKAC 5DMIL 3GSXB 1KN4H 2R0ZH 2AEQL 4EXKA 4LSUH 3TA3D 4OCNC 1F6LL 4O5LL 2E7MA 5GRUH 2W0LA 4GW5A 1BQHG 3ARGA 1J8KA 1YECL 4KK9C 3BZFB 1AE6L 4U7KA 1H3VA 3QXAA 1ZXQA 1HSAA 3NGBB 4Z95H 1L0XA 5EUOF 1A6PA 1ADQA 5H8DA 5D2LF 1VFMA 3DX8A 4QRTB 3KPQB 3VG0L 5B8CC 2GKIA 5HVFB 5I76A 4M7KL 2DWDB 3WHXA 2UWEB 1CIUA 2GTZA 4D0BA 1ZGLM 3BKML 1A4KA 1ZA3B 3CLFL 4KMTL 4UIMB 3BRDA 3QNXB 4OIAA 4KAQL 5FYLD 3UYPA 1YEHL 1NCUA 1HEZB 5IT2H 5KVGL 4LLMB 3L3KA 1YDPB 4KKLC 4HT1L 4X6BB 4PGEB 3V79C 2YR3A 1FO0B 5FUCE 4U1KA 4BSWB 2FL5A 5FV2A 4IRJA 2Q86B 4WTXA 1UZ8B 1X5ZA 1C12A 3B5TA 2D9QB 1CXIA 4ZFGH 1U8NA 4LHUB 1RV6X 5FDYA 5TJWK 1J0YA 4I18C 3A0OA 1LP9E 4DGYH 4D0DB 1WIOA 1TZGL 3VXUD 5AAWA 4KPHL 5I30L 3CCHB 5EBGA 4WDIB 3QWOB 2GSIA 4XVUC 4Y4FC 5IHUH 3MJ9L 5HTSA 5JXED 1BOGA 3JWOH 1ZS8B 3EFFB 1KTDA 1L7IH 1TDQA 3DXAB 3MXWH 4PJEA 5B8CB 1S9XA 3SGKA 3MA9H 3HG1E 3DTXA 1A7PH 2H6PA 3CXDL 2VC2H 1K6QH 4R4BA 3HZKB 4GKSA 1WIUA 2X4OB 5D1ZD 4YHML 5BJTB 1B0GB 2VUYA 4WI4A 4FG6D 1ADQL 4YDIH 2CGRH 2H41A 2CUMA 4OFDA 4LOUD 3N1GC 1NCBH 1I1AD 5SWSB 5F6HJ 2O61B 1PZ5B 2UV3A 2NW3B 4JFXA 3RWJA 3GSVB 1CLCA 2AJUH 3MV9D 4PJ8B 4X4YA 4PJ5D 3SE9L 4HDIB 4LPYA 3O6FC 3BSZH 4FXGA 1NGXB 1HILB 2AJXH 3VXTB 2R1WB 3P4OB 4U1JB 5T1KA 4KVNH 3B8YA 4LNRB 4I18B 5HYSG 1WLHA 4HKZB 1JGLL 1YA5A 3HC4L 5HHXL 4M02A 3O2DA 2JJTA 1INDL 5CEYA 4YXKL 4MDIB 4JG0L 5F21B 1R3IL 3WUWG 4YUEL 3PIQA 5EO9A 3D87B 2FECI 2DQCL 4Y4FB 1MIMH 2X5PA 3RTQD 4EI6B 4PR5A 3KPPB 2PXYA 3L1OH 3FQWB 1A2YB 2ADJA 1XMWA 3L3DA 3OGCA 3P77A 4QT5A 3SKMB 3RBSA 4H1LB 5JHDE 1CR9H 1TVHA 4Z7OE 1OGAA 5SX5H 3VXOA 3QUZD 1MJJA 3BKJH 1AGBB 4PRNA 2QKIA 4HUVB 3EUUA 3UJIL 1JZ6A 2X1QA 4L4TE 5DJ0A 3RU8H 3VXSE 4RNRB 1Q72H 2LQRA 3VDCA 1EJ6A 1VFBB 3ELAT 4WW1A 3RWCB 3D85A 2ZSWA 1J5OH 1ETZA 4GXVL 3UPRA 2E27H 1XGUA 1SJHB 4M43L 2YN5A 3O6FB 4ZO6A 5HYEA 3MACL 1CN4A 2VDMH 2MKLC 2VWEC 2WBJD 4S0SD 3BN3B 4PY7A 4P5TC 3RNQA 4XCNA 3VWJA 2FH6A 5DGQA 25C8L 2AXHA 3NIFE 1UT9A 4HXAL 5C86A 1T0NB 3QIWC 1NL0L 4PPTA 3BH9B 5L2JB 1CFVL 2GJ6E 1FRGL 1TCRB 3PL6A 3JWNC 3DYOA 1PEWA 3WSQL 3TJEL 1FPTL 1YECH 2GK0B 1AE6H 1G9MH 2CR6A 3B9KB 2EDWA 5I1GL 5IB5B 4NQUA 1GC1C 4Y4HA 3O2DL 1G1CA 2CRYA 5C3LD 3JV6B 3MV01 3RWIB 5E4EC 4M7KH 3WLWD 3GMRB 3PHQB 1HXMB 4KK9D 4TTDD 1PYWB 1XF4B 2OXHA 3BKMH 1JZ2A 1RJCA 3MV7A 1U8MA 4KAQH 5IMLB 4NJ9H 2A2QT 5LGJB 5KVGH 4PYGA 5CJQL 4N5UA 4NBXB 3OKDA 5FDWA 3QUXC 4XTRC 4ZNEA 2EZ0C 4LQFH 3WIIL 1E27B 3BGFC 2PN5A 2KZ1B 2AV1B 1L9MA 5CZKA 1S7QB 4YHIA 3VFWB 5DYOB 1RIHL 1NGWA 3PP4H 1KOAA 3G9VA 1J88A 5L9DL 4OFYA 2HLAB 4PFEA 3ZE0F 4P5TB 3K2MC 1WAAA 3X17A 3LRGA 4P2CG 4MX7A 2D4FA 3LZFL 1IJ9A 1DLHA 4XNQA 2OSLB 3R8BB 2Q87A 3GUTB 3LQAC 8FABB 1YNTB 5I30H 1T4KB 5IUSA 1I9IL 3FO1B 5CILH 4X7TB 3LS5H 4QNPF 5GZND 3KYMB 1JCKA 3MJ9H 4EBQH 4H20L 4WUUA 3N06B 4P9MH 3L5XL 3BDYL 5E4EB 5FOBA 3T1WA 1RZJH 2A83B 2YN3A 4HX1A 1BECA 3LQZA 2BVOA 2BVUA 5TFSH 1Z2KA 4Y4KC 1I1YB 2DMKA 4M62L 4R97C 2OS7A 4PJAF 1BLNA 5AD0A 5IB1B 3U9UA 5HPMB 1ADQH 5F44A 4Y0GA 1KT2B 2YRLA 4X5XB 4M1DL 1U58B 4MSWB 3BGFB 1I8MB 5EU6D 1OCWH 4OCYH 2WBWB 3DO3A 1L7TL 2Y5TB 1RJZA 3SE9H 3WXVL 4G5ZH 3VI3F 2AJSL 4NO0A 1EZVX 1MCCA 1BJMA 4HV8B 4FZ8L 5CSZB 3LMJL 1YNKH 4AIXA 1MAJA 1G7MB 4KDWA 4PRHA 1JGLH 3HC4H 1INDH 3WN5C 2VE6B 2VKWA 4NQEA 4YXKH 3MC0A 4JG0H 4NUJA 1KIUA 5CS7A 2EDXA 4DFHA 4PREA 5CIPB 3NFSH 3K4DA 3BIBX 1VACB 4BK5A 1VGKB 3MLZH 5SX5K 3C8KA 3ULUL 2DQCH 2JIXA 4JGJA 2DD8L 2D9CA 2NY5C 5KS9B 2QR0B 2HG5B 4GRWE 1F4YL 3CVHA 4F9PA 5DK2A 5IMKA 5F7WC 4DOHE 2MQ3A 5DJ8B 4N0YH 1KTLB 2V2XB 3O0RL 4W4OC 3Q48A 4GMSL 4ZUSB 1Q94A 4Y4KB 1G7PB 1SJEA 4XPTL 4R97B 3RZCA 1FHGA 2DTML 4TVPE 15C8L 5FCUL 2BY2A 3HUJF 3C09C 4MWFB 1KIPB 1G6RL 1QLFB 2FEDC 1JGDB 3QO0A 4GKZB 1QG3A 1K4CB 5BS0D 2PO6A 4G7YL 2O93L 4RFEB 4F7TA 1RUAH 3LAFA 