2M2DA

Human programmed cell death 1 receptor
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
MPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDSRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and interactions of the human programmed cell death 1 receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Programmed cell death protein 1
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2m2dA00
4W4OC 4Q0XH 2Y07L 2WINA 2HJKA 2EZ0D 5I75C 3GSWA 5IB4B 3AS2A 3FQTA 5INDB 4X4XA 1NUFA 4GUPB 3QJFB 4QRRD 5D9SA 2K7PA 4FQQA 4DUWA 4JY5H 3QHTC 3F7RA 3DOSA 3RZCA 3O0RH 1K5NB 4XCEB 4CDGC 1PG7H 3H7BA 5KVFH 4ONOA 1FG2B 3DGGB 1MWAB 1GHFH 2J8HA 3WN5C 5CD3A 2OS7A 1EUTA 4LHUD 1YDPB 4WEBH 3VFMA 2DQEL 3T1FA 5DQDL 5JNYB 1MFCH 4FQHB 2QLVB 1AGEB 2AKRA 4M61B 5ADPH 4OFKA 5D7JD 4CU7A 1UJ3A 5I71C 2KH2B 1FZMA 1J0ZA 4NO5B 3RDTB 2P42B 2AVGA 4GT7A 4N90D 1EXUB 1JV5B 4OIIH 5J8OA 4JFYB 1G7MA 3ECBA 5T33L 2QADC 2Z35B 2GT9B 4K3EH 5CUSL 4PJAA 1EZVY 5J11C 1Q0XL 5D2LB 4GMSH 5I19H 4ZPVA 1FLRH 2WBJC 4ZUSB 1EHXA 3DYMA 5CJ5A 3TJHC 1GIGH 3U9PH 2Y9RT 5TH2A 4X99B 1J1PH 4PJFB 4YPJA 4M1DH 5A43C 4KJQC 4NZDA 1M6OB 1X5JA 2LU7A 1MCNA 4H8WC 4B7IA 2AEPL 4K7PY 1W0VA 2FX7L 1CFSB 2NY3B 4J8RB 4KUCF 1D5IL 4JFHD 3VRIA 1F4WH 4M5ZH 3CXHJ 3BE1H 1JGVH 2FBJL 2GITA 2KQNA 4ODWB 1D5ZB 2R9HD 3T3MF 3I50L 3C08L 5L88L 4WWKA 1CGXA 2E7BA 3WNMA 1FVDA 4AEEA 3QB7C 3SDAC 3GM8A 4O2EB 4KKCD 1CU4L 5IM7B 2EE3A 2M26A 4EDWH 3QQ9C 1UGNA 5GRVK 1RUKH 2VWEC 1C16A 4XP5H 2EO9A 1CXEA 3QWOB 5L9DL 4UT6L 3WXVH 2JELL 3KYOB 3A67L 1Z0NA 1TQCC 4JB9L 1MRFL 5DEGB 3D87B 3X14B 1QACA 1UB6A 2XKNA 5EU5A 5C0IB 4P5TD 5TFSH 5I30L 4V1DA 4ONFH 1NGQL 4LQFH 4M7LT 1VKXB 3BAEH 3VWKC 2BDNL 1NCBH 2VITB 1EO8H 3AB0B 5B21A 3T0EE 4MXWH 5D71H 4KZDL 1AXTH 4AT6B 3WCYA 3CXDH 5I1HL 5GGVY 3LY6A 4OF5A 3BVNB 4RFOL 4NQEA 5I71B 3G9VA 3HPJA 4QF1B 2I26N 3FFDA 1S7TA 3FO1A 4PRNA 1OT1A 1I1AB 1VFUA 2I24N 4G42B 4I18B 2WLZA 4Y19D 1YJDC 5F3BB 2FD6H 1MNUH 2NY7H 3MRCB 2NR6D 4G8EB 2EIEA 5J11B 3UJJL 2JF1A 5C0CB 5HGHB 3TVMA 4Y4KA 3ULUC 2AXGA 4XNQB 4HUMB 4OZFG 1WEJL 3OTTA 4D0DA 3P0GB 1KIRB 5C92A 1FO0A 1IT9H 5T1MB 4Z0XB 2ARJA 3DVFA 3MCG1 2QSQA 4MNHB 4QRPB 2ENSA 4XBGB 1CF8H 1MEXH 4WHTB 4JO4L 3TA3C 2WLYA 2QQKL 3MA7B 4OLYL 1J5OH 1BIIA 4OCWL 2MJWA 4ZS6D 4GMTL 3ARQA 5T1LB 1S7UA 5FA4A 5KJRH 4U0QB 4PJEB 2NZ9D 1WAAE 4RFEB 3ALXA 1NSNH 2FNBA 2LAAA 4PJ9B 4UU9A 4ZD3L 3RPIA 3EOTL 4O5LH 1S7WB 3QPXL 5CHNB 3WN5B 1MPAH 2PO6D 3FHAA 1PFCA 3MACL 3QQ3A 4F2MB 4IBLT 1FQ9C 4PJ5B 3K4DA 1X5GA 2OXGA 3VXOA 3P0YL 1A6ZA 3ULUE 3PWNA 5TDNB 3ILQC 1AH1A 1UM6L 1HNGA 2ZCLL 5IW1A 2ESVA 1RVFH 5MHSD 3O8XD 5KSBE 4PRPA 1T5XA 1H0DA 2FHBA 2K7QA 4ERSL 5IMLB 5EU4B 3NABL 3QEGL 4M6OH 1DFBH 1NCWL 2FEDD 4F7CA 1CU4H 4BSWA 4KVNH 4XPFL 2Q8BL 1KJMA 1F3RB 1MAMH 3CFEB 5BS0E 5ADOL 4XX1E 1ZLSL 5SX4H 3HS0A 4H1LB 3QG6A 5LWYL 1VFAA 5J0BA 1IEAA 1HN1A 4GS7B 4NNPL 1X7QA 4F33A 2VR9A 1IC7L 1NL0L 1VGEH 4JVWA 4P9HL 3QXAB 3WLWC 1T0PB 3DURB 4PJ7B 2GJ6E 3SDXF 4MD4B 2VDKL 5SWZD 1LEIA 1I1AD 2K3TA 5H37H 2P43B 4LBEB 1SMAA 2OJZH 5F7FA 4MNQD 4LOUD 2ZUSA 1A6WH 4I13B 1MF2H 4NHUB 4K94H 1EXUA 2N4IA 1JV5A 3BRGC 3NACL 1D5BA 3KPRA 4Y89A 5DRZB 3N0PB 4ZFZA 4X4YA 2FJGB 2XY1A 4YDKH 2BX5A 3P2TA 5CJOH 2EDLA 4L4TE 1U41A 3M17B 5DMGD 3VXUE 3QJHA 4JRXD 1TZGH 4GG6B 3MJGX 3JTTA 2NYYD 2A74A 3QUXA 1HSAA 3OKNA 1A3LL 1T2JA 2EH7H 2Z93A 1V7ML 5C86A 3T0AA 1MIMH 3O8XC 5E6YA 1M6OA 1W8NA 1ZE3C 2DQUL 3NCYP 3BO8B 1OOAA 2D31A 2GSGA 4MB5A 4JJHA 5KVEL 1J9CT 1NPUA 2FZ3A 4XCYA 5C0AE 1ZHBA 3QDJE 4OGAD 4EOWH 4OKVA 1D5ZA 5DHYB 1DQML 1IVLA 1KIQA 1ZAGA 4M9OA 1T21B 1VADA 4QHNA 4LCWA 3AREB 4L3CB 3WEXA 1P1ZA 4CN4A 3HA0A 2IMMA 2QADD 1FFPB 3HE6D 2CR3A 1NKOA 4DCQA 4EVNB 2GSIA 2Z9TA 3UBXA 1MCRA 1MJ7L 5B8CA 1JZ4A 3E2HC 5C09A 1CGYA 1JGEA 3GMMA 3RWGB 4PRPE 3UTPE 2XPGA 3BP4B 2GAZB 1AHWC 5IHLB 3DYOA 4WEBL 4IIQC 2DJ4A 2VDNL 4K71B 4HKJB 1J8HB 5EBLA 1ITBB 3VXUA 1DVFC 2FSEA 2YRZA 1YYLL 3TBYA 3E3QC 3MZGB 4NCC2 1CIDA 2BVOB 4R2GC 4HXBH 5T3ZL 5FECB 3BPNC 4M43H 4QY8A 1QSFD 2BZDA 2YRPA 3OX8B 1JPGB 2X4OA 3F5WB 3A0OA 4HWUA 3C09B 4Y2OA 3WFZA 3QDMD 4IRZL 4KUZL 4K07A 1KG0B 5T5FL 1DBAH 5GS3A 3KS0J 1JJUA 4RA0C 1UH3A 5L0QB 3GSXA 3DUHA 1GYAA 5I8OH 4GW1A 4JFDB 1BQHA 3RTQC 4PRIE 5B3JE 1U2CA 3QIBB 3HG1B 5DI8B 2B5IB 2NR6C 3NH7L 2AQ2A 1CDBA 2EDKA 4D9QE 3B4NA 4OSUL 1NBVL 3RBGA 3VI4F 5IWLC 1NUGA 1EUUA 4LVHC 4MWFA 3RUGE 2ZSWB 3TN0C 3IU4H 5DT1L 4PV8B 1LE9A 3RNQA 3MJ9H 5LAXB 1T1YB 1D5MA 4BK4A 3VA6A 5J6HB 4Z7QF 5FGSA 4JM4H 1CXIA 4JFYA 4YR6A 1E6JH 3UYRL 3OHXB 3OR6A 2BC4A 1SJHA 3VFRB 5D2LF 1DQLH 5ANMA 4ETYA 5IQ7L 1KJ3H 3GI9H 5K9OA 2OMNA 4XMKH 2R1XA 4QRPE 4Y4FA 4YEFA 3AGVA 4QXGL 1XIWA 3F7QA 5FA4B 3SJVB 1WWBX 5F1IA 4PB9H 1MHCA 2MCPH 4M7ZC 1BOYA 5IQ9A 2NY4C 4XNMA 2Y36L 3ARTA 4UU9B 4PBXA 5KOVC 4Q9QL 1SYVB 4LSSL 3ROOB 4C56D 5T3ZD 2JJSA 4EIZC 4QRTA 3CVHA 2PXYA 3OAUL 4XC1H 1NMCC 4ODWA 4EDXA 4JREB 4WUKH 1DQJA 2XFXB 2DN7A 4EUPB 3QI9B 1EO8L 2D9CA 4U6HB 1MCOH 1FZJB 3GSNB 4N9OB 1VGKA 4FRWA 4ONGH 3NTCH 3X3GH 3HPLA 3C5SB 4HLZG 3BHBB 4K2UL 4L5FL 4WNQB 5AYQA 3ZO0A 2V9QA 2DQFB 2R9HC 1T5WB 3B5TA 3KHOA 4F7EA 2E9WA 3MLXH 3BW9A 3DV6A 2A6JB 3LKSA 3D3VD 2D03H 3ES6A 2ICES 4P4KC 5HPMA 5IBUG 4NQDE 5JW3L 1C08A 4MZ2A 3QUYB 4HUWB 1RZ7L 3DJ9A 1XGPB 4XNXL 3IS1X 3O3AB 4R0LC 3HS0B 4H1LA 4H20H 1IGML 1MFDL 1FNFA 1YC8A 3K2UH 3PNWA 3H42H 3D0VB 3BMVA 3W2DH 3RGHA 1JZ5A 4ZOEA 3PL6D 3EO1B 5F89A 3S5LG 2CIIB 4WIQA 2A38A 4WFFE 4GSDH 4P5TB 3VRLE 1MHHA 4M62H 5I76B 4NKMB 2IMNA 4H26B 2Y5TA 25C8H 4AEIH 5E70A 5GSRA 2X70A 2D7NA 3O9WA 3DVGA 3I84A 1E4XH 3NFNB 1S7TB 2YD8A 1H3PH 1XGYL 5E08H 5HGDB 2EDNA 4MAUH 3V6OA 3EO9H 4GKOA 3KPRB 3NOIA 3C2AH 4Z5RB 5HI5C 2NXYC 2W91A 3EW3B 4XC1L 2RIKA 4JFFD 2DWDB 4XX1G 4O58H 5K9QI 5DJ8A 1N4XH 1DLHA 5DJZB 3UYPA 1XH3B 1MCHA 4WUUA 3ULUD 2B39A 4PLKC 4OLUL 3FT2A 4JEGB 5J06A 2V5YA 3BO8A 4HDIB 4MXQC 4XBGA 1UZ6F 4HGWB 4JFQA 4RCAA 5EG6C 3TZVC 3HUJF 1MJ8H 4NUGL 4OLXL 5T1LD 1SJVA 5IMOA 4OKVB 1MCPL 3IGAB 1A1NB 4HIHB 1EAPB 2DICA 5IVXE 4PG9B 1LK2B 1KT2A 2E27L 3TPUA 3AREA 4PBWD 3QUZA 1AO7B 4L3EA 4Z7UF 2OR9L 1DVFB 2B1AH 2C4XA 3RPIB 2X1XR 1U8NB 3SE3C 5D93B 3MRMB 3VGAB 4L8CB 3L3HB 3ZYZA 4JPVH 1RZ8A 4Q9RH 2XN9A 5C09B 1OY3B 3CAFA 4ODTH 4G6FB 1A6ZB 2IBGA 4HIIA 1B6UA 4OT1L 3GSQA 2BNQB 3VWJA 4YXLH 4I9WE 4CVZB 2OL3B 3HI5H 1T7VA 3MV9A 4Q7DA 4Y5VA 1XF3B 2YPVH 4HZLB 4L8SC 1P9MA 2VDPH 3MGAA 4OAWB 3TBWA 3UTOA 2BVEA 4UB0H 3S36H 4QY8B 2D0HA 4JHAL 4OCSL 3EUUA 1WLHA 4BFBD 1J1PL 2P7TB 2FRGP 3ARGD 5D7SH 1CDYA 4G7YL 3SE9H 3MRKA 3TVMC 2VDLH 3QEGH 4M6OL 1J10A 1KEML 2ADGB 2JB6A 1RI8A 3O3DB 5F7WC 4UOJA 5DD3L 3L95B 1E0OB 1X7QB 2APFA 1TQCB 3ULVL 1EBAA 3QO0B 3GRWH 4NQSA 3JV5A 1DBJH 5F6HJ 1X5FA 1UB5A 1OGAE 4ZAKB 5L88H 1NGZB 4OV5B 5FGBC 4PLJC 2G75B 4WI8A 4KK9D 1R5WB 3GSRA 2WW8A 1UYWH 4NP4H 3SKUD 5LAXA 2FIRT 4J3XA 1S78D 5DK3A 1IAIM 2UYLA 1BWMA 4L1HA 4P2RA 2HJLB 5DJYA 5I8CB 5DXWA 2JK5B 3RDTD 3X13B 2MQ3A 3DMMD 3S3PA 5IIEA 5F9OH 4K23H 2X4TA 1YNLL 4RWYL 1S7QB 2O26U 1S7RB 5HY9B 4RWHA 3P30H 2O61B 4HAFA 1QD0A 1RK0B 1A8JH 2W0PA 1N5AA 4HK0A 3ZT5A 2NY4D 2IADB 3LN5A 4HC1H 4IOIA 2OQJB 1I3UA 5FM5M 4LL9A 3MRQA 5E94B 4NN5B 1NDGB 3TA3B 4RIRA 4M9PA 4RQQB 3CFCH 4I2XE 1Y6NR 4Z7NF 1TZGL 2FZ3B 4WW1A 3MBEB 4FQPA 4XMPL 3B8SA 2SEBB 5KAQG 1Z6JT 3LMJL 1KUMA 2VOTA 3B9KC 3HZVB 3ZE1F 1REIA 2YMXH 4QTHA 4KHTL 3CUPB 3VFGH 1P1ZB 3AXLA 1E4KA 3HMXA 1HEZB 5C8JA 5F44A 1FFNA 5B38A 3EIFA 4N8VB 1E4JA 4ZUTA 3BEWB 1RZKL 3BP7B 1X9QA 3SCMD 1CVSC 4LCUB 1R3IL 3N1QC 1F11A 5GS0L 1VPOL 3QRGL 1KEGL 2R2HA 4M1CD 3SO5A 4BH8A 1P84K 4UQ2B 3MNWB 2IQAA 4P59L 4P2YA 3UPCA 2HT3C 5C3LD 2DQHL 1DCLA 4C4KT 1V05A 4XWGH 4F57L 2VMFA 1G6RB 1ULVA 3ORJA 4LFHG 4QXUL 3PWLB 4KRMB 4FFYH 3EO1A 4HX1A 2VXTL 4PRBA 3EDFA 4I3SL 4YBQC 4JO1H 1IFHH 4OQTH 2ID5A 3QEQE 3LHPL 5DRXA 4HS8L 4LLYB 3PWPE 1I7UB 3LPWA 5E7BA 2ZKHL 3IKKA 2VIRA 4PTTA 4NKOA 3SGJC 2H1PL 3UAJC 5L2KA 1EHLH 4XNUL 4JN1L 2VL4A 4UUJB 4GG8B 1SYSA 5JXAL 4B0MM 5IKCB 1S7XB 5F1KC 4NKQB 1K5NA 2EZ0C 4WFHD 1DBAL 3WJLC 3PXHA 3VD9A 1CS6A 3TV3H 3QIWD 4NKIH 1FAKT 2Y06H 1X5HA 5CS7A 4LLMA 2X2YA 2YKLL 4O4YH 4WUUB 4YFDB 1BX2B 1A7PH 2BC4B 1SJHB 4KI5D 2IAMA 1V3MA 5HYEA 4DGYL 3VXPB 4OCWH 4ZSOA 3FHQA 4KKAD 5JUEL 3ARGC 3LQAL 2XQBH 2DL2A 4I2XB 2Z35A 4XPGH 3NAAL 3E1F1 2BK8A 5IQ9B 2H32B 4C56B 5JOFA 3VGHA 4B41A 3RY6C 5DZLA 5GISH 3VMNA 4Z7VE 3T77A 3L3HA 1RZ8B 4YGVA 1HXYA 3T2PA 3QO1A 2FHCA 4X99A 3CFBA 2MCG1 5TE6H 1S5IL 4NC1C 4H1LH 2HRLA 2VDQL 3PGDB 5HI4C 1RUMH 1WITA 3MYZA 4XZUA 1H15B 4UDTB 4HBCL 3O3BA 1SEBA 2A6DA 1B4JH 2WWKT 4XP4H 2DRUA 4YX2H 1UVQA 3L5XH 5E8PB 1EMTL 2Y07H 1BZQK 5IOPB 4MJID 5JQ6L 4JG1L 1MH5A 4NSKB 5GGVL 4UV7H 3O6FB 5AZEL 5BMFH 5HPMB 5HVHC 2IFGA 4QHKI 2XZAH 4HKXA 3UCRA 5D1QD 1TETL 5C08A 4HJJL 2C3GA 2AJ3B 3EHBC 3KYOA 3IDIB 4N0CC 3RA7L 1SY6L 2VLLB 3CZFA 3QO0A 4FQ1L 2F8XC 1A1OB 2R2CA 3KVQA 1U8IA 5C08D 4OLWL 4ZUUB 4GAFB 1KB5L 2A0LC 3DSNA 4PJDF 2R4SH 4DZBA 1JGLL 2VITA 5FHAH 5GS2D 3T3PE 4MA1C 4G6AC 5DJYB 5HYSB 5GISL 3CFKA 1AD0A 4ODHH 1D6EB 2EO1A 1AGFB 5I6XC 4I1NB 2DWDA 3QCVH 5C0JB 1RJLB 5F9AC 4WUUD 3WE6B 1KXQE 4X6EB 2F58L 4F15C 2BVYA 5KANI 5EB9A 5IB5B 3GB7A 1DLHB 2DDQH 3QXTA 1LP9F 4RMUA 5KS9F 5H94A 4PGCA 2KZWA 5EIIB 3STZA 2NX5B 4OD3H 1AQDA 5IV2B 3FT2B 5I16B 1BQHG 5C0DA 1NDGA 4E41D 1WAAA 2WQRA 4G6FD 5HBBA 4OIBA 3RWIB 2RQ8A 2FR4B 1ERNA 3HE6B 4XHQA 5C0CA 5E99H 4MA8H 3E6FB 2GFBA 4WI2A 4KK9C 4DZ8A 1X5AA 5ID1B 1QUNA 3LDBC 4YBQD 5IHUL 4N0YL 4D0DB 3EJZC 1AHWA 2VDPL 3F58L 3JV4A 2EKSB 3VDCA 4N8VG 4H88H 2QL1A 3QUZB 2ATKA 3L9RA 1GAFH 3BPLC 5EC1B 2VYRE 3PL6A 1XR9B 2X1QA 3MRMA 5JW4Q 4L8CA 4YQXL 1OLZA 2YBRB 1R24B 4FQCH 5ALBH 1JPTH 3GMLA 3QEUB 4LPTA 3DBXB 1X44A 4MVBC 4LEXH 3GSQB 1ZGLA 1OM3H 2ITCA 2EDXA 2BY1A 5IHZA 1TVBA 4ISVB 3BOVA 2XWBB 3V5DA 1JF6A 3I2CH 3QQ3B 4YE4H 4F2MA 3VGEA 4ODSL 3ILPA 1W0WA 4HZLA 1I1YB 4OAWA 3MPCA 1S9WA 1U8QA 4XWOC 4NRYA 3VD5A 5EBWA 3QCVL 1NLBH 1T5XB 3JSSA 4PRBB 2OK0H 1F8TL 4RRPG 2HP4A 1ES0A 3P4LA 4HV8B 1YEIL 4MJIE 1YY9D 1VDGA 3O3DA 4MNGE 4PTTB 4V1DE 5MP6H 4LP5A 4JQIH 4P9ML 2FEEL 5MEOA 4X6CB 3KHQA 3TO4D 3DX9B 1S7XA 4YDIL 3V52H 2OJEB 3W0WE 5EOCJ 2OLDA 3RZWA 2WV3A 3I3EA 1FC1A 