4NSKA 3HZVA 4J8RA 4NPYB 3TVMC 3DHJA 3VXPA 3LPWA 4M43H 5I1HL 3MACH 1YEFH 4D9RD 5D6DA 4P46D 4XXCC 2ATPB 3AUVA 4QRRD 3VH8B 1T3FB 5I0ZA 2V7NB 25C8H 4GS7C 1S5HA 1LK3L 3V4UL 1FIGL 4HXAH 3WN5B 1VEPA 4HLZG 3SKJH 2WIIB 5L8KB 1CFVH 4Z9KB 3VXMB 1FRGH 1FFOB 4U1GC 5JO5B 1OAYL 3TJEH 3TBVA 2VISA 3ES6A 2R0WH 1CF8L 5I1GH 2M8XA 3LEVL 2VZSA 1Q9KA 1MRDL 2A9NH 3L7EB 1RHHB 1T1ZA 3O2DH 5I1EL 3PG2A 3W2DL 1KJVB 2BFVL 3OAYK 5B38G 1KNOB 5H2BB 2F74B 4OCLC 1A6UH 3RY6C 4XXDA 3ZTNL 3SGJA 3FT3A 3N9GL 1S7VB 5KZCB 3CVHL 1NAMA 3C09B 3PABA 5D93C 3WS6A 5CJQH 4M6OL 4IDLA 2FNBA 2X4PB 5HGHB 5D5ME 4JPVL 1DQJB 3WIIH 1EJOL 3D18A 4JN1L 5I8CA 1YEEL 4HS6A 2P7TB 4JY5L 4FFWD 1RIHH 4LPWA 1N7ML 3TVMB 1S7XA 2X4TB 3IB4A 3V4VL 3MRHA 4UQ2B 1J0IA 3QUXD 5CJ8A 5IB3B 1T83C 1MHCB 5EUOE 4ZG1A 2F53A 4L29B 2BHZA 2VR9A 5F72S 4WV1C 1WCQA 2VXSL 32C2B 4GS7B 4MNQA 3WNMA 3FQXA 4WU7A 1MRCL 1CGVA 1MFBL 4MJIB 3C5ZC 1F4AA 3B3IA 1FNSL 3KYNB 4GG8B 3OGOE 5KSUA 2X7LA 2VXVL 4U1GB 4WEMB 3JWOC 4G43B 1I9IH 5DTFA 2J8UA 2Q7YB 1KEMH 2AV7A 3TO2B 4D9QD 4J3WA 4ISVB 3D0VA 3BGMB 3QXTA 3PQYA 4KY1L 1MLCB 4JFPA 3G6AB 3MODL 4IRSA 3LSOA 1IM9D 1BD2E 5GGQH 2AQ2A 3ESUF 4CW1A 4PJIB 1RQ5A 5DHYA 3EJJX 3V6OA 3RWEA 1WICA 4C83A 3QQ4B 1YZZA 1AJ7L 3F12B 4FQXA 3C08H 3KPLA 4M1DH 2PTTB 2P8LB 4PP2B 5I8KL 2VXTL 4NQVB 3FFCB 2AXJA 3ARYA 4JY4A 1CDYA 5H94B 3MLSH 1FYTD 3S5LB 4G6FD 5T1DL 3KPOB 3WXVH 3KR3L 3ZKQD 2AJSH 2UZIL 5IVNA 1T6VN 4FZ8H 2QSTA 2JB5L 4XP9L 4ZD3H 1AGDB 1F58L 1U8IA 5F9OH 4WV1B 1NBZA 5E6IC 5A2LH 1AXTL 4OZGA 1BEYL 4QHNB 3THML 3C5ZB 4H5SB 1HE7A 3GM0A 4WI7A 3QEQD 1MCJA 4EOWL 1TENA 2FATH 3ULVL 3KXFE 4RDQF 1ZLSL 5I15L 3JXAA 1MI5E 2DD8H 3VXRB 1M05A 4GT7A 1NFDA 1F4YH 2W9LA 4M1CD 1T03L 2NNAA 1MFDL 5EPMA 5GGUA 2P5WD 1U3HA 1T22A 1AP2B 3VJ6A 4M5ZL 1XF3A 3O0RH 4PGBA 3CDFA 4GMSH 1H3WM 4XHJD 5DS8A 2D3VA 4MXVF 4UQ3A 1S8DB 2DTMH 3Q6GL 2GHWB 5FCUH 3WNPA 5KOMC 5CD5D 4L1HA 3GIVB 3Q2CA 3UTTB 2ZUXA 4NCC2 4NNYB 3S34H 3QPQC 3CMOL 1RPQA 2FO4B 3MV8E 1GGCL 1D5ZB 4GRLB 4PRIE 2F8XC 5CCKH 1LO3L 5I1HH 1H9VA 2GT9A 1MCNA 4Z77B 4ZFFA 2K7PA 5C0IA 1K3ZA 5DEFB 1HHJA 3G5YA 4ESKA 5E6IB 4U6YA 5DUML 5ESVB 3V4UH 4NKMB 1FIGH 4E41A 3KDMA 5C0JB 1UCBL 1G9MC 1D9KA 4TQEL 2PR4H 1ZT7B 1KIQB 4NN5C 1KB5B 1LD9A 3VD5A 4NZUH 1JF1B 5BVJB 4OD3L 1ZLUH 1CF8H 5H35A 4MQSB 1JNLL 1YJDH 1CXKA 1F11A 5MERA 4LVNC 5I1EH 2N7BA 2AK4E 2X1PA 3T65A 3N1FC 4G9DB 5TE6H 4DVRL 4F7PB 4PJ9A 3IXAA 2VDRL 4DWHA 1PX4A 3F65A 3G6DL 4X9BA 3RHWF 3RWGA 2QHRL 2CH8A 5KVFH 2VTFA 1NDMB 2GY7B 1JRHL 1FORH 3O3DA 4C55A 3ZTNH 3BP4B 4YZFF 1NGZB 3N9GH 1UCTA 4F9LC 2YA2A 2EDQA 3CVHH 4P57B 1A7RL 4I48B 4QHLB 4M6OH 4Y2DC 1NC4D 4JPVH 1T20A 1EJOH 4HG4J 2VLJB 3WIFB 3K1KC 1CE6B 3WJLC 1N7MH 4RWYL 3V4VH 1X4XA 3CSYA 2ESVA 1U92A 2ATKB 1QA9B 3VMOA 4LHUG 1UJTA 3LKQB 3C60D 4G9FD 5E9DB 4AM0B 5DMGC 1DBKL 2P5EA 5DZNA 3VW3L 3K1DA 2CLVB 2HRPL 2DBJA 2O26U 2VXSH 2R29H 3C5SB 3DURA 1CZ8H 1Z0NA 1MFBH 4NQTA 3W0WA 5T1LA 3RA7H 2NZ9C 1MCQA 2DM4A 3MCG1 1PW3A 4PTTB 4PJFA 1MF2L 3TIDB 2VXVH 5EOTB 4W6YB 5D7JC 1BFSA 3QPXL 5E95B 4Z78B 2VERN 5ADOL 1VFAA 3DYPA 3RPIA 3MNVB 1RZJC 4LVNB 3PGDB 5FM5O 5C0GA 3MA7B 5HI5C 1FNEA 4PV8A 4JPKH 3SDAD 4HSQA 1AGEB 1QD0A 3JTTA 4N90E 1KEGH 4WJ5A 5ID1A 2FHBA 3EYFB 3SJVB 4JM2B 3TBWB 3MOBL 4XPFL 3LKRB 1LGVA 1RJLB 1P9MC 3FB5A 2BNUB 1D6VH 5GS0H 4Y2DB 3ARUA 1AH1A 4J4PA 3QDMB 4QRUB 4ENED 3I02B 1AD0A 2VXTH 4M9PA 3MQIA 2BHYA 3CFDA 5DRNA 1PG7W 3NACL 4XPHL 2D7TH 4I0CC 1BWMA 3T0ED 1F3JB 2Z35B 1UFUA 2Y9RT 4QNPE 1NAMH 3KR3H 1IQDB 1I7TA 1R3KA 4JCLA 1GPOH 1ITBB 4HKXA 2UZIH 1F58H 4TYUA 4OUUB 2EDDA 4JQVA 2RCSL 4PJGB 3HLAA 4MA8L 5ICZB 1AXTH 1BEYH 1ZHNB 1JGUL 3GHBH 5DUPH 4GJTB 5CZXD 3RWHB 4JDTL 4NRXA 4EOWH 4PJAE 2EIDA 3ARDA 1ZLSH 5E24E 4HAFA 4P2QB 2EIZB 4Q6YA 4U2ZA 3O3EA 2I5YL 3CU1A 4H1LG 