1CDGA 1CCZA 3ZDXE 1SBSH 2EEDA 1T7WA 1YY8B 1V5JA 3L5IA 1AGBB 1YNTA 3R8QA 5FEBA 2FH6A 2WWMD 1OLLA 2YD7A 1FBIL 4PJ7A 2Y1VA 4YIQA 5CGYD 3B9VA 2UWEE 1CICC 2EEAA 1Q9OB 1FRGL 1ZA6A 3S5LA 3EOAB 1CK0H 2O61A 1C12B 3DNKA 3RX8A 3CCHB 3WNKA 3C5ZA 4Y5XB 5DRZA 3O2DA 2JJVA 3WUWG 1CYGA 4I2XA 3Q48A 5CJBA 4E9LA 3VJ6A 2ICWI 3QI9D 4TVPE 3TA3A 5F7DB 8FABB 4QRUA 4AEHH 4FOMA 3V4VH 1CGTA 2EIDA 1F2QA 2D4DA 4I18C 2A74B 4X8JB 4YHOL 3D0LB 3MMEA 3OG4B 1QVOA 2DQTH 1TFHA 2R1YB 2V9TA 2IEPA 4G8FA 4PR5A 2Z31C 4K8RD 4ODXB 2VLJA 3CU7A 1NGPH 4K2UH 1T6VN 3TM6A 3LS5L 2VR5A 4PJBF 1H15A 3O3BB 3MV8E 1JL8A 5E2JA 5TE4L 4ZUTB 5KSUA 1YPZF 2FO1A 2Q7YA 4X7FC 1TQBB 2H1PH 2B4CC 3C5ZC 2UZIH 3IDYC 4UBDD 3QH3A 4X6DF 3OZ9L 1G7JA 5DUPH 4NN5C 1NCAL 2GSIB 1A6TB 5KTEH 3FRUB 2UUDK 2XXMB 3LAFA 1JHLH 3LEYL 3UTQA 2ERJC 2R23B 1KLGA 2Q3AA 2GQHA 1FH5H 2R0KH 2HVKB 2YZ1A 1ACYH 4PG2C 3W11D 2CUMA 1RIUL 1WBYB 3HHRB 3O8XB 4K7FA 4C83A 4GAGL 3O3EA 1KBGL 4GBXC 2HFGH 2ZUXA 1PY4A 2XV6B 3IS0X 1YN6B 2HH0H 2YD2A 3MGOA 5F6IC 5HYSG 3DRTA 3TP4A 3PP4L 3VFNB 2VDMH 3WS3B 3DPBA 2H8PB 1FHGA 2D3VA 2J6EL 5C6TH 1E28B 1I1CA 4NOFA 3DVNB 3WFDL 4NCC1 4Y7MA 3TH3T 3WNLA 4ODTL 1ZLWH 4JPWH 3AAZA 5DLML 3U9PL 4JQIL 4BQ6A 1IM9A 3WLBA 4IMLB 2R0ZL 4PJDA 5EFIA 5HHOB 4QYOA 5E4EB 1EEUA 1QLRA 1P4LA 3HG1A 3P9MB 5ICYA 2ADJA 5FHBH 4MXWL 4QO1A 5D71L 5H94B 1Z9OA 5F8RC 2DLFL 1ZKAA 3INUL 4JHZA 1QKZL 1DN0B 1FL5B 2VDQH 2ZUUA 3FQRA 1WFNA 4R7DB 2QR0B 4WJ5A 1V7MH 3ZKQD 3DMMA 3KPRD 1VFMA 5ERWA 2OL3H 5GJSL 1OHQA 4LCCB 1D5MB 1FPTL 4UV4H 5FF6B 3O6ML 3BPNB 1G6RL 4Y8DC 1EGJL 1KEMH 5I73C 1CGUA 1H3GA 1GXEA 2QQQA 1IL1A 3ARRA 4XP9L 2PR4L 2IH3B 1BD2A 3OGOE 4OGZA 5DJCB 4XP5L 2HFFB 1EJOL 4GAJH 3QRFM 1SJEB 2M1KA 5ESQA 3OGCA 5TQ2H 3T0XA 4GG6E 2BHZA 3IFNL 3SJVA 1BJMA 5CSBA 4HKBB 5EC2A 1LO0H 4LMQI 1P6FA 2ITCB 4FQIH 1U92B 2B1HL 2CDGB 5BJTA 4OBSA 1OTTC 1P5VA 4ONFL 4TUKH 2J4WL 3ROOA 3Q3GA 4KJYA 5GGTH 4M7LL 2XWBA 3HZKB 2ZUVA 1J8HD 1YEHH 3IDJA 3RL1B 1W0WB 3UJTL 4MSWA 5FO7A 3DWTA 3FQNA 1II4E 5CP7B 3RHWF 5ISZA 3ZKNC 4EI5B 1BLNB 1QBLL 5F7YC 1JPFB 3STBA 3SDDA 4Y1AD 3L3JA 5JTWA 5EDXA 2AJZB 3HAEA 4ZAKD 4I5BA 3KPSA 5HI3D 1ES0B 2HLAA 4XBEH 4ENED 5DUPL 3LIZH 5F96L 3TO4C 1TJIH 1ZS8B 3MLTB 4NWTL 4JFDD 2HT2D 5GGVH 3FB8B 1IM9D 3FOLB 3S88L 1K2DA 3NFPB 4L4TD 4WW2C 3QIBD 3AVEA 1BF8A 5ALCH 5KOMC 2D4FA 3ARED 4R96B 1OP5H 4DZBB 4NKDB 2FGWL 4OM0H 4UIKH 1FNGA 3MRIA 2X4PA 3D3VA 2CIIA 3ZZ1A 1RUPL 3CDGB 1PQZB 4YC2C 1GPOH 4TULL 5GS0H 5TQ2L 4UNUA 1QBAA 1JPST 4XPTL 2J88L 1J1XL 2EYRA 5IK3A 2ZG1A 2AXFB 5JMRA 1UM5L 1U95B 2NX5D 3CCHA 4H25A 1NAMA 5HHOE 5ILTL 1WK0A 3QI9C 1TVDA 3VJ6B 4KROC 3C60C 3AY4C 4Y16C 3MXWH 2HMIC 4QRUB 3FO0L 5D7LB 3KJ4C 3F6IA 5KVDL 4HWBA 5DJZA 2P5EB 2VB5A 3AFLA 3L7FB 4GBXD 4X8JA 3MX0A 1BOGA 5CJXA 2DTMH 4AENB 1QVOB 4G8GA 1G9MC 5DR5L 3TYGL 5ENWA 43C9A 4JFQB 2VDOL 1XIWD 1Z9MA 4U7KA 1QSZA 3IDXL 5JO5B 1I9RL 5CJQL 4XP9H 3RVTC 2FLRT 3PGFL 1I7TA 1RIHH 1RZIA 5GGUA 1ORQB 4IMKA 5I19L 4HIHA 4UBDC 2Y06L 4V1DD 4XH2A 1LMKA 2HT2C 1HKLH 3LEVL 2J3SA 5E0QA 4I4WA 2YKLH 4M48H 1W72B 4YPGA 1VA9A 3UXFA 1IKFL 3OKMA 1WIUA 2PNDA 4JDVA 1NGYB 2F5AH 4HIIB 4MA7L 1QLFA 4DKEH 4GXVL 4XVSH 3ZHLA 2BFVL 4Y4HC 1BBJB 4C83B 1J1XH 3MCKA 4YK4B 5IWLA 3P9LB 4BKLB 3U7AA 2OJZL 3I6LD 1UM4H 4IJ3C 4X6BA 4YWGL 4ZPTB 2H2PC 2O5XH 1QA9A 1Z3GH 2MOVA 4KRNA 4MNQB 3QIUD 3VFNA 3NGBC 1EX0A 4JDTH 4PJGE 2LV4A 1OARL 2DQCL 4ZDHA 2DD8H 4X6CA 5EA0H 4AEIL 2QTEA 4P2QA 1CE6B 3UO1L 4H8WH 1H3PL 1R3HA 1XGYH 2Q3ZA 3AU1A 6FABH 3K74B 4PJDB 3BKYL 3W9EA 4UQ3A 4QYOB 4JKKA 4BUHA 3VXUD 1AGBA 4U0RB 5ICYB 2ADJB 4NC1E 4Y4FD 2OTUA 5INCB 5T5NF 4GLRI 2QQNL 4X9HA 4ZAKA 4Z7OF 3T4AB 1MUJB 4UOW0 2OX5A 1MHEA 3ARBD 2GTZA 2DAVA 3IJHA 5CD3B 4E41E 2HTLD 3EOAA 4YBHA 3WV0A 1KYOK 2MQ0A 1CD1B 3AS0A 5EO0B 4JE4B 3I85A 4P2RB 3IETA 3QDJA 2P1YA 4Y5XA 3WSQL 4HJJH 3EYFA 5CGTA 4NUGH 3M45A 1CXLA 5IEKB 3V5HA 3ZTJG 1HHKB 3G08A 4I3GA 2P8LA 3GBMH 5J9PB 5D1ZC 2YEZA 1MJUH 3LKPA 2YPLD 2DLEA 4YHKL 2PETA 4OZ4A 2VLKE 5AYUH 2F54B 1J1OL 4IOIB 2IAMC 1E6JL 2R4SL 4EI5C 1OTTD 2ZNWA 4PJAB 4XCCH 1H3TA 3PUCA 5HYIA 5IW3A 2O5XL 3CIQA 4G8FB 3O41A 3D39B 2DTML 3ARGA 3MBEA 4OZGA 3MJ8B 3VRIB 3ABZA 5I66A 3OB8A 3QIUC 4C55A 1L6ZA 4NNXA 1JZ8A 4D0BB 3T0EA 4IS6B 4KTDL 2HMID 3BUYB 4Y0GA 3K1DA 4TSCH 1BLNA 2VSDA 2YPVL 1RFDL 3P0VL 4JG1H 1ZHNA 5C8JB 3VE0A 1JZ3A 5T3XL 1J87A 3V79C 5T3XE 1QOKA 2VE6A 1HHJB 5CFHA 2HTKD 3PDGA 4A6YB 5DJ0B 4XPAL 5SWZA 1MREH 2ADFH 1FYHB 3M1BB 5FYJD 5D93C 3C09C 4BZYA 3X14A 2HJFB 4OD1L 2HKFL 5CEXB 5IM7A 4OGXH 4MAYC 1NEZB 2HT4D 1FCGA 2A6IA 2BFVH 4MQXC 3TIEB 3LZFH 5C0AD 1I9IL 3NA9L 1C16B 1QBML 4M1GH 3CJJA 4LVNC 5CMAB 3CX5K 3TNNB 5D2LE 3LD8B 4YQXH 5IB2A 1IQWH 1JWSB 3LRSB 1PYWA 4IHOA 1DLFH 4C58B 1EGJH 3OKDB 4HT1L 3BEVA 2HKHL 4NP4L 1QSVA 4NQCB 4UTBH 2D0GA 3VI3E 1MY7A 2W1NA 4K8RH 3QCTH 1ADQA 1XGTB 3ET9F 2N56A 2VLME 3O6LL 5EFIB 2ICWA 5GHWH 2Q8AH 2FHFA 4UUJA 4M7KL 4MQ7A 3ARVA 1M7IB 1HHGA 3EDKA 3C60D 1TJGH 3WIFB 1N8ZA 4MXVF 4GW5B 1MRDL 4TUJA 3BVNA 3DO3A 4XI5C 2VR4A 5E99L 3UTSD 2NY1C 4QWWC 3S7GA 1NC2A 5LCVL 3FO1B 4Q97A 1MIEL 3UP1A 4XNQA 3VWJC 2CLRA 1KB9J 1JTTA 3CX2A 1KPRB 3P0YH 4PBVC 5F3BA 2LE9A 2X4UB 4L5FH 2IAMB 2W9DL 1D6VL 5IT2L 2IG2H 4MNHA 4DTGL 2IPKB 3WSQH 1BIIB 1AE6L 1FPTH 3B83A 4Y4KC 1I7TB 1BZ7A 4D0CA 2GJZA 1YEFH 4NZJA 4ZXBA 2H2SC 3QQNA 5D6DC 2CKBA 5D70L 2UY7A 3MCLL 2XZCH 3MBXH 5JW4N 4QHUA 2HTLC 2Q8BH 4RFEA 1I9JL 5ECJE 2PUQT 1W72A 3TA3D 2I27N 2RFXA 4G9DB 1T66D 4NQTA 4BELD 4YFEA 5E56A 1JTPA 4XCCL 1A21A 1QTYT 5DEFA 5SV4A 3CFBB 4LRNL 4O02H 2E7LA 3UJIL 4PGBA 3VXOB 3SGEH 4JZJC 1I7ZB 3ALPA 5IR1A 3REVB 1T4KA 1EO7A 3FQNB 1G0YR 1ZANH 3TPKA 1GJIA 4ORZC 1T03L 1T83C 1CDJA 4FHBD 3NFSH 2JJTA 1QA9B 2NY0D 3PHQA 2BNUA 4WW2F 2NLJB 2XY2A 1WZLA 2BSED 3V6OC 5DRWA 4PRPB 1ZK9A 4PJ9C 1JVKA 5FM4A 4C56E 5T3ZE 3X12B 5DQJB 5HGAA 3EHBD 1A7RH 1UADC 3S37L 2OI9B 2HWZH 1CBVH 2DMKA 2DIBA 3S9DB 1JGVL 2YS4A 3HB3C 2AK4D 2C3VB 2X4PB 1WBZB 4Z7WE 1FNSH 2RCSH 4HF5L 3OF6D 1OF2A 4R0LA 4U2ZA 3K8MA 2CLVB 1NMAL 1X5XA 1JI1A 4GAYA 4LBEA 4DK3A 4LP4A 5GGSY 2JJTC 2W9LA 5BV7C 3HE6C 5IFJA 4KV5F 5EO0A 5JLZA 3VG0L 4W6WB 3GHBL 4XPBL 4OFDA 3WJJA 1Q1JH 4R7NA 2FJGA 3JV0A 5D1XA 3DV4A 5K9JH 3PIQB 1WICA 1YZZA 4J3VA 3N1PC 5H2BB 1HE7A 1A3QA 2IBZY 4S1QL 4X6EA 5DK2B 2YEZB 1RUQL 1AC0A 1KC5H 1AR2A 2VC2L 3B9DA 5D7LA 4NN7C 5E4EC 5C2BH 2VJXA 1IQDB 3KPQB 1D5BB 1BOGB 4PGCB 1OP3H 7CGTA 3STZB 1KTDB 3MV7D 4BFEA 2F53D 1MCIA 2ITDB 2GSGB 5CD5D 1AKJB 3SE8H 5IW6A 1T0MB 4BYHA 4QRSA 3D2UD 3BIKA 1QRNE 3KPOA 5E2TL 5DMGC 4D3CL 2AJUL 1KJ3L 1RZIB 3GI9L 4JFEE 1ORQA 3V7AG 4AQOA 5BW7C 2R0ZH 5IB3B 4PJXA 5BV7H 3SE9L 3VXMA 3WEXB 2WAHA 5ICXA 3L9RB 3HNSH 3U7WL 1FJ1A 4AG4L 3C9NA 1HQ4A 4XCYB 3KXFA 2VKWA 2Z91A 4PJIB 5B3NA 3H9HA 4I0PC 1U91A 3N9GH 4UDUB 4GOSA 5LGHL 5IFHH 3HZMA 4A6YA 3OAYH 3DBXA 1NGYA 3GMMB 4GKSB 3RWGA 2AJYH 2GW5A 4JKLA 5F6HI 1ZLWK 1NEZG 3QXDB 2GAZA 3TWCL 4CVUA 1BBJA 1QRKA 1UYWL 1T7XA 3VXUB 1D9KB 1B3JA 4YEEA 3TBYB 4PFEA 1JGEB 3DROA 2EDRA 1HWGB 5JOPD 5EUOB 5C0ND 2M2DA 1T83A 1VPOH 4HUKB 4OF7A 5FCSH 4UINL 3GI8H 4IRJD 3PG2A 5DK0B 3MYJB 5EUKB 4QHLB 4KAQL 2EDBA 3BDXA 4X7SL 5FECA 5ACZA 1MCKA 4JFDA 3P4NB 3HAEG 1XCTA 3VGFA 4MQ7B 2IANB 4TSAH 3SGEI 3DUUA 5DD0L 4Y5XC 1UM6H 3V95A 1OSZB 4CJ1A 1YNKL 4AM0B 5MENA 2HYMA 3MROA 3S35X 3OAUH 3HMWL 4U6XA 4ZNEE 1D7FA 5EOQL 5EULV 3V0VB 3OR6B 1Z0MA 2CXGA 3EYFB 4ZUVA 3U0PB 4XPFH 3DLQR 4YC2B 5DUMH 3A67H 5DFTA 3RHWK 1A6VH 1KENL 1OGAB 3DXAD 4M5YH 4N0UE 4HWBL 4JJ5A 5ANMB 4NRXB 3G08B 2P8LB 3C2AL 2R56L 4PV8A 4N1EA 1MIML 4RGNB 5E8EB 2WBJB 1LO2L 1LVEA 4XVTH 5J6HA 1AY1H 3GMRB 2BSSA 4PJHA 1U8JA 3VG9C 4B53A 1P7KA 2ICCA 3SDAD 5E5RB 2CKBB 5BXFB 4OCMC 5DZOA 4G3YH 2NTSP 4M00A 5F7EL 5K9QG 3G5YB 1FNLA 3PWUA 4Y4FB 1K4CB 2FBJH 5I66B 1BMGA 1KTLB 1BQUA 4NPYB 3VD7A 4H20L 4CVWA 4IS6A 2BSRA 4GRWE 4IRSD 1UM5H 1VENA 1F6LL 2R29H 1IAIL 4LMQE 5FYKH 1J0YA 1CICB 2XTJB 3NACH 4TVPH 2VLJB 3KJ6L 3LDBB 1DSFH 3V5KA 1OAUL 2W60A 1EEQA 2VDNH 1C5DA 2BNQE 2VZ1A 2BNUB 3KNBB 1R0AL 2DI7A 1EK3A 1K8DA 3BW9B 4M6MH 5DRWB 1A3LH 1A4JB 1JIBA 4M7ZB 4NKIL 1HCFX 3CDCA 2G2RA 3VRLF 4IJ3B 3G9AB 3HPLB 1X4XA 3T2NL 4PJHE 5CSGA 4KKLD 2HTKC 3N1MC 5F7LB 3QUYA 1T5WA 1HXMA 1YC7A 2P5WB 3O4LB 4ZFOA 1TZIA 3TNNA 2AEPH 2W07A 3GJFK 5E00A 1PYWB 2AJSL 1A9EA 4OLUH 1AXTL 3EBAA 1F00I 3PP3H 4HD9A 4PJXF 3BQUA 4BQBA 2VH5L 3SQBA 4JFPB 5JPMB 3I6GB 3VCLB 3WS3A 5DVOA 2NY0C 2ARJQ 4KKNA 3PGCA 2ICWB 3DVNA 2UZIL 3MRLA 4HJ0D 5GJTL 5A3ID 3W0WB 3JV6B 5F89B 4CMHB 4R7NB 3ULUF 1FZOB 2XZCL 3MBXL 4TRPL 2DKMA 4ODUB 4GXVH 4XVSL 5D1QA 5AWNH 4HUVB 3HCVB 3ULVH 2OCFD 5TE6L 3VXNB 4MJIB 3B2UC 4U3CA 1W72H 4NHCL 3TJEH 3O2VH 1JNLL 4IMKC 1RIUH 1CE1H 3O45A 2LU4A 2AQ1A 1XH3A 4OCYH 3OXRB 5IVXF 2XTJD 1H8OA 1N0LA 4ZOAA 3LD8C 1G7PB 4PP2A 3LSOB 4LNRB 2JCCE 4YHOH 1CF8L 1MEXL 4B5EA 4P4KB 4U31A 1JYXA 1P7QB 3C8HA 4MA3B 3RWFB 4NN6B 2AK1L 5IMOB 1GRWA 1NEUA 3ZYJA 5I8OL 2G60L 2V6HA 1IRAY 1KT2B 3TPUB 1EH9A 2JKXA 4GBXB 1NL0H 4O2FA 4XNYH 5JHDB 1A7NH 3BKCL 1KLUA 5J56B 3VFTB 3ZDYE 3IAPA 1SJEA 1CD0A 2J7LA 4HFWA 3ARFC 1BM3L 1FVEA 1K9TA 3E8UH 3IGAA 2V17H 3CFCL 2GCYB 1YA5A 1DUZB 5GRUH 3X3GL 4ZFGH 4GKSA 1X5KA 1I7ZA 2BNQA 2APXA 4GLRH 3QXDA 2C26A 3RWCA 3VWJB 1ORSA 4WGWB 4DW2H 1UENA 1MCSA 3X3FL 1IZKA 1KGCD 3WO4B 4ERSH 3W5NA 5EWIH 1I7RA 4Y5VC 4HHAB 5TJWK 4PTUB 1INEH 4IDLA 5EBMB 1OAYH 2E8YA 2W65B 4L9LA 2E5EA 4L8SA 4YXKL 1T2QL 1GHFL 3QUXC 2NLJA 1LEKB 5E5MA 3WFCH 4CBPA 5DJ6B 2PR4H 2A2QT 4R6UA 1GZPB 5D7IE 1JPFA 1J1OH 1EEZA 4GKNA 1DEEA 3RAJH 1VEPA 4FP8H 3UO1H 2DQJH 1U8PA 3HAEB 1X5YA 1JNLH 2B20A 4LOUC 3WO3B 3QRGH 2WSKA 4RGMC 1J86A 3O11A 2JB6B 2RB8A 3SJVE 5BCAA 2L0DA 1IILE 1XR8B 2AV1A 4POZD 3SQOL 2F54E 4HUXB 5FGCB 1AI1L 1INQB 5KG9A 1B88A 1K4DB 5SX5K 4R0LB 5FUOL 4OD2B 4MAUL 3K1KC 2O5YH 4PB0H 4GAYB 2A9NL 2PTUA 2RR3A 3MGTB 3O4OC 4JO1L 1FDLL 2R2EA 2XKUA 4AH2B 1UWEH 3MRIB 4U6XB 3MFGB 2YSSB 5JNYA 3L3DA 1MY5A 2BVPA 3KYNA 2AP2A 2YA0A 3L5JA 5CIPH 5IMKB 4WHDA 1TVHA 1S7QA 2JJUA 1FZMB 2V17L 3EFFB 1J12A 5J12C 2WNGA 2UUDH 4M5ZL 2I9LA 3RGVB 4QT5B 1NAMB 1QSEB 3CVIH 2BSSB 4PJHB 5I8CA 4FFWC 1YEKH 3FQWA 1T1XA 5JMOC 5E94A 3G6DH 4GAJL 3I6KA 5K9JL 3OKKA 3DX8B 3CDYA 4RIRB 2E7CA 3L5HA 