4NP4L 1W0WB 4GW5B 4JFQB 5C07B 1T03H 2VR5A 4BSJA 5JXAL 2YPVL 2E9IA 4OLVL 3DX8B 2MTPA 2P45B 2ZCLL 5C8JB 3D39E 5I76B 3Q6GH 3WHXB 4HFWA 1DSFL 2DAVA 3E2HC 4D0BB 4I3SH 4KRPD 3MJ6A 1QVOA 1YEKH 3LEYL 3EKCA 5MP6L 1ZVSA 4QOKE 1LEKA 1ROWA 3D2UD 1QLRA 1T2JA 3L3KB 1CDBA 3LY6A 1J11A 5BRZE 4J3TA 3RVXC 4HWEL 1X9QA 4D9LL 1VENA 4U1KB 3WFHA 1BQSA 1QSFB 4QXGL 2OXGA 1ZA6A 2VLRA 4L8BA 2J12B 5MEPA 4HHAA 3WFBL 1C12B 3CUPA 2QSVA 2N1KA 1ZLUK 4HJGA 1CFNB 1U8NB 1PEZA 1T2XA 1UADC 1JRHI 2V5TA 3MBEA 1CGTA 4FNLL 3MGOA 4M6MH 1C1EH 1TETL 4HZAA 1LP9A 4ALAL 1I3GL 4KTEH 4UT6L 4OD3H 2XKUA 3UYOD 1JNLH 5EU3B 2FO1A 1T89A 2WIMA 2K3TA 4X99A 3TN0D 1S7RB 3W39B 2GSIB 4I9WE 4DVRH 2NY7H 3G6DH 3IU4L 2YD8A 2QHRH 4B7IA 1BOGB 1QR4A 1IL1A 5C70A 1KTDB 3B5GA 1JRHH 5GRJL 4OQ1A 2IPUK 1S9XB 5DJCB 4L3CA 4QXTA 3DTXB 3HR6A 3HG1A 5KSAC 4OZFA 1A7RH 2DMCA 3E2HB 4LK4A 4R4BB 5T3ZD 4PRDA 1JPTH 1VFOA 2BP3A 4GKSB 2HFEA 4LCIH 2EEBA 4Y5XC 2CO7B 3NIDE 5HPOA 5K9QG 3IRZA 3BQUD 5LBSL 3I9GL 4C56D 3L5WA 1ED3A 5C2BL 2GFBA 1KGCD 4YEEA 4MD0A 3KS0H 4HKBA 4UTAL 1M71B 4JFXB 5I1CL 3C6LD 1NGQL 4P2RD 1DBKH 4GW4A 4X4YB 3VW3H 2IPKA 1T1YB 1ZK9A 3MPCA 2HRPH 1QSEE 4FXGB 3O4LD 3VFSA 1T1XA 4ODSH 1WTLA 2CKBA 4XCFL 4TPRL 5T1KB 3VWJC 3RDTD 4PRAA 1IGML 2LVEA 1MF2H 3V9FA 4HUNB 4MJ6A 3U0WH 3V7MA 1SEBA 5CEYB 2UY7A 5L7XL 1M7IA 3QB7C 5CFHA 2HFFA 3GM8A 5EO9B 1JWSA 4B50A 4FABL 3A6BL 2XN9E 3U46A 3UTPE 4PJCF 2PXYB 3OTTA 4JREB 4UTBL 1I1CA 2ADGA 1VB9A 2ADJB 4QT5B 1YUHB 1N26A 3S8WA 5I17A 1RUMH 2R2EB 1TVHB 3HFML 4J3SA 1OGAB 5JHDA 5KSAB 3G5ZA 3VXOB 4PRNB 2VUOA 4X5LA 3WJJA 5FHBH 4Y5XB 1HQ4B 3O9WD 3IGAA 3CH8A 2V5MA 3BRFA 2OYPA 1GYAA 2R56L 4O02L 5A2FA 2OR8A 5DJ0B 4XPHH 4ODXB 3VXSA 1ZVYA 3SDCD 1X6NA 4L4VB 1PSKH 4X6FA 4JRYE 3S98A 3D85B 2W0FA 2ZSWB 2JB6B 1ETZB 5A43C 2G5BA 1OLZA 3UPRB 5FM4A 1FL5A 2RCSH 3ARFC 3CK0L 1DUZA 4ZOBA 3IDYB 3QI9A 2ZZUT 4GUPA 5F7EH 3PGCB 4PY7B 4JDTH 3QNYA 3VWJB 4K2UL 4RBPH 5KVEL 1GGYA 4A6YL 3I2CL 3ZKND 2FGWL 4IIQA 4WW2F 5F1SA 3GSQA 1BVKA 3IDGA 4TULH 3ZZ1A 4NP4H 2GJ6A 3K2UH 4EKXA 3MFGB 5IQ7H 2CKBL 3PV6A 4PP1C 3K3QA 4L9DA 3U6RA 3BDBA 4O58L 1N0LA 2YPVH 1TVDA 5GS1C 5FYLE 2B1AL 4IS6A 2ENYA 4DKDC 5JNYA 1MJ8H 4OLVH 3U0TA 5SWZD 2BVEA 4F33B 2CRMA 3H6JA 3H3KA 5GJSL 2R39A 1L4IA 3QIBD 3LKNA 2NY2D 4EI5D 5C9KA 2CPCA 4PRBA 3O6ML 5C3TA 3MV7B 5F9JA 3JVGC 1U8MB 5MP6H 3D48R 1MCEA 4XCYA 1MWAA 4IJ3C 2XTJD 3OKDB 4M61A 4JR9L 2BVTA 3F7YA 1UM6L 4NZTH 4HWEH 3VH8G 4K3DL 4YHIB 1B90A 3WLBA 1NGWB 1HHGB 3LKPA 4QXGH 4XNZB 1B88A 4F15C 3ARFB 3BKCL 5I66B 3WFBH 2C7UA 3HRZA 1DZBA 3QZWB 5J12B 3VD9A 3SDYL 2Z0BA 3ZTJH 1BQUA 2XY2A 4MX7B 3BFOA 3KWWA 4X7FC 4HUKB 1YJDC 1TETH 4XH2B 4OD1H 4BELD 2ZUYA 1DUYA 4KJPD 1I3GH 1S78D 2IMMA 1S5IL 4UT6H 4V1DE 3PNWB 4DQOL 2DF3A 1X5KA 5KVMC 3T2PA 4HIIA 5F7FA 4IOFD 5GS1B 1CLYL 1JUFA 2WINA 2B2XL 3IU4H 4XP4H 4WUUB 1GZQA 2BXYA 5GRJH 1IE5A 5M7QA 3OZ9L 2Y36L 3SDXE 4HX1B 3AS0A 4K8RL 4I3GA 3VXNA 3LQZB 3TF7C 2E7CA 1DQQA 3NCFB 4PGCA 5D7LE 3IFNL 3RZCC 1IGTA 4PJ5E 1MAMH 2ZJSL 3I9GH 3NA9L 5LBSH 3U9UB 2C5DC 1TITA 4DZ8B 4IJ3B 4JFED 3SCMA 3BPOB 4JZNA 2WV3A 5I19L 2VDQL 2VXUH 1OAKL 4LIQE 5LAXB 3E6FA 3DROB 2P43B 2PO6C 3MLTA 4NFDA 43CAA 4HIXL 4F15B 4HGWB 4XAWH 1A6VL 4XI5C 5TDPB 4MA1C 4TSBL 1D5XA 2FBJL 3ZHLA 4XBPA 5D6DC 2YD4A 2DQFB 4NKIH 4NQDE 1RUKH 2HH0H 4XCFH 4TPRH 1JIBA 1IGMH 1F8TL 4X7CC 1TVBA 4PRHB 1FGVH 3JV0A 1I4FA 4NQEB 3AGVA 1X5IA 2Y07H 4NUJB 4F7CA 4HJ0C 3MLVL 4PREB 3V6BR 1CD1A 1XGRA 1IARB 3H2WA 2JIXB 3A6BH 2VLKD 4XX1G 4DKFL 1WBYA 1A14H 3HE7D 3NZ8A 5TDOB 5A2KH 5GS0C 2UWEE 3HFMH 3DGGB 2BHUA 3TO4C 5E08L 2H45A 2XG5A 4C4KT 3JBG7 4XC3L 1SJEB 3V0VB 4APQA 3RZCB 5C6TL 2PW2A 2BSED 4WFHE 3SGJC 4NKQB 2R56H 5CGYD 5TQ0L 5CJ5A 3EOAA 4O02H 3LIZL 3S5LG 4KI5C 1NMAL 2HT4C 1RZKC 2V9QA 1JPST 1QHPA 4OZFH 2XKNB 1T66D 2BRRL 3Q6FA 2PO6B 2HJFA 4F7TB 4NSKB 3STLA 4J8RB 1HN1A 2DKUA 3I6LD 1BZ7B 3IXTB 4MA1B 3CK0H 3QCVL 1K4DA 4LLVA 3NFNA 3OG4B 3PWUA 3WS3B 2XQBH 4K2UH 4PD4K 5LJYH 2NLJA 1HQRA 1S5HB 2C4FT 5I1JL 2K7QA 1WC7A 3EYQD 5DRXA 1Q8MA 1XEDA 4MHHI 5D1XD 3AS3A 1U8PB 4L4JA 2CKBH 3FZUC 3BZ4A 3TT3H 5CKGA 5F7YC 4P23A 3TBVB 1MFCL 2VISB 4O58H 3QQNA 4LBEA 3DXAE 2HMIC 1T1ZB 3V7AG 5F7DA 2WK2A 1URLA 5IFAL 5GJSH 2ARJQ 4MLIA 2IAMD 4KK6C 5CEZL 5C0EB 4X80L 5B39A 5D70L 3O6MH 5JW4Q 3FT3B 4JFDB 2IALB 4HUUA 1YPZB 1NAMB 3PABB 2H2PC 3VWKA 2LFGA 4FQXC 5SWSE 4JR9H 5FA4A 3QHFL 5D5MA 3EW3B 3D3VD 3BJ91 1UM6H 4X6CB 3D18B 4LLAA 1NC2D 4OCXH 1S7XB 4LLDA 1VCAA 4TVPL 2NX5B 3MMEA 4V2CB 3UBXI 3BKCH 1I3RA 5HDQH 4PLNC 1JWUA 5EUOA 3ARXA 2F53B 3FOLA 3ARZA 1OTTC 3RBGA 5IMOB 1IAOB 4CRPA 4MNQB 1SBSH 3DOSA 4JZJC 3FQXB 4WU7B 1KCSH 4OZHF 1KLGA 4M4RA 5KSUB 2IH3A 3PWPB 3DVGA 4LPVA 1W72L 1XR8A 1P6AB 1A1MA 4I13B 1RK1A 4HGMA 3KLHD 1I7RA 1YN6A 5J06A 2J8UB 1HNFA 4NHUA 4X9HA 1X5LA 1JTPA 3L7FB 4WTZG 3Q5YA 4EN3D 1CLYH 2B2XH 3PDGA 3D0VB 1B4RA 3PQYB 2H32A 3C5JA 2CR3A 2VO5A 3FQTA 4JFPB 2QTEA 5LCVL 5C0DA 3VGGA 4KTYA 3OZ9H 2Y36H 1BD2A 2EO1A 3K8MA 2WLZA 1U8OA 1UG9A 5J1AA 4JG1L 5DHYB 3VRIB 3RWEB 4C83B 3BEWA 5JQ6H 2ZJSH 4P9HC 3NA9H 1MCDA 1EDQA 1NBVL 4FQXB 4G6JH 1Z5LB 4JKMA 7CGTA 2VDQH 3VGBA 3P9WB 5T5FL 1EGJA 1UWGL 3MRIA 3RI5K 1JZ7A 4MXQD 4NQXA 2BNQD 4JY4B 4K9EC 3VRLF 4ZS6D 4PBVC 3LKOB 1A6VH 1MWAH 3IAGC 4QRQB 2VDOL 4TSBH 2YPLD 3QUKA 1ES0A 4ODUB 1U8IB 3ALWA 2IQAA 5EDXA 1HINL 4KROC 4MVBC 4XGZA 1NBZB 1F8TH 4JZJB 4PJ8D 1LO2H 4JO2L 1C7SA 5GSRA 1K8IA 1A6AB 1ZMYA 1IEAA 3FRPG 1BBDL 3HZMA 3ARSA 3MLVH 3KXFA 4U0RC 1YEJL 5E8NA 5INDB 1MI5A 5AG9A 2AEWA 4Y19D 5EN2A 1OF2A 2EE2A 1GCFA 1A0QL 2NNAB 5EPMB 5GGUB 1B0WA 1A4JA 4JFYB 1U3HB 1T22B 4PJ9C 3VJ6B 2W59A 1XF3B 1MRFH 4PGBB 3MGTB 3WNOA 1C5BL 5E08H 5EOCL 5DS8B 3O8XA 4OTXL 3CLEL 3GSNL 4XC3H 3KYKH 3DARA 4ZMAT 5C6TH 3OKYA 1WJ3A 4DTGL 5JW3H 12E8L 1TJIL 2W9DH 1PG7L 5I8EA 5TQ0H 1QQDA 1II4E 3LIZH 4DVBA 1DLFL 4N8VA 4D9RE 4GG6F 2F5BL 4CAGA 3TO4D 6CGTA 4X4XB 3K80A 4AIZB 2BRRH 4MQTB 3MLYL 4HPOH 3NN8B 3WFDH 4EJ1C 2EC9T 3MV8A 5EOQL 5I1IL 4WUKL 4M03A 2XNAA 4POZC 4PRIA 4KI5D 2FWOA 5DEGA 2GT9B 4FFYL 3X3FL 3C9NA 2VRAA 1T5WB 3QCVH 4K3JH 4ZFFB 4YFLI 5C0IB 4JRXB 4KROB 1HHJB 1EGJL 5IW6A 1KB9J 5E8DH 3C8HA 4KHXL 5DD5L 5E2TH 4U6YB 4HW6A 5I1JH 4CMMA 4RGNC 4CADA 1A9EA 1QOKA 3CU7A 3MCKA 3VFNA 3KDMB 2CKNA 3MNWB 2EDJA 5IV2A 1FZJA 3H0TA 3KPRE 1LD9B 2NYYC 3MJGX 3DPBA 3VRJA 1F11B 3SO3C 3WUWA 4G8GD 4KTDL 2AKRB 4JHWL 3T65B 3QBTB 3QXWA 2AK4A 3H7BA 4QY8A 4PJ9B 3IXAB 1KJMA 5D6CA 3HAEB 3RWGB 1PX3A 3MUY1 4M8VA 3B9KD 4LAQL 4X80H 3O3DB 5D70H 3MJ7A 3LEXA 2HMID 1KC5L 5ESQA 5C71A 3BZEA 1WEJL 1AY1L 4GRWH 3CGTA 1LO5A 5IEKA 4J4PC 1T20B 3RVVC 3EHBC 1TTGA 1H3UA 5I74C 1YY9D 2XZAL 2IH1A 2MMXA 4TVPH 3CSYB 2ESVB 3LPFA 4JO1H 5GZOD 5I1AA 5I8OL 5C6WH 5FECA 4WHTB 1QRNB 2R2HA 1TPXC 4HJJL 1MCSA 3GIZH 2YKLL 3L5HA 4FFZL 2P5EB 1ZAGA 4D9QE 4JQVC 4ODBD 1PDKA 2DIBA 5GGTA 2QQLL 3W0WB 4B7LA 5T1LB 1VADB 1MIEL 3WE6B 1H8OA 1LEGB 1KXVC 5IVXB 4PJFB 4AMKL 3QUMA 4IRZL 2YXMA 5HSFA 3WMSA 2CLRA 5J56B 1KLFA 4E0RA 2I24N 4LLWA 3RPIB 3MRFA 1JV5A 5C0GB 2GEEA 5F7UA 3S4SB 4PV8B 5LCVH 4LPUA 3FAWA 3MRPA 2ICWJ 5DJAA 1RZ7L 4I0PC 4K23H 4LCWD 5C0CE 3JTTB 1Z6JT 3SKOB 1X5FA 1NLDL 1N2RA 2Z4QB 5ID1B 1FVEA 5HHMB 3UTSB 4JG1H 4YFDB 5CBAB 1FYTE 4PJ7E 4HUMB 3T77B 1RMFL 3UXFA 1AIFB 1OSPH 1DP0A 1NBVH 2Y5EA 1WWWX 1CWVA 2P24B 4OIIL 1U9KA 4PY8I 5GXBB 5J6HB 1AD0B 3HE6A 1EXUA 2OL3A 3CFDB 1G7QA 5DRNB 4WO4A 5I74B 1QFHA 1VESA 1CQKA 1DBAL 1KCUL 4PJBB 4YGVA 3AROA 1U93A 1ZVHA 1QP1A 1I7TB 1R3KB 2VDOH 5DZOA 4LEOA 2JE8A 3QNZB 1HINH 3TBYB 4Y16A 3HLAB 3CFKA 4U1IB 1QKZL 2FZ3A 5K9JL 5J0BA 4JO2H 1DR9A 4HPYH 3RZWA 5ABDE 3SY0A 1KCVH 