5EN2A 2PYEE 3GIZH 3IFNH 4QRSB 1X3DA 5HYFA 4NNPH 5E6ID 3T0WA 1L7TH 4S1RL 3RTQA 4RZCA 2OYPA 5HHQA 4WHCA 3UTTB 2AJXL 1AIFA 3I9GL 1NGWB 4QTHB 4ZFFA 3E0GA 4K8RC 5TDPA 1MLCB 1FJ1B 2F15A 2XRAH 4DUXA 2FGZA 3JWOC 3JVGC 2MKLC 3SCMC 5GGUB 4UDUA 1JWUA 1KFAH 5E9DD 2ED9A 5GGRA 4Z7VB 3C8KB 4P2CG 3S6CA 4KTEL 4KRPD 4MXQD 3SKOA 1Q94A 2CRYA 4DAGH 3JUYA 4IOFD 4I0CC 4UI2A 1OTSD 5JXEA 1FVDB 5FK9A 1PKQA 5ITFA 3F7PC 4RFNC 3P4OB 1CFTA 1DBBH 3VWJD 5A1AA 4U05A 2DMBA 4Z76B 3CXHK 2IQAB 4PRIB 1QG3A 3BEWA 4Y1AE 1HK6A 4YAQB 3K8LA 2ADIA 4KY1H 4G7YH 5EU6D 2WANA 2R0LH 5JHDD 1S8DA 5CSZA 1M4KA 4R8WL 4RISL 1F45A 4UT9L 4DEPB 3VFVB 3H3KA 1DQMH 3WD5L 2X89D 6CGTA 2DQJL 5JZ7C 1Z9SA 3PWLA 1MRFH 4JFXA 1SYSB 2VWEE 4J3UA 4P2QB 3X17A 1IKNA 3B6SA 5I18H 1IE5A 1MRDH 5C70A 1KJ2L 1QLEL 2DKUA 3K7UA 1MVFA 4S1RH 1A1MA 4AM0A 2WWKO 3TO4B 1BD2D 4WY7H 5I9QB 3VXSE 1Q0YH 1W2KT 4F3FA 4LAQH 4CUCA 5DZNA 3FT4A 1FNEB 3OXRA 1OCWL 4XBPA 5SWSD 3LS5H 4YNYA 1F6AB 4Z78A 32C2B 4OLVH 4G8EA 1GGCH 4XAKD 3GRWA 2Z92B 2WUCH 5F3HB 4LCYA 2OMBA 2I25N 2WBJA 2VAAA 3ETBF 3IETB 3QDJB 2P48B 2UZXB 3T09A 4PUBH 2MSPA 2QADB 1KIRA 2X41A 1R0AH 1UQSA 2EEBA 3BPCA 4C56A 4APQB 1UXWB 2Z0BA 4WO4C 1MQKL 3CH8A 2CD0A 3I02A 2QQLH 4HXAL 1MLBA 1EFXB 1TETH 5IBUB 2GCYA 1S7UB 4ETQB 1NMCB 3EYVA 1E4XL 3GJEB 1LDPH 1B2WH 4NZUH 5BS0D 3BIAX 3Q5OA 5ADOH 1CICA 3O41B 5IESH 2X4QA 1WSST 1S7WA 3V5KB 3B8YA 1YN7B 2FX9H 2GKIA 3EJYD 2A6DB 1EBPA 1FVCA 2VQUA 2VH5H 3BUYA 4PJ5E 4YXHH 1H3WM 1PG7L 3S37X 3BKJH 4YHIB 3PGDA 5DHXB 3C6LC 3CSPA 4MJ2A 1DEEB 4C57C 5IMLA 3KPPA 4L4VD 5B8CC 2CMRH 3MRFB 3BPOB 1MI5D 3K0WA 3WS6C 4JRYE 4ZFOB 5KW9H 4Y4FC 5DD1H 2ZCLH 3RY4A 1T22B 4YDJA 3D85D 3TCLB 43CAA 3C8DA 1TJHL 2VQTA 4QNPF 4YHMH 1DQQA 4F7MA 1Q9LB 5D72H 2A6IB 3OJMB 4NZRH 3MR9A 1ZT7B 4OJFH 4AYFA 4JFPA 4HWZB 3TBTA 5JPMA 3QQ4A 3IDIA 4L8BA 4G8GD 3LRSA 4Z7UE 1NCDL 4NWTH 2F53A 3BZEA 3JV6A 3DURA 4XRCB 1D6EA 5D5MF 3S3SA 4NYLB 4LPXA 1CFQB 2VLMD 3BH9B 1U8IB 3V0AC 3HLAB 4O4YL 5HYQA 1RJLA 2EDYA 2CSPA 5TF1H 4JGJA 4MLIA 5IB5A 2N7BA 4OM0L 2JIXB 4HEPG 4FQCL 1M7IA 1CTNA 5ALBL 3HNVL 4KZDH 4ELKB 4ZO6A 4UOW1 3QFDB 3U9UA 1G1CA 1P4BH 4YZFF 3TZVB 2NW3B 4GKZA 2CLRB 5B39B 3UTTE 4OTXH 4HT1H 2VZTA 2BNRD 1UEYA 2X4SA 3JV4B 3HNSL 5F9JB 1BAFH 5CZXD 5CZKA 5AZ2L 1UH4A 4X7EC 3QEQD 4RNRA 1EJ6A 4PJ9D 1JBJA 2L7JA 2EH7L 1FVEB 4NFDA 1U8LA 4OZHB 2F54D 3KS0H 3KYKH 1T21A 4QHNB 4LCWB 2AGJL 5D7IB 3RWCB 4Q74A 5EC1A 5F7MC 1LDPL 2YBRA 5GS1B 1YPZB 1KF9B 5IESL 5JQ6H 3MRBA 4FG6C 1HSBB 3MV8B 4EEEA 4J1UB 4ZOCA 5E2WL 2CK2A 2LAGB 4EUPH 1QBMH 3PV6B 2V2TB 4L29A 1J8HA 4MMXC 4ISVA 1F4YL 3GMQA 5IFAL 4KI5C 2VDLL 4H0HB 1OB1A 3ILPB 2HLFD 3DARA 5KTEL 3C6LA 4XMPH 3SKMB 4HZAA 5EBWB 4POZC 4K8RL 3RJDA 1HIMH 4YLQT 1J05B 1ONQB 4JFXB 2C1OA 4OQTA 1TTUA 4NT6A 1KN4H 5I0ZA 1K8IB 5JW5A 1PD6A 2PW1B 3RZCD 2R4RH 1CDHA 3L3IA 1CFVH 4GO6B 1MRCL 4HPYH 4GW1B 5CINH 2R15A 3HB3D 1RSFA 3WHE1 4YUEH 5D72L 2CGRH 4X4XB 1CG9B 1N6VA 2YUVA 4OI9A 1BVLB 4YXLL 4FQXD 3FT4B 2F5BH 3QIBA 3D39E 3I3BA 4XBPB 4YO0A 2V2WB 3RWJA 2OJEA 4LF3B 4R3SA 2BVPB 3KYNB 1EMTH 4Z77B 1NCDH 1RJZA 1U36A 5JDSB 3TT3L 5A2LH 1YQ2A 3P30L 4AIZB 5KZCB 3WHXB 1YDPA 1KCVH 1ZEAL 1YNTB 2ICWJ 5IP4A 3BGMA 1VGEL 1OSPH 3MRNB 3TBVB 3QDGE 3TZVD 3FAWA 5C0EA 2EDHA 3NPZB 5HYJE 4NQUA 1NCCH 5E9DA 5ISZD 2CDEB 1L9MA 2CXKA 4Z6AT 1GOHA 3RU8H 2X42A 1A14L 2R1XB 1A6UL 3MV7E 1A7QH 5F88A 3KPQA 3TO2A 1GAFL 4X9GA 1KTDA 4IIQA 4KDTC 5HHMD 5C7XL 4Y16A 1S9KC 2QKIB 1AIFB 4TQEL 1A3RH 4PD4J 5F7DA 8FABA 2P5WE 3O4LE 1HHIA 2R2BA 4MCZA 2AV7A 1KN2L 5E8DH 5EOCH 2XZQH 3L5WA 1KCUH 3VXRA 1KCRH 4K3DL 4Y4KD 1Q94B 5ABDE 3GSNA 1JCKA 1I85A 4IOFC 12E8L 1KELH 4WNQA 1JFQL 1TCRA 4FQIL 1SEQH 1U91B 4IM8A 5FIEA 5EU3B 3BSZH 1WFTA 4LU5H 2Q7YB 4MA8L 3DXAA 4YAQA 2ADIB 2CPCA 3GJFA 1AXIB 3GKWH 1K6QH 3O8XA 4QGYA 3DV6B 3LKSB 1NDMB 1OP9A 3FT3B 4HUUA 2AEWA 2G60H 5M7QA 4MAYD 2LFGA 3O9WD 4JQVC 1GIGL 1LGVA 5E2WH 3EKCA 3NPSB 3RNKA 1RVFL 3RDTC 1JK8A 2DYPD 2R23A 3QDMB 1F4XH 1KLGB 1V8HA 2BVQA 2WUCL 2V5SA 1F4YH 3PNWB 5IFAH 3LV3A 2QHRH 4HS6A 5I1KH 2EDFA 1IEBA 2H8PA 1UKTA 3ULVF 4CADB 5JZ7D 3FRPG 2DTSA 5EPMB 2NY3C 4UT9H 4U1KB 1PKQE 3G6AB 1AC6A 2W0FB 4XRCA 3U46B 1MHHB 3VI4E 3WNOA 3N50A 1OAQH 2WQ8A 1MAML 4QHLA 1E4KC 4F9LA 4PJDE 5T5NG 4TN9A 5GSRB 1MHPL 1CFNB 4APQD 1QR4A 1LK3L 1NLDH 4EJ1C 3CSBA 4WRLA 1P4LB 4M4PA 4XVUD 1IGYB 2QBWA 4XNZB 1B2WL 1PW3A 1NUNB 1DN2A 1AGCB 3WLBB 3MBEC 4MVBD 5TDOA 4OZIF 1U8MA 4AIXA 3HPJB 4QF1A 4JQVA 3WNPA 4E0RB 4MQSB 4XP1L 4PRPD 5TGBA 2AABH 1UKSA 3UC0L 4M7KH 5B39A 3UJTH 2V7HA 1KACB 4PJ5D 5CZXC 1IL1B 5EO9B 3ROLB 5DA0B 2X10A 3BPCB 3BZDA 3HI5L 1N6UA 5LXGL 4YHZH 1AQKH 4LSQH 2AEQL 1INDL 2CJUH 1BWWA 4L4VE 3LKRB 1QP1A 4AY0A 4ODVH 2LTQC 5DD0H 4ETQA 5BXFA 1YYLH 2NXZD 1A4KA 4HPOH 1BD2B 2J8UA 2C7UA 2BOBB 2XXCB 1U8NA 2BNRA 4ONHB 4E5XB 4PREA 1EV2E 1RK1A 5ESQB 3OGCB 2W9EL 3PJSB 4Z7VF 4U1SB 3NCFB 2FECI 2F58H 2H9GB 3OZ9H 3MRBB 4LLAA 1IGTB 3PDOB 4EKXA 1PSKL 4X6FB 1T2XA 4J1UA 3TESA 5BJTB 4Z7QE 3DXAE 1FL6B 5CEZL 5GXBB 4OZFA 3GSNL 1IGIH 1RZJL 4G9FA 4PY7B 5HTSA 1GCFA 2HT3D 1NFDA 1MJJA 2HFEB 