2E6PA 3VXME 4NRXB 5L2KD 3IRPX 3EOTH 1BBDH 3MBEC 2VDNL 4HMCA 3ARDB 4OLWL 4NN6C 4PJAA 3RVUD 4U7SA 2PF6A 3DMMD 1WK0A 1N59A 3OF6A 2VDKL 5SV3A 3ZE2F 4NC0B 5I18L 4HIHA 4UOW1 5HYFA 4LCUA 1T89C 1D7FA 4MCZA 1A0QH 2VL4A 1H5BA 5MEND 5IB4B 4I0PB 4X7SH 3QUML 5IWLC 1C5BH 5IGXH 2D7PA 2IEPA 1J0KA 1KYOJ 1KJ3L 1GH7A 2NY3C 4TNWF 3D39A 4DTGH 12E8H 1LHZA 2JJUA 1OSZA 2H32H 1D6EA 1TJIH 1PG7H 3QCUL 2QSQA 3V5KA 1EFXD 1KLUB 1QVOB 2F5BH 4CDHA 4YK4C 4QOKA 3TWCL 1QLRB 4R0LC 4BA8A 1DL7L 3QWRA 2R23A 4MA7L 5I1IH 4WUKH 1EMTL 5GRXG 1QZ1A 5BRZA 3V6FA 3L5IA 3MRKA 4G3YL 1KPUA 1P6FA 4FFYH 4W81A 3X3FH 3WFHB 4JAMA 4MS8C 5TH2B 3BN9C 3PHOA 3OJMB 1EGJH 4XP5L 2VLRB 2VLLA 4L8BB 5MEPB 4MJIE 4KHXH 3DETC 5DD5H 3GMPA 3CUPB 3P4MB 1R3JA 3SQBA 4HJGB 1W0VB 4CGTA 1CFQA 3EAKA 3MBEB 2I25N 4Q9RL 3F7VB 3ZHDA 1LP9B 4PJHF 1CDHA 3RNKA 5JIKA 2DYPA 2OQJA 4RGND 5FO9A 2CDEA 1SM3L 4X99B 3Q1SH 3STZB 4JHWH 4KUZL 3S88L 4QHKJ 1C8PA 1XR9A 4QKXB 5F88A 1CXFA 2Y1VA 4OGAC 1CVSC 3TZVC 1IL1B 4LAQH 2DLIA 1PQZA 3QJFB 1RUPL 2NY3B 4QXTB 3IDUA 3HG1B 1CLOH 1H0DA 4PRDB 4ZUUB 1LE5A 2NY6C 4G9FE 3WJJC 2DM2A 4YK4B 2X44D 4BQBA 1UXWA 3EJZD 2P48B 3L5WB 1BIIB 4L3AA 3U30C 4FA8A 1ED3B 5I1DB 4LCCC 2DQJL 2XZAH 4YO0B 4P2OA 2NY4C 3QZWG 4HKBB 2YA0A 4WEUD 1WZ1H 1R3HA 4U1NA 3MXVL 1P84J 4KV5F 2NQCA 1AKJD 4JKLA 4HJJH 4N9GA 5E99L 3DVIA 4GBXD 2IPKB 2CJUL 2MQCA 2JELL 2APXA 3QFDA 5EBLA 4PV9A 1QSEA 1X7QA 1T1XB 1MIEH 1OY3B 3G9AB 3KYOB 2XA3A 4PRAB 2DI9A 1NJ9B 1ZHLA 4AMKH 4MXWL 2AEPL 4JVPA 3GSOA 4LP4A 1JPSL 4IIQC 4WWKA 3VXRE 1AGFA 1M7IB 1TJGL 2D2OA 3BVNA 3O4OC 3TFKC 5DQ9A 1AR2A 1OTSC 3OSKA 1JWSB 3FMGL 4FQ1L 2MSPA 2XN9A 3B9AA 3U46B 3L3OB 5KTEL 5AYUL 1RZ7H 1F45A 2ADGB 1OAXL 3TZVB 1NLDH 3N85H 5I17B 3V7AE 3T0EE 1KN2L 5ENWA 5EZLA 4NGHL 3QIUA 4NIKB 1EV2E 5JHDB 3G5ZB 3DRTB 1RMFH 3A6OA 4JZOA 3GBML 5B38A 3ZKMD 4OIIH 3SN6N 4OZHE 3IGAB 1HOCB 5C0BD 4S1SH 4WCYL 2BSSA 3HNTL 4LCCB 4ZUTA 2DIJA 5DC9B 1OVZA 3GKZA 1PKQB 3T2QA 1DBAH 1KCUH 2NY4B 2C1OB 4PRPD 3IS1X 5FHAH 3PUCA 4XAKE 4X6FB 3FFCD 4JRYA 2W0FB 1U6AH 4Z7UB 2G5BB 4OF5A 3TA3A 1DUZB 1NUFA 1QKZH 2G60L 3QI9B 5DVNA 5K9JH 4GUPB 2LU3A 3T1FA 2NY1C 2V2WA 3QNYB 3RKPA 4KKCC 3HI1A 5C1MB 4R7NA 5BW7C 3SDDA 1I8KB 4IIQB 5T3XE 1Q38A 2VDKH 5DJ2B 4HFUL 3O4OB 2IG2L 4I3RL 1CD9B 1MFAL 3IDGB 3JSSA 4PJDF 3FHAA 5GGTH 4BZ1H 2AQ1A 3EO9L 4TTGA 5EZOH 4DKAA 5A2JH 4FQCL 1J18A 1PBYA 1WT5C 2K1MA 2IPUG 2Q8BL 3U6RB 1XGTA 1MCPL 3QUMH 4IS6B 5CJOH 2DQEH 4BFIA 5C0RL 3U0TB 1UJ3C 2B20A 4LHJB 1KJ3H 2BSRA 4UZGA 5HGAA 5H37H 4E5XB 2IGFL 3QEGL 3LKNB 2QQKH 1BFTA 5E1AB 2P8PB 4LRIC 4PRBB 5F9JB 2YD2A 1Z9LA 5ITFA 3TWCH 5DK0B 1MWAB 3B9EA 1DL7H 4M61B 3SCMC 4UILL 3BPNC 5I1LA 4MA7H 3G5XA 4UDUA 1RK0A 5CEXA 1TTUA 1KCKA 3AXLA 1X6LA 5E9DE 1LEIA 5JZ7D 4HIJA 5IJKC 3OR6A 2OL3H 4GRLD 1RAMA 2F8OA 4F2MA 2C7UB 2FHFA 2KH2B 3QRFM 1P7QA 2NY1B 1A7OH 1WBZA 3NABH 4FQIH 5JXEA 4Q9RH 1T2QL 4GG6E 2APWA 2QJDA 4WU5A 3WFCH 2VL5B 4J3XA 4V1DA 3LH2L 4AJ0A 1JYNA 5T3ZE 3IETA 3G04B 4KUZH 1U8KA 2DJ4A 3S88H 3O45A 4HIIB 5C09D 5D1ZA 2WINB 4E9LA 4C56E 3SBWA 1IFHH 1LQSR 3SJVE 1O0VA 3QDJD 1QUNA 1J8HE 5E5MA 4QXWA 1AQKL 4XWGL 5EA0L 1MQKL 1QLEH 3SDXA 3BXNA 1BFOA 1DQQB 3RY5A 5CLWA 1U3JA 3QQ9C 1JPFB 5D7LA 4PJ5A 2WW8A 4CNIA 1KFAL 1UQSA 5SX4I 3SCMB 2DQJH 3BPNB 5IESL 4QHUA 2ZG3A 3OKMA 5DFTA 2NY6D 1F6FB 2DJSA 1GGUA 3E6FB 5ANMB 2J6EA 3UP1A 3MXVH 5DFVD 5IVOA 5AWNL 3MLTB 4ONFH 2JJWA 1AGCA 4LKCA 2CJUH 3OXSB 2X4RA 4CVZA 4XMPL 3P0YL 2JELH 3MFFA 1D5XB 2APBA 2J8HA 4XBPB 2UUDH 3S6CA 1CFSA 4GAFB 2Y6SD 1DVFC 4NQDA 4KI5F 3CH1A 4JDZA 4QCIA 4UDTA 2Q8AL 3ABZA 5SX4H 3RTQA 3WEXA 1AQDA 4P2QE 5GGVY 4R7DA 3WFEH 5HHVL 4MXWH 1E4WL 1IGYA 2AEPH 1CICC 3GSXA 5IMMA 3TM6A 2PTVA 1TJGH 4F7CB 5F9DC 4JFFD 5C07E 4MDJA 1OD9A 4Q74A 4LEXL 5KTEH 5AYUH 1OAXH 3GBLA 1KCRL 3NZ8B 