4H5SA 3BYTA 4PJ5A 4D94A 2IWGA 2WP3T 1HDMA 5CIPB 3FCTA 5HHVH 4U1NA 3MLTA 1T22A 1A4JA 2EYSB 1T03H 3ZE2F 2V5RA 1GGTA 1NAMH 1L0YA 1V7NL 4RMSA 1A0QH 3GSVB 2AJZA 3FOLA 4L9LC 3VXTA 2AABL 3KPSB 3MRKB 4LARL 5JW5B 4OLWH 3MREB 3CGTA 1TZIB 1ZT7A 4ENEC 1OP5K 4XMLL 3CFEA 4RX4D 3NZHH 1IC1A 3UTSE 3BZEB 5HGBB 3W39B 1N6QH 1FLTX 2MQCA 5DDHB 1BIHA 3JWOH 3VU2A 4NZRL 4XNZC 5E6IB 1OARH 2DQCH 5IEHA 1A6PA 5FHBL 4HWEL 5E9DE 2AI0L 2YK1L 4KJWC 3PGCB 3CDFA 1OAQL 1FN4B 3BZ4A 5F9WB 3W0WA 4L4VA 4NZTH 3D3VB 2Q76B 4DWHA 3MRNA 4I77H 4MD4A 4DOHE 1HKLL 1LO2H 4R4NC 3MRPB 1YMME 2Q87A 2X4TB 5D2NA 5E24E 5E9DB 1JRHI 4HH9B 3IDGA 4LGSB 4DKDC 3L7FA 4JO4H 3EDDA 3B3IA 5FYKD 1IGIL 1RZJH 3UTSB 4HJGA 3LSOA 3D69A 4N68A 5J3HC 2H3NA 1NBZA 1I3RA 4APQC 3EYOB 2BVUA 4P9MH 3RY6A 4S1SH 43C9B 3QJHB 1KTRL 1DDHB 4QRRA 5LWYH 4WW1B 3L5WB 3JTTB 4GW4B 5IBLD 4NFCA 4LIQH 4JY4B 3WIHL 1KJVA 4NWUH 4XAWL 1R5IB 3VXRB 2FYYB 4YDLB 2HG5A 2QEJA 1KB5A 4WO4B 1MFCL 1V3JA 2GEEA 5GGSB 4PP1C 4EN3D 2HWZL 3TLRA 5JO5A 3RGVD 3EDJA 3LHPH 5AAWA 5E95B 4I0KA 2V7NB 4Y1AA 3DSFH 1QLFB 2E27H 1HSBA 3MV8A 1AD9B 1N5YH 1A7OL 3ULUL 3ARFD 4R8WH 4YPGB 2QSCH 4BKLA 1PDKA 4Z7WF 2RJMA 3ME0A 1OAXH 3OAYK 2AK1H 4Q2ZA 2G9HA 1FIGL 3CU1A 1FSKC 1EJOH 1CXHA 4LQ1A 4J3TA 3TWCH 1IEBB 2EXWC 5I17A 2XNAB 4YFLI 4CADA 1CLYL 5EBLB 5KVEH 3P9LA 1U58B 1ED3B 4X6BB 3G6AA 1FP5A 1N4XL 2FCBA 3QUKB 3WUWB 2D03L 3O11B 3ZKND 1I7UA 4PJAF 4UQ3B 5GS1C 4DW2L 5DMIL 2KDGA 2E6PA 1QNZL 2V2WA 1W72L 1MJ8L 4FQXC 4LF3A 4NHCH 5D1QC 1R3HB 2DQIL 3BRDA 3EZ8A 4XMLH 4OD2A 3AM8C 4AL8H 3HZYB 1CFVL 3RVUC 5EZOL 2APWA 1BQHB 1FCCA 3WXWH 1YEJL 4F7TA 4LNVA 1P9MC 2AXJA 4CKVX 4KK8D 2YPLB 2OTUB 5INCA 4X4ME 1U8OB 5HYJA 4YK4C 5GZOD 1RZKC 3CFDB 1I8LC 5SWQB 3HRZA 4Y4HD 4JZJB 4QT5A 4U7MA 3GNML 1UA6H 4I3RH 1QSEA 2FJHA 1R3JB 2HH0L 5D7KE 4YR6B 4YDIH 3GMPA 1A7PL 4OCXH 4KQ4L 4Y16B 2B4CL 3OKKB 1SQ2N 4KMTH 4NQVB 1BM3H 3HFML 3U83A 1M71B 5J1TC 3BRFA 3HUJA 4FQXA 1PG7X 4OF8A 3D39A 4XWOD 2P45B 3IYLW 3CMOL 3T77B 5CKGA 5C0FA 4WEMB 2F54A 4O51A 3S35H 4OZGE 2XA3A 2H9GA 3T0EB 3W81A 4S1DC 5D7IF 2P44B 3EFDH 2C3XA 5C71A 3QDGB 4MGXA 5FB8B 1ZHNB 2WM0A 2R1WB 5DD3H 5L0QC 4UDTA 1RV6X 1I8LA 1JWUB 1RUKL 2OR9H 2VE6B 4U3XA 4UILH 1AJ7L 4D0BA 5ESVB 3VFUB 1OTSC 5A2IH 3KLAB 3U30C 3TT1L 3GJFB 3U0WL 1FZJA 1J11A 4WHYG 5C0BD 1PEZA 5HHXL 3C87A 5EZOH 3C5SA 1MH5B 3MODL 2DI8A 3Q6GL 3SGDI 5DC4B 4BFIA 1KELL 4P2OA 5I30H 4HCRL 2FATH 2G5RA 1I3VA 1RUAL 4CNIB 3DVIA 5FGRA 1M7DA 1AGDB 3PGFH 3BZFA 3RVXC 1ZTXL 4IHOB 4TYUA 3SDCA 3MLPA 3GK8H 4NO3A 4EN3B 4JPWL 3D18A 3MLRL 1IM3B 2F19L 1VFBB 5IG7A 4I3RL 5CGMA 5TE7H 1XGRB 1CXKA 4WV1A 4P9HH 2J5LB 5ACLA 2AEIT 4JR9H 5B3JF 3DRQB 5IB2B 2X6MA 2CRMA 2VDKH 3MFFA 4CRPA 4X80H 4TTDC 4X4MA 2Y6SD 3BEVB 1AD0B 2DI9A 2X9XA 5I1EL 2GI7A 3IFLL 3G6JA 1QFHA 2X70B 4WCYL 1RULL 2VN7A 3GRWL 4JO2H 4X9FA 5L6YL 4X6DA 1PLGH 1YPZE 5JR1L 1CGVA 2VZVA 5CEYA 2W9EH 1QHPA 3D85B 4L4JA 3RWHB 3V4UL 1FNEA 1FORL 1HHGB 5J3HD 3KLDA 4P5KB 4JKPH 3JWDL 1Q8MA 4W4NA 3D69B 5H35B 4D9RE 5CWSB 3ROLA 3O4OB 3FONB 3LOWA 4OGYH 1DTUA 1NANH 1RHHB 1MCJA 5HXMA 2DQUH 3MNVA 3I2CL 3GHEH 1S3KH 1YNLH 1LP9B 3VGGA 4EQ2A 2B2XL 1KPRA 4RA3A 3H9SB 4WFFD 1OTUD 2MFNA 2VLKB 5F21B 4G9FE 4D8PA 5DWUL 3WIHA 2HAZA 1CICD 2NY6D 5GGSA 3OF6A 3OKEA 3RKPA 1AQKL 4LSQL 2BNRB 4ONHA 2XTJE 3RPKA 3S4SG 4E5XA 4JKMA 3BMWA 4TSCL 1FGNH 1MLBB 3QXUA 5TPWH 5DEFB 1X6LA 2GJZB 4PGBB 2XQBL 2Y7QA 1QSFE 1LK2A 1A6WL 3REVA 1ZGLB 4WFHE 4LDLB 2R0WL 1MCLA 1EHNA 2QSTA 3FQUA 3E6HB 1T7YA 2ATPB 3FZUC 1TVBB 2VTFA 1MFEH 3QA3A 1KNOB 3GEWB 4LGRB 4F37F 2VAJA 2YUWA 4PUBL 3IVKA 5DFWH 4OD1H 1MI5A 2NNAA 5GRUL 3TBSA 3BGFB 3FCTB 1A47A 3BE1L 4YHIA 1KPUB 3ZSSA 1J0KA 4MDIB 5CBAA 5I17B 4OZHE 2HRPH 3EJYC 4QKXB 4RBPK 5GZND 1ZT4B 2IGFH 3MLUH 5K9KA 1I3GH 3VDBA 5JR1H 4U4BA 5FUZH 3W2DL 1TLKA 4P3DA 1FRGH 3PHQB 4JDZB 1T2QH 5F71A 2YPLE 1RZFL 1KC5L 2VC2H 5IB4A 4PG2A 3SBWA 1YMMB 4YDJB 3KYMB 4LCWD 3GMNA 1EDQA 4R97C 5CKAA 2XI9A 1IKNC 1MWAH 1Q9LA 1KCRL 4K3DH 5CZVH 5D5ME 3BH8A 3VFWB 5JUEH 1LEGB 2CLVA 3ARDD 4EI6A 4QRPD 3OB0H 1IJ9A 2IANE 3QQ4B 3H3PH 1SEQL 4DK6A 2F53B 4KJWD 3T8XB 4HIXH 4X5XA 3WJJC 1TITA 1A7NL 1I1FB 1R3KB 3BKCH 1QHOA 5CBEA 5MEQA 1MCWW 1AGEA 1OF2B 3EGSA 3DI2B 2NCMA 2BRRL 2EIZB 3SN6N 1T80A 4QNPE 5JXAH 5HYQB 5C0GA 5SWQA 1PEWA 3EYSL 2Y25A 1C12A 1N64H 1I9IH 1R3JA 4HIEB 3ECBB 1IAKB 3GMPB 3X13A 3MUGB 3UTSA 3PIQA 2R39A 1WIOA 4TQEH 1NBZB 3QFDA 3SPVB 3RIFF 3U9UB 3GBNL 2ITDA 4NQVA 4Y88A 5C07E 1QRNA 2ZOKA 2Z8WC 3DTXA 4KKBC 5L2JA 4ZUSA 5D70H 1RK0A 3C2SA 5C0FB 3MBED 1IQDA 3ILQD 4JY4A 4PJFA 1YEKL 3MRQB 2HT4C 4XXDA 5AZEH 4XPHL 3VXMB 4RQQA 2R1YA 5D7LE 1LE5B 1DR9A 4WO4A 3U4EA 3BT2H 3KXFB 2Z91B 5JIKA 4GQPH 1P4IL 3LB6C 3QZWA 5IHUH 1FAIH 3TH2T 4XC3H 3VXRE 1H3UA 4K9EC 3IU4L 5DT1H 5CLTA 3OMZA 4PJXB 5I8EB 4JFEB 2V7NA 4Y1AB 4WWKB 2DIAA 3K2MC 4RBPH 3QNZB 4OFIA 1HEZA 3C9NB 2X1PA 3ARFA 1JHKH 4F9LC 2CO6B 3CXDL 3SGKA 3S36L 3GSOB 5EU6A 2R29L 1JZ6A 4I0PA 5F72S 4GH7B 5FCUL 5EUOA 4BSVB 5I8KH 2DB8A 5DQ9A 5FDWB 2CLZA 3OKLB 3R06A 2H26A 3BUTA 1D9KA 4NO3B 3MLWH 4EN3A 3D18B 4HMEA 4DOHB 