4QRTA 4GRWB 3KPQA 4I2XB 2DWDA 4DOHB 2JKXA 5HYJB 4NGHH 2UWEA 1K85A 3TIEA 4UIMA 5C0ND 2PW2B 4QXUL 1RURL 1HEZA 4LLMA 2VNCA 3EOAB 3HNTH 5ESAB 3N1PC 4RQQA 4AEFA 3DRQA 3VWKC 2Z8WC 4RRPG 4J23A 2WBJA 2XWJB 2WWKO 3RKDD 4S1QL 1P4IH 3MBXH 1LE9A 1FO0A 4RCAA 2HJFB 1S9YA 4RAVB 4BSWA 1QSFE 1N64L 1XF2B 3STLB 5IOPA 2Q86A 3S36X 1BJ1J 1ZLVH 1IEHA 5TE4L 2G60H 3NFNB 1QBML 2E3VA 3CC5A 4JO3L 4LHUA 3OPZL 5F9WC 2PYEB 1WWAX 3O11A 3H9ZA 4YE4H 1HQRB 2VQ1B 4JJ5A 5SWZE 4GOSA 5DRXB 2M1KA 4M7JH 4KK8C 2IG2H 5D71L 2B5IC 1MFAH 3CCHA 1OTUC 4ODWA 2DTSA 4YC2C 4Q0XL 3BZ4B 4FQCH 4P23B 1AXIB 1JZ4A 3EJYD 3EFFA 3GSWA 1S7TB 3T08A 1V8HA 4WFED 5C0RH 2XTJE 4DW2L 2R0KH 4WY7L 5F7DB 5D7IF 1XIWD 4GFTB 3ARGD 2HYMA 4RX4D 4HLZH 3TJHD 3Q3GB 3TT1H 1JF5A 5B39B 2FD6L 3ZLQC 2X4OA 3SO5A 3HI6L 5BJTA 1JBJA 1FFNA 4HUUB 1QFWL 3VWKB 3HC0B 2MHAA 5D1QC 4UILH 5FA4B 5SWSA 3CAFA 1RULL 2O61A 3VU2A 4P3WA 3MRGA 2IPTL 3QQ3A 3ULSB 5T33L 4LLDB 4D94A 4HDIA 2XKSA 3CSBA 1KSRA 1FCGA 1I3RB 4HK3N 3VXTA 1XAUA 2R1WA 3P4OA 1JWUB 5HDLA 5EUOB 4U1JA 4Q9CA 1GHFL 5F9WB 1R24A 5D2LB 2KBGA 1FO0L 4IRJD 4MCYB 2D31B 2FX7L 1KLGB 4EQ3A 2J4WH 2YUWA 3FL7A 2B5IB 3DVGB 1G0XA 1TLKA 1XR8B 3W11C 3LH2H 4YC2B 1A1MB 1ZT1B 4Y89A 3HAEG 4Y4FA 1YN6B 5GSVB 3UTOA 1ZV5A 4OD2B 2XQYG 2H32B 3IJSA 3C5JB 4LVEA 3K4ZA 3NPZB 4H1LA 4DN3L 4MAYC 5C0DB 1AQKH 4XWGH 1MQKH 1JNNH 1AGBA 1BD2B 3DVFA 1U8OB 4HUVA 4NQSB 1FJ1A 4JFOA 1A02N 5KSBF 3BEWB 5FYLH 2N56A 3RUGF 1KFAH 3RGVC 4MJ5A 5F7MC 5KS9F 2OTUA 3D5OF 5IESH 4J12A 4L4VE 2APVA 2H8PA 1T0MA 3MRIB 1BZQK 2LU7A 4NQXB 4NZRL 1H3PL 3WIHL 3OAUL 3EGSA 2LVCA 3AREC 3G5VA 3LCYA 4XMPH 2W38A 5EOCJ 1KG0B 3QUKB 5EULV 1ES0B 3R0MA 4P4KC 1QFOA 2IQAB 2Q8AH 1I7UB 2AJYH 4XGZB 3JUYA 5HHVH 1E4WH 1T0NA 5GSRB 1OWWA 1FN4A 3BH9A 1IEAB 1NCDL 1IILE 5IHLB 4WEBL 3W9DA 3S4SG 4UNTA 4DK3A 4PIRF 5IW1A 1DVFD 2GK0A 5ITBL 1RZIB 2XZZA 3O6LH 5E8NB 4PJXF 1EAPB 1MI5B 4G6AD 3U4BL 5K9KB 3GSUA 3BYYA 5EN2B 3S37X 2WP3T 1KCRH 1OF2B 2OK0L 3X11A 4MAYB 4KV5E 3PHQA 1SHMA 1PYWA 1JMZA 2WZPD 5IMLA 1Y0LA 5EFIB 2GSGA 3I6LE 1RURH 2XICA 5I8EB 1QQDB 4N8VB 4OCRL 1MJUH 4P46A 2NMSA 1ZLVK 1IMHC 3KAAA 3VFWA 4FMKA 1MFEH 1UWEL 4OCSL 2WWMD 1N64H 2BMKA 4D3CL 1V7ML 3BH8A 3MV8B 1CGWA 4LARL 2XNAB 4UB0L 1RFDH 2FWOB 4KK5D 2PYFB 5DEGB 2HLAA 5F8RC 3C9NB 5TE4H 4GAJH 1QBMH 4P4KB 4JO3H 5GISL 2DQTL 2HT2C 4HS8H 4Z7VF 3PF2A 4LIQH 2J6EH 4XC1L 3GO1L 3H42L 1JFQL 3W5MA 3QIWA 1J05A 4CMMB 4CADB 3OWEA 1P2CA 3MCKB 2A77L 1YY8A 5D71H 1T4KA 4HUXA 3FO1A 3I3EA 5IV2B 3H0TB 2QV2A 4JPWL 5DJYA 4JQIH 4DAGL 1QFWI 5FEBA 3KPRA 3KJ6H 2YC1A 1H3GA 3GK8H 3Q0HA 1MCFA 6FABL 1NCCL 4M1GH 3UTQB 3IAPA 3PL6D 5TDNA 4QY8B 2HTLC 2PW1A 5D6CB 1FAKT 4BQCA 2V6HA 3D3VE 1MHEA 1ZWIA 4R8WL 1Q0XL 1OP5H 2FD6H 4GH7B 4Y4HD 3MJ7B 3LEXB 5IB1A 3BZEB 3OKKA 4P5MB 4ZFOB 3QULA 4BYHA 1MAKA 4MNGB 3QUXA 4F7MA 2PNDA 1QSVA 1U58A 1LO5B 2LAGB 1EEZA 3BAEL 3LN9A 2ITDB 1BM3H 4MB3A 3HE6C 4PJDE 1BMGA 4NHCH 5BV7H 3CXHK 2Y5TA 5T33H 1F6AB 2IH1B 5FO8B 1MH5A 4PJIF 1PY4A 3B5HA 5I1AB 1B6UA 4EUPA 1B3JA 1N0XL 5FECB 1FNAA 2YHGA 2X4SB 1FO0H 3P40A 2I07A 4TSCH 3BO8A 4TOYL 1VGEL 1IAII 4OFYD 1NMBH 4MZ2A 1K8DB 2DJUA 2Q6WA 3ULUD 2CLRB 5ADPL 2IMNA 5ACLA 3TH3T 3EZ8A 4F58L 1OPGL 1YNLL 1JV5B 1UACH 4RMQA 5F7KC 5CSGA 5DJ8A 1CGYA 5FK9A 4DN3H 4AL8L 3BP7A 3K4AA 5DJAB 3FCTA 3UJJL 5C0CA 1IAIH 3QHTC 5TF1L 1G7PA 1RIUL 1MREL 5L8JB 2BNQE 3CJJA 4IDJL 1GC1L 4HGKC 1MCOL 1FYTA 4PJ7A 4XT1C 1MCLA 1KIPA 2W92A 1MNUH 4RMVA 5JR1L 1K4CA 2L7UA 1REIA 3HE6B 1EXUB 2OL3B 1G7QB 2R8SL 2ICCA 1KYOK 2HWZL 3B2VL 4NPYA 1H3PH 3OAUH 1U93B 5A3IC 1U8LB 1CG9A 4WNQA 3RGVD 3U1SL 2BDNL 2ATPA 3CFCL 4LEOB 2R0LL 4Y1AB 4JPIB 3VH8A 1TQCB 1T3FA 4XNUH 4L9LC 4Y8AA 2V7NA 4Y16B 5AZEL 2ILLA 3CFKB 3LS4L 4JQXC 2FZ3B 4NO0D 4FQ2L 1UM4H 4ZPVB 3GRWA 3VXMA 4WEBH 1FFOA 4Q7DA 4PJAB 4MHHG 5ITBH 1MEXL 2F19H 3EZJB 1N59B 4PRHD 1CDGA 3U4BH 3A6CL 4MQXC 4S1DD 4FQLH 4XNMA 3B2UD 3L7EA 1OP3H 4HIHB 4NQED 5CUSL 5IBLC 2C4XA 4LCUB 3V52L 2P1YA 4N5ED 3DSFL 1KJVA 4MCZB 4YHZL 3LQAL 1H5BB 1IC7H 1KNOA 2F74A 4W4OA 3S35L 3AY4C 4AG4H 2PCPA 3MZGB 3GMOA 3C2AL 4CJ1A 5GGRY 5DRZB 4NZDA 4JFDE 1YPZE 1S7VA 2EDKA 2VDPL 4KI5E 5F7NC 1OSZB 1D6EB 2IQ9L 4H1LH 3NAAL 3V5KB 1UC6A 4OCRH 4M4PA 4Z7WF 2UVFA 4X6CE 5HI4C 4LFHG 4QOKB 5HD8D 5BVPL 1UWEH 4OCSH 5AUMA 2DDQH 2NX5E 5D7KE 3TVMA 4D3CH 1V7MH 2R23B 4HMEA 4LARH 4G6KH 2VKXA 4P2OC 4UQ2A 4X4ME 4WRLA 3U48A 3MRKB 3PDOA 4WFGD 2DQDH 3MRDB 4XXCA 5DURB 3SE3C 3QG7L 4JAMB 4LSTH 5GISH 3PHOB 5JPMA 2DQTH 4L9LB 2VLLB 3RVWC 4XC1H 3GMPB 4MJIA 4ZFZB 1R3JB 1I75A 4MGXA 3KYNA 4GG8A 2V7HA 3PWPE 2A77H 1P84K 4G43A 4PYHA 4N0UE 4UNVA 2NY0D 3PDDA 3HUJB 4DAGH 4RGOH 5HVHC 3RNKB 3TO2A 3BWUC 3ZE1F 2YD3A 1FAIL 3BT2H 2MNUA 1OP5K 3BGMA 3ZMRA 3B9VA 2CDEB 4JVUA 6FABH 1MLCA 3AFLA 5HHNA 3G6AA 3H3BC 3EBAA 1XR9B 5F88B 4HXBH 1T6WA 5BOPA 3RY6A 1Q0XH 3LB6C 1I9JL 1F5WA 1PQZB 2NY5L 3QQ4A 2DWEB 3QCTL 2FYYA 1GZPA 5K9QI 3HA0A 1H0DB 1LE5B 3C60A 1IM3B 4G9FA 4O00A 4PLKD 4NQVA 1UXWB 5E4IA 1HHHA 5MEOB 4YHLL 3KPSD 1MELA 1N5YH 4ZPTA 3S5LA 1EA9C 4P2OB 1T83A 4AYFA 1FFPB 2W91A 4G8EA 2X1XR 4U1NB 1AGDA 1OL0A 1FYHB 1RVFL 2B0SH 2YPKA 2FJFA 3HB3D 2MCG1 4I8DA 3TA3C 5EBLB 2Y4SA 2X70B 4H5SA 4PV9B 2EICA 1UM5H 1X7QB 4TOYH 3ULVD 3E0GA 1CBVL 5I71C 2WANA 2F53D 3WHE1 4LCWE 1JHKH 5D96C 2JCCF 1NFIA 5L88L 5D7SH 3R0NA 3GSOB 5ADPH 1KN4L 5HVHB 4KI1A 3EYUH 1OPGH 1XGPA 1YNLH 1NCAH 3VXRA 3VFGH 1HHKA 3VDBA 4NWUL 4HBQA 1IGFL 4LVOC 2P4AB 4CJ0A 1ZSDB 1NKOA 5M94B 1B9ZA 4AL8H 4N0RA 1BJ1H 1HCVA 4CMHC 5TF1H 2VYRE 1FIEA 3VGFA 1S8DA 4IDJH 1P4LA 2C3HA 4JB9L 5EZLB 4AH2B 1GC1H 3T0EA 5DXWA 1MCOH 3VA6A 4JZOB 1KV3A 2NXYD 4R26H 4TUKH 4IRSD 5DMKA 3ARTA 4NFBA 3W9EA 4LF3B 1CVRA 1CU4L 5IFHH 4OZHA 2D03H 5IT2L 2YEZB 1OLLA 5MI0C 1JTOA 4ZUTB 2FO4A 5CJXC 2R8SH 2HWZH 1RJYB 4N0CD 2MCPH 5F89A 5FM5M 2NPLX 5L2KE 1VA9A 1ACZA 3U1SH 2AEIT 2D7QA 1ZHBA 4XPGH 5E70A 5IFJA 4JRXE 4JRYB 2R0LH 4WFFE 4BH7A 2Z31C 2VZTA 3TA3B 5ESVA 4JO4H 3LS4H 3DVNA 3V5HB 2GCYA 4KWUA 3L5JA 3FRUA 1OP3K 3FO0L 4DGIH 5C0FA 3T1FB 1J87A 2V2WB 5I71B 5MENE 4EUPH 5KSBE 3HI1B 5D96B 5JXEC 1KB5A 4DZBA 1K9TA 4ZO9A 3RUGE 4R7NB 2J88H 4EIZC 1F2QA 4LVOB 1UB6B 5DDHA 5IHUL 4YHZH 5DJXA 3LQAH 1XGTB 3PE9A 5FKAA 3JWOL 5DO2D 3S35H 4W6WB 5D1ZC 1L7IL 1NDMA 4WTZA 4BFIB 3C2AH 3MXWL 4FG6C 4M9OA 3D2UA 3MA9L 2HAZA 1JN6A 1J9CT 1A7PL 1NGZA 3BKYL 2BSRB 5HGAB 1MVUA 1CDIA 4Q6IA 2VC2L 1I1AC 1U3HD 5JOPE 1U3ZA 3NAAH 3ZDZF 3KHQA 4YDIL 5EC2A 3WIFA 5MI0B 2CGRL 1CXEA 5ACZA 1CE6A 1NCBL 5KJRH 5I1LB 1CL7I 3G5XB 4UDUB 4PUBL 1IVLA 4PJEF 1QRNE 5CEXB 1JJUA 5E6YA 3AXLB 3LKQA 4DUVA 1LEIB 5E9DA 4AM0A 1S9WA 3OR6B 2AGJH 3QG7H 3GKWL 4C57C 4G6MH 1DDHA 3BSZL 3VXUB 4N8PA 5EB9A 4RGNE 4F2MB 4LLQA 3EDKA 4KVNL 4HBCH 1WBZB 5IVXE 2DB8A 3GB7A 4PTTA 4ZOAA 1XH3A 5ICXB 3Q5TA 4ZOEA 3QRGH 3RTQC 2MPAH 1GOFA 1RU9L 1CL7H 4XPBH 3RVWD 1DQDL 1D5BA 4WU5B 4GG6A 1FAIH 3IS0X 5T5NG 3X12A 1E4KA 4E41D 5L0QC 2EXWD 3QUZC 3FRPA 1BZ9A 1MIML 3IETB 4RIRA 1D9KD 2NCMA 5BQ7B 2KDGA 3GRWH 1U8KB 1DBBL 3SE8L 1AGEA 5D1ZB 3HPJA 1KB5L 2EC8A 5HHME 4BQ6A 3UTSE 4C56A 5DVMA 3SJVA 2FGZA 5E5MB 3LKRA 3HMWL 1J8HA 2DS4A 2QBWA 5T3XL 4L8CA 3QCTH 4ZNCD 4NBYB 1I1AB 3BKJL 3EIFA 4B0MM 4Z7VE 5GGRB 4Y2DA 3V6ZA 5BV7C 1DJSA 5MHSE 3I02A 3MV9B 1J1PH 4ODHH 1WVZA 4PJ5B 3BIKA 3WJLA 4PJBE 1GIGH 4YHLH 2WBJC 4QHUB 3OKMB 1Q72L 2HKHH 1PAMA 3REWA 4CDGC 1J5OL 2NTFA 4Z0XA 1AGCB 1T04A 5ILTH 3GJFA 4K71C 2Z93A 3EO1B 2GTWB 5GHWL 5HYIA 1CDUA 1CFSB 3CH1B 4UDTB 2DM3A 3RTQB 3WEXB 5EZIH 2NR6D 5D7JA 4P2QA 2EIZA 3QA3B 5IW3A 3VMPA 3EYSL 1IGYB 5L88H 1YQVH 3P3YA 4W6XB 3V2AR 5IMMB 3MYZA 3W0WD 2A0LD 5FOJA 4ORGA 1JI2A 2XT1B 