3P11L 4MJ5A 4WTXA 1RIVH 3RP1A 4N8CL 5BS0B 1F4HA 4TSBH 4G6KL 3SKMA 4XVTL 2DMCA 4LIQE 3NABH 2A83B 3ARDB 2IANA 4OF3A 2W38A 5ICZA 3CSGA 1E4WH 4X8XA 2ORBH 3UMTA 4OFYA 1WIPA 2QQNH 3FB7B 1EFXD 3P77A 5D5MA 4PV9B 2XQYK 1NC4A 3MROB 4KU1A 4M3JA 1XCTB 5F9OL 2J6EH 4U1GB 15C8L 5FKPA 3BN9C 3WKNA 1OAKL 4KC3B 4YO0B 2YPLA 1BF2A 4P5KA 3EFDL 4Z77A 2WP3O 1DQLL 1Q9KA 4ZD3H 4F7PB 3UDWC 4ELME 3G6JF 4XMKL 3HC3L 3OWEA 2F53E 4IEFB 3WFHB 2EDJA 3VWKB 4NQDA 2BRRH 3CC5A 1WC7B 1LP9A 2XWTB 5JW4M 1CBVL 4ZUVB 5T1MA 3U0PA 5CJ8A 1QQDA 4J2XA 4HS8H 4EZMA 1BGXL 5HI5D 5BOPA 2BVTA 4R26H 1WZ1L 5E8EA 1AO7D 4N1CA 2VLJD 2ARWA 2PYFA 3NCMA 2W92A 3HN3A 5E7FA 3CSYA 3TV3L 3QT2A 4PJ9A 4P46B 2OZ4H 3CMOH 2R1WA 1K4CA 3QO1B 5EORL 1F58L 1XGUB 3VXQB 2C3HA 1C5DB 3IDJB 1H8SA 3WHE0 1N2RB 3PWNB 1UXSA 5B4MC 5HDBE 3H9ZA 4LVOB 3RKDD 1KJ2H 5JOPE 4G9FD 2DS4A 3KGRA 3SCMA 3L3KA 1Z9LA 2P49B 4JZNA 3ZHDA 1CQYA 3S97C 3QDHA 3KR3H 5IVXA 4PRHA 4CNIA 3TJEL 1YMMA 3ZDZE 3EOBB 1NDMA 1CT8A 3GMNB 4LVHB 3U36B 1CK0L 1QFWL 3Q6GH 3FN3A 3VDAA 3TNMB 3NCBB 4WI9A 3QUYC 5C08B 5CD5C 3QG6B 4I9WD 3ZLQC 4GRMA 1G9MH 4MX7A 2PYEB 3LV3B 1VFAB 3W82A 4NKDA 1Y18A 2A1WH 5BRZB 3MRDB 2ZUQB 4UAOC 2VZOA 1U3HC 5EPMA 1OWWA 3TT3H 2X5PA 5CBEB 5MEQB 1A6AB 5IUSA 2ZG2A 4JZOA 1VACB 3CDGA 4NO0B 3UZQA 5C0NC 2P24A 3VXNA 4DKFH 1CFNA 1XMWA 2AXFA 1ADQL 4YHNA 1WCBB 3EDEA 2HVJA 2I5YL 1VB9A 3D85A 3RWHA 1NCCL 3SDDD 3QUMH 1NCUA 4N90E 2CRIA 4F9PC 3I75B 4ODUA 5D1QB 1P6AB 3MV7B 2LABA 2NXYB 3IAQA 4PGEB 1J7VR 2WIIB 3LKQA 3PV7A 1CGWA 1FV1B 5C0JA 3RIFK 4P4KA 5HDQH 1P5UA 4XPGL 3GO1L 5L2JB 1SVCP 2FECL 1IKFH 4K7PX 4P23D 4U1MA 4D9QD 1ZVSB 1OAYL 1DQDH 3RVUD 5ILTH 2V7HB 2CKNA 4K3HA 4TOYL 3S37H 3U6RB 5I16A 4AENA 3FKUS 4O2CA 4LNRA 3KR3L 1LE5A 2CKBL 1U6AL 1FH5L 4DFIA 3OKEB 1PZ5B 4PYHA 4YWGH 1S9YB 3B9AA 3MNZB 1CI5A 5FO8A 4HULB 3QZWB 1VFOA 3U2SA 2FDBP 5DHVB 2CO7B 5FXCH 3ARXA 4QRRE 5C6WH 1DANT 5DR5H 2OP4L 4L3CA 1PKOA 3Q5TA 2FX8L 2J8UB 4D9LL 4O2FB 5JHDA 4I4WB 5L8KB 1FGVL 1U93B 4P3WA 4RMWA 2VLRE 2KKQA 5B8CB 4HFWB 1R24A 3QUXD 5EBMA 1U3JA 4XP6L 3GMLB 3QEUA 4Y2DB 1MI5B 3E3QE 1KPVA 5BMFL 4TPRH 3LN4A 3QG7L 3G04A 1CZ8H 2Z4QB 1ZT1B 1VERA 1R5VB 3NVQA 5T1DH 5CBAB 1EEZB 4HC1L 1F4XL 4X7CC 3HR5A 2BERA 2JCCF 4HQQH 5EZLA 5T33H 1H5BC 2M8XA 2FSEB 3AM8A 4HHAA 5L7XL 3H0TA 2OTWA 4QXUH 1NAKH 5CIPA 4JDZA 3BP6B 4MNQA 4YHPA 4JM2B 4NRYB 4FABL 1JPGA 2X4OB 1QO3B 4NM4H 3CVIL 3FTGA 3ARDA 3F7YA 3CK0L 1YQVH 4GKNB 4P46D 4PY8J 3PWPA 5BVPH 3GSVA 1U8PB 1GC1C 4HV8A 3OKOA 1IAOB 4Y8AA 5GJTH 1HH9A 2FH8A 1A5FH 3AU1B 3LIZL 3T3ME 1F4WL 3BN9D 3L3OB 1L7TL 2VNCA 4Z8FH 1W8OA 5DQDH 5EA0L 3ZDZF 3DX9A 5CEZH 2YSSA 1ITCA 5KG9B 4NNYA 3RQ3A 4BZ1L 5A16B 5KN5A 4YE4L 3T4AA 2NW2B 3SDAA 3BWAB 3SO3C 4MWFB 2BOCB 2EDQA 5C0GB 2BY0A 3EFFA 4N0RA 5HHVL 4YUEL 1LO4L 4A2MA 4BQCA 3IF1A 1CD1A 4NGHL 4NQDB 4U1JB 3WKMH 1I8MA 3MV11 1F3JB 3MUGA 4HW6A 4K3EL 2FLBT 4N0UA 1JP5A 4LPCA 3GJFH 5IEKA 4UZGA 3MA9L 5FDYA 5FOBA 3IDNA 4HH9A 1FFRA 1LHZA 4ZNEA 1QKZH 3VW3L 4H88L 5FYLE 3RWEA 1XIWB 4F9PA 4Z7WA 3K46A 2UVEA 2PYFB 2H3NB 1I3RB 1NGWA 1PY9A 3VFGL 5LGKA 1JYWA 4OF6A 5KVFL 1FYTB 3U7WH 1GGIH 1SYVA 1QFPA 2VZSA 3MJ8A 2WIMA 4WI5A 4F8TA 1JRHH 3NZ8B 2A9MH 2YRLA 3MLZH 3MMEB 4LSTH 5GGRB 4AK1A 4Z7VA 1R5IA 4OLZL 3UTTA 1DL7H 3SKOB 4OZFH 1RIVL 4NUJB 1ZLSH 1OAZL 3QI9A 2CK0L 5TDPB 5HHXH 3TC9A 5EOQH 3C5ZD 4KK6D 2H45A 1CFTB 4K3JL 3VE0B 3IDMB 4DVBB 3G5VA 2FX8H 2CIKA 4MNQE 3BGFC 4NBXB 3V4PH 9CGTA 5BZWA 3TVMD 4R9HA 2HA1A 1CWVA 4UAOB 4LARH 3SE3A 3EOBA 2YOCA 3L7EA 3M1BA 4U2YA 2FB4H 5D2NE 1BECA 1KCVL 2N7AA 4CMMB 4Q2ZB 3HNTH 4U1IA 1XGPA 2F5AL 4KXZI 4HQQL 4GRLD 5DC9B 1OQOA 1Y18B 4NQED 2CUIA 1JWSA 5I1GH 3O3EB 2OXHA 4NJAH 2MTPA 4G6MH 1D6VH 3JTSA 4H26A 1OPGL 1LNUB 4PJXE 4PV9A 1A1MB 1NC4B 3IRZA 1LO5A 1IQWL 3C5JB 4JDTL 5EU6E 4IRZH 1MCWM 2VDRH 1VESA 3MXVH 2ORBL 4X5WB 4P2OD 1NCAH 1R3LA 3AAZB 5LKNA 4Z7OE 1YEEH 4Z0BH 3CFIC 3JVGA 4GW5A 4NQDD 1FG2A 1Q9KB 4HWBH 3H2WA 4KI5F 4OGYL 1SM3H 5DRNB 2ZSVB 2AAVA 5GRJL 4PJHF 4JFFE 4MS8C 5FYLL 3P9MA 1LD9A 1VEOA 3TYFA 1YECH 3KLSA 3O2WH 1OGTA 2HFGL 1XIWC 1UJTA 3LKOA 1FL5A 3FQRB 1UQSB 3MJ7B 1UJ3B 4GQ9H 5HDLA 3VGDA 3DMMB 3HRZB 2BDNH 2DQTL 4LCYB 1BD2E 2VAAB 4Y2DC 5FO8B 4JM2C 4S11A 1DUYA 1EFXA 1KB5H 1RHFA 4D0CB 2A9NH 1KB9K 1MFNA 1O7SA 4L8DB 3BDYH 5I1HH 1XEDA 3J7HA 1UWEL 2BSTA 1UH2A 2GK0B 2OSLB 4APQA 1M71A 1U93A 5D7SL 3MTRA 3ULSB 4BA8A 4FXKA 1P69B 4LLUB 4DAGL 3TJHD 3HMWH 4QXGH 1OVZA 3L1OL 1A9BB 4W6YB 1JN6A 4M6AA 3MUHL 2I60H 1DBBL 4XB8A 1GVIA 1KPVB 3QR2A 1N2RA 1UXSB 4HGMA 1ZT1A 4H1LG 5D96C 2A1WL 5GS0D 1JPSL 5SWZE 1G7QB 2OL3A 2X4QB 3MZTA 3Q3GB 3UJJH 3HTLX 1FG9C 6FABL 5GJSH 3HZKA 3MLUL 4YDKL 4KY1L 2XZAL 4PLNC 1AY1L 1RU9L 1YN7A 3CMGA 4MAYA 3NMEA 1TNMA 4MSWB 4H0GA 1WFOA 4PRHB 4FZEL 4OFVA 2QQKH 1CT8B 1MFBH 2ICEB 5FA3B 4ZTPL 3T4YB 2XKSA 5DEZA 1HZHL 1BZ9B 4QGTA 1C7SA 5FUCC 4LLDB 5AD0A 2GY7B 3QWOA 2D7QA 4PGDB 2D7TL 5KSVA 1AGDA 3BZFB 4K94C 4GQ9L 4JVPA 1WBZA 3MJ6A 4KUCD 5SX5H 1O5DT 3FB8A 4ZFGL 1UB6B 2XKNB 1VFBA 1ETZA 2ERJB 5KN5B 1VACA 3NIFE 4EUPG 3MJ9A 1YEHL 3OSKA 2P24B 1IGMH 1MFDH 3K2UL 