1W0WA 5L0QB 4JFQA 4NWUH 3QUZB 1IAKA 3WLWC 1IGFH 4MDJB 5C07A 1XCTB 4WWID 1G9ML 4XVJH 4E42B 4TTDC 5FIEA 3MNZB 3LV3A 3O9WA 3NFPA 5C0BE 2BRQA 3GMLA 4ZOCA 2VZ3A 5C8JA 4JB9H 1P9MA 3QP3A 4Y8DC 1CGXA 3T3PE 1I9EA 3E8UL 1J86A 5B22A 3TIEB 3E6HA 3SDCA 4K94C 1FVDB 3HRPA 1S3KH 4U4BA 5BV7B 4S2SA 1CU4H 4Q9QH 5L6YH 1WUNT 4NJ9L 2O5ZH 5KANI 2A6IB 2EDFA 3LDBC 5FGSA 4RQQB 5HDBE 3DRQB 4KJQD 4LQFL 2WBJB 2CUHA 1GVIA 1LE9B 2NZIA 1S9YB 3PP4L 4WHCA 3WFZA 1QSFA 2VLRE 5IOPB 4FFVD 1J1XL 4K71B 4CVXB 3NTCH 3WDHA 1CFNA 5HHQB 3CC5B 2M2DA 5JOFB 2R9HD 4DFIA 3BUYB 3FO0H 4PG9A 3PWVB 3UZVB 3O11B 1X44A 5JW4N 4UINH 1JI1A 5GZNC 1A3LL 4JJ5B 4UU9A 4K3EL 1SJXA 5GGSY 1W2KT 2FEEL 2Z31D 4GAYA 5B3JF 5ISZE 2WBKA 5SWZA 3DWTA 1ORQA 5EU3A 4ODWB 1S7RA 3W39A 5CILL 4EI5A 2P47B 3LS5L 3KJ4C 3GZKA 3K0WA 4EBQL 1MUJA 1WAAF 4GLRI 1M7DA 4RAUA 4U0QB 3ULUF 3GSWB 1RUQL 2AJ3A 2A6DB 4P9ML 4X4ZA 5DJCA 1RZJL 3BKYH 4N8VG 2BJML 4ZQKA 5TFSL 3UMTA 2HT3C 4YWGH 1FFNB 3UZEA 2D7OA 3LDBB 2MHAB 2J7LA 1HI6A 4GLRH 2HTKD 1HXYA 1OCWL 4PUBH 1M71A 3MRGB 4OCYL 4FQJH 3VFVB 2A73A 3QQ3B 3WKNA 1KIRB 3DIFA 3MOQA 4OKVA 3GKWH 1MCHA 1T1YA 4G5ZL 3S96A 5JLZA 4NYLA 3IDMA 4P4RB 1YNKL 1R24B 1M7XA 3OR7A 1F3RB 1RU9H 5FGRA 1G9EA 3VFOB 2R4RL 4BQ8A 1DQDH 1NEZA 3W81A 4Z7WE 5FYKE 3NFSL 3MLZL 3NCYP 2X09A 1DBBH 1FDLH 4J1UB 2V9RA 3SE8H 1IBGL 1KB5H 5HHOD 1YUHA 3IJSB 3LVEA 2R2EA 3HMWH 4N0YL 4K55A 4JFEA 5T3XH 5KSAA 2BZDA 4K7FA 2YK1H 5EU6B 4Y5XA 1FJ1B 1HQ4A 4L3ED 3RP1A 4JFOB 1UKTA 4N8CH 1PKQE 2EEAA 3MZTA 4UMGA 4ODXA 4MJ5B 2OTUB 2GITB 4XP1H 4BZ2H 4P46C 3BWAB 2EDOA 2ZUQC 2H8PB 4L4VA 3ZE1E 1T0MB 3ARVA 1RUAL 3GMQA 3MLWH 1AO7D 3BP6A 2ZNXA 4Z7UE 2JB6A 5IHZA 1ORSB 1F02I 3EGSB 1A9BB 3G5VB 1JYWA 1YEFL 2GIYA 4JFFE 2FH8A 3PGCA 2DQGH 2DL2A 5GHWH 3O3BA 1NANI 4QRPD 3EYSH 3EYVA 5H37G 3SKJL 1FN4B 3WDJA 1AFVH 3W9DB 5DMJB 2EDRA 4XVSH 4MQ7B 5IW1B 3BJLA 1MPAL 3QDHA 4UOW0 2R0WL 3IDJA 3MO1A 2A9NL 3GSUB 3UZQA 5LXGH 4HUWA 1R5IB 5J57B 4F33A 3X11B 1MCRA 5J9PA 1NANH 4UBDC 1IAMA 4CN6A 3E8UH 1A6UL 2I9LA 3BPCA 5AAMA 1WFUA 5T3ZH 5BS0B 3U82B 2W60A 3MJ8A 3ECBA 5JIPA 1FG2A 1Y0LB 4FFWC 2GSGB 2VZVA 4FHBD 2FB4L 4Q97A 2JCCE 3IU3A 4P46B 2ZUQB 3GMMA 3PV7A 3UYRL 3PHSA 2FEEI 4QRRB 5CMAA 3QG6B 4WW2C 4N9OB 3GEWB 1GRWA 3BX7C 4YLQT 2BMKB 2BXZA 3TYGL 3BH8B 1JP5A 1HHGA 1J1XH 4L4TD 1MCBA 3ARFA 5I66A 1JYVA 3VXSD 3QZWA 3S9DB 5D1XA 4PJCB 1OOAA 1ZOXA 5TPWH 2ICEB 1NFKA 1B4JL 1K2DB 2CIIA 3WO3B 2X9XA 3ZSTA 1A3LH 4XH2A 3P0VH 2AS5M 2G75B 4K7PX 3QIWB 1IGJA 1J05B 4K3EH 1P2CB 3T0DA 3PNWA 3QI9D 1YY8B 3GJFH 3H9SE 4HUXB 1BQLH 5DJYB 1KEML 3ORJA 4NOBA 3ULVF 1M6OB 3KPRB 5GS1A 3OKEA 4N0FA 2YC1B 1A7NH 4YBLC 2CDFA 1RUQH 4QGTA 3X3GH 5EUKB 2HRLA 5TDNB 2GJ6D 4K8RD 4FQHA 2PW1B 5GGQL 3HNSL 2BJMH 1MHEB 3D3VA 1ZWIB 1QPXA 3JVGA 4KHTL 2XZQL 3OKKB 3QULB 4EXPX 4DZ8A 3HKFA 3CFBA 4GKNA 1QBLL 3C08L 3QUXB 4F7MB 5JA9A 1OWRM 2VZUA 3GI8H 3MUZ1 1EEZB 3RFZC 2XRAH 3R1GL 5ANME 4CL7A 5LAXA 3DROA 2HT3D 4WW2B 2ZCKH 3MREA 4PJDA 3MLSL 5BMFL 4R2GD 2HFTA 4RA3A 4HGWA 1MH5B 4GSDH 5TDPA 1GJIA 1TJHH 3TNMB 4EUPB 4ZD3L 2DQFA 2P44B 5F9OL 2YUVA 4O2FA 4LNVA 2AXGB 2VJXA 1I8LC 2I07B 4EN3A 3BO8B 1V3MA 4XHQA 2R4RH 2FATL 4M1CC 3ZYIA 2A6JB 4LKXA 3B6SB 1IM9B 2Q6WB 4WHDA 5J3HD 4JKKA 4KGJA 3RVTD 2IBZX 5GGSB 3U36A 5IQ9A 4XHJC 1SVCP 4YBLB 3MOAH 1IBGH 5CJBA 4I2XE 1Y6MR 4HK3J 3ARBD 3DBXB 5TDOA 5J8OA 1DTUA 2ZCHL 4K3HA 5HYJE 4OZGF 4DKEL 5FK9B 4ETQA 3F62A 5C08D 5CD5C 1CT8A 3DGGA 5CZVL 3AVEA 3BEVA 3BP7B 1JF6A 4Z0BL 3FCTB 4OQTA 1CTOA 2OP4L 5C0CB 2FJGB 1JWMB 5KG9B 3MROA 1CGSL 3V0VA 2ZP0T 2BNQA 5EWIL 3AMKA 1FYTB 4PJ7B 3NVQA 4G6FB 2L0DA 3REVA 1CDCA 2BX5A 4YIQB 1I3VA 1NFDF 2XKNA 3S34L 2LAAA 3HPLA 1C7TA 2FLBT 3S3JA 5CCKL 2XYCA 2FHCA 4OLXL 1NBQA 1CG9B 4WNQB 1BZ7A 4OB5L 3IXTA 3QEQB 1QYGH 3VFMA 2H2SD 3WS3A 2PYEE