3ARYA 4R4BA 5SWSE 3GSUA 3Q1SL 4FNLH 4KGJA 1KOAA 5KBNC 2BNRE 4KKAC 3IXAB 5MENE 5D1XB 3I75A 3GNMH 3CFJA 1XF4B 1WWCA 1EHLL 5C0RL 3GBNH 2BP3A 4WUKL 1WISA 4J3OC 2KUTA 3IDNB 3LPGA 4X6DB 4RMQA 5DMKA 3TZVA 3C6SB 3HI6H 4FXGA 4KPHL 1C5BL 3GK8L 3G5XB 3UPRA 5A2FA 1QSEE 5T3XH 1QPXA 4HS3A 1LO3L 4LEOB 3ARSA 2IFFH 1OW0A 4O2CB 2XIDA 3C60A 4OM1H 1ZGLM 4UMGA 4F58L 1FYTA 1AKJA 3PHOB 1NGQH 4ZFOL 4Q9BA 1RHHA 1Z2KA 3V6ZB 3KPOB 4Q58C 5GS0C 3QDGD 4GG6F 2YN5A 4GKZB 4IDJL 3RVTD 4KKCC 4PB0L 1T1ZA 5EZIL 3H9SA 3QDME 2FO4A 5IB3A 4TULH 5MHSE 2RGSA 1RZ7H 2UY6A 4FFVC 4L3EE 5D7IA 5FKAA 1ZLUK 4JO3L 5ICXB 4F80A 4EN3C 4N9GB 3NA9H 2VN4A 2CKBH 3MRHA 1BVKB 4QOKE 2DJUA 2MMXA 4RNRB 4PJIA 3V6FB 4KAQH 1QEWA 3KPLA 4I48A 4NWUL 4ZS7H 2Y7QB 3ZTNL 5CINL 3M8OL 4LVOC 1TENA 4CMHC 4X7DC 1HYSD 2R2HB 4L29B 3BD3A 2OK0L 5JORA 3OKMB 4P23A 4WDIA 1S3KL 1JPSH 1YEIH 2NZIA 1UCBH 4MLSA 5E1HB 3WDJA 5TE7L 1WZMA 4CW1A 4NQCE 1ND0A 1YEDA 1UJ3C 1J05A 1ONQA 2IBBA 2C1OB 2X7LB 1ZT4A 2Q20A 1UKQA 5L7XH 2AJVL 4WVRA 3T0ED 1IAOA 5DRXB 3CLEL 1T20B 4LASL 5HPOA 4LKCA 4NKOB 3KYMA 4JHAH 1BP3B 3LRHA 5L8JB 1QSFB 5JXEC 4X5WA 1MPAL 1I4FB 5DO2C 2VXVH 1OSZA 4IDJH 5E6IC 4QRQB 4OKDA 4M1CC 4UTBL 1MNUL 3ARPA 3EJZD 3WHXA 1BVLA 4FQJH 1Q72L 4X5XB 4GRLC 5DMIH 2VL5B 4ZS6C 1F3JA 1I8KA 5KW9L 4WU5A 1MUJA 1OAZH 1LEIB 2GTZB 5I1JL 4JPKL 1RJZB 1AXSA 4JM2D 1BGXH 1G84A 1UCTA 3SQOH 2JCCB 1M05B 5J7CC 3VG0H 2PN5A 4PB9L 4CL7A 3AB0C 2QKIA 3D48R 1GSMA 1PGRB 2UWEB 4R2GB 3PQYB 3U0TB 2J12B 2R2BB 4MCZB 2AV7B 3ULVD 1BBDH 4KVCH 4ELMF 2A6KA 3F65A 4WGVB 2NYYC 4DTGH 5KSAA 5EZJA 5CLWA 3SDCC 5F7KC 4IIQB 3JZ7A 1GL4B 4WY7L 4ZQKB 4Q6IB 2YD6A 2AJVH 4OSUH 3UTZB 5JIPA 4GRLA 4R90H 3WL9B 2D31B 4GMSL 3U4EB 3V2AR 1RURL 2R8SH 4OZGB 3EJJX 3SDDC 3NBNA 1ZHBB 1X5ZA 1SEBB 3LEYH 1G0DA 2NXYD 5EU3A 4MAYB 4JY5L 1FSKB 4TNVK 4E41B 5BZWB 5I8EA 3DI3B 4JFEA 1S9XB 4NC2B 5E4IA 2YMXL 3O6MH 1TQBC 5FUZL 3RZCC 3ZMRA 4CGTA 1FFPA 3L7EB 1HINL 4TOYH 3TGXA 2DLGA 3NCCB 5FAAA 2Z8VC 4I0PB 4UT7L 1BZ9A 5DO2D 4WW2A 2AJ3A 4JFHE 4H8WL 5KSVB 1X5LA 4PJ8C 5BZDA 4EXPX 1B9ZA 1M1SA 4FTVB 5GPRA 1U2HA 4HUUB 4LSSH 3BN3B 1G6VK 1TPXC 2W0FA 2WZPD 3U46A 1JYNA 3RNKB 3JTSB 4JAMA 4MJ5B 5BS0A 2BJML 4HS6B 4Z7UA 5DFVC 5KANG 2P5EE 3ZDXF 5D8JL 1ZTXH 4HMCA 4XT1C 1CD8A 5ICZB 4ODVL 2DLHA 3IXAA 3PF2A 4W68A 4MDJA 4NQCA 4KDWA 3MOBL 1GGBL 2UVFA 4GFTB 5C0BB 3U4BL 2ED7A 4NOBA 3MV9D 3DECA 3U1SH 5DMKB 2ZSVA 3JWOL 1NC2D 5I8KL 5TGBB 3GB7B 1ZXQA 3C6SA 3ZKXC 2Y4SA 1IGYA 3G5XA 4AZ8A 3LH2L 1N8ZB 3QQ9D 1WTGT 2WBJD 1G7PA 1AGCA 5EO9A 4YHYC 2MWCA 4O00A 3RWIA 4RFOH 3QISA 3BP5B 2Q6WA 2L4OA 3S34H 3LRGA 3SDYH 1CFBA 3WFHA 1N3NA 2XWTA 1E4WL 3BQUD 4MJ6B 4B50A 2ATKB 4D9LH 2BSTB 2GK0A 4LSPL 1NKRA 1S9VA 2C7UB 3O2DH 4N9GA 3JUZA 5DYOA 4TNVF 3V7MA 3ULSA 5FM8A 4Y16D 3KPNA 3BYYA 4S2SB 3PWPD 1J88A 4FN0A 1FO0L 5I1IH 3H6JA 3NAAH 3EOYG 1ZEAH 2V9RA 5D1ZB 3MSPA 3LQZB 2DM7A 3WKML 2BOBA 3DUSB 1JTOA 4X7SH 3AY4A 4PREB 1G7HB 1RK1B 3D25B 4HG4J 2XQYG 1SVZA 2YC1B 2XICA 4P23B 5DJDB 3PJSA 4WDIB 2CMRL 3DMMC 1KIPB 2O5YL 2FJFB 2B8OT 3LB6D 2AI0H 3KPSD 5E5MB 1A14H 1LEKA 4X6FA 5FYKL 4U6HA 4P3CL 5L2KE 4KK5C 4CW1B 4DVRL 4OCRH 5EUOE 4NQEE 5I1DB 3L3KB 4KRPC 1RU9H 4PJCA 1JNNH 2LQRA 4LLDA 2HKHH 3KLHD 5DJXA 2MHAB 4HLJA 4RMTA 5JXED 2F9BT 3MLVL 2EYSA 4NZUL 3PWVB 4A2LA 1A2YA 4ELMA 1ZHLA 2DQDL 4BZ2H 1Q38A 3UROR 1DL7L 4P46C 4Q9RL 3OKYA 3VXTB 4LCCC 1ETZB 3PABB 3VH8A 5M95B 3OR7A 2YWZA 3KDMA 4LRNH 3QWRA 5GGRY 3IT8D 3WO4C 1J8HE 4R4BB 5K33A 1IGFH 2X4NA 1FN4A 3FFCB 4YDVB 5BRZA 3MRDA 3QHFH 1AP2A 2Q76A 3T65B 1DZBA 3IXTA 2Y5TB 2NY5H 4JM4L 5IMKA 1ZA6B 1TVHB 4PLJD 3IAGC 3RVWD 3DVGB 5I0DA 1F3DJ 4YHNB 5EOTB 3FQXA 3H3PL 4RMVA 3IU3A 2HVJB 3BGAA 1Z5LB 3GKZA 3CLFL 4L4VB 4FXGB 2GJ6B 3B3IB 4XAKE 4LPUA 2ZUTA 3EO0B 4ODHL 1KCSL 1UWXH 4R26L 2QHRL 5I1KL 3I6KB 4XCFH 4G43A 2I07B 4N5ED 5D2NB 3BPOC 2DBLL 5J6GA 3IDGB 4CU8A 4I3SH 5BQ7B 4U1MB 4RGOL 1IAMA 1NGXA 5KSAB 3D0LA 5C6PB 1T1ZB 1HQRA 3ZT7A 4KQ3H 1U3HB 4HJGB 3QEQA 1I3GL 3MQIA 2CGRL 3Q0HA 3B9KB 4TVSa 4PJIE 4S1DD 3BI9X 5IW6B 2IH1A 5SX4I 1UG9A 25C8L 1DDHA 2DWEA 5T1KB 1PZ5A 4LLWA 4F37K 4KMTL 4LSPH 1HH6B 4ONGL 3KPLB 4I48B 1FLRL 1ZSDB 1R3IH 2FYYA 5HI3C 2HG5B 1AR1C 1CDUA 3WFEL 4MYWB 4POUB 4LLVA 1T66C 1PKQB 3DETD 4EI5D 2GHWB 5ITFB 1KCKA 2VRAA 2J5LC 4HH8A 1MCDA 1G7JB 3ZKMC 1MSPA 5LQBH 1FYTE 2UZYB 1IMHC 4E42A 4Z76A 1FAIL 3VXSB 5IJVB 4CN6A 2DYPB 2HKFH 2OBGA 1VEMA 3RU8L 3G04B 3AMLA 1R5VA 4QCIA 5DD6B 2RAMA 1ND0B 3VA2C 3HR5B 5EZLB 5FUCE 5C07A 3ALWA 3RIAF 3RWDA 3VFVA 1MJ7H 1R6VA 1PAMA 4Z7NE 5IBTH 3VXMD 1OP3K 4J4PA 2G9HB 1IC4L 2DF3A 3DRTB 3TBWB 4S0TD 5B38G 4JN1H 2YD5A 3ZE1E 3F7YB 5TQ0L 4RDQF 1NQBA 1ADQH 4XCEA 3MYJA 5EUKA 3QUKA 4U6TA 3V8OA 5F7UA 1Q0XH 3H7BB 1QFWI 3OKOB 2EE9A 1IM9B 3CLEH 3DGGA 1MWAA 3HZYA 5C0CE 4URTB 2HN7B 2QQLL 2DQDH 4HXAH 1HOCB 5KSAD 3TO4A 4BZ2L 5MP6L 5HHOA 3VH8G 5C07D 3VFMB 3LS4H 3RX5A 2XOTA 2YA2A 4LQFL 4FQHA 5T5FH 3KYAA 2FX7H 2NW2A 4YFLF 4KGLA 5B39G 1DQDL 4X80L 3U4AA 4XC3L 5IB1B 3T08A 5D7JC 5JHLH 4EBQH 4F7TB 2UYLB 2IG2L 4RGND 4KMLB 3P40A 1JZ7A 4MS8D 4PY8I 2GUOA 3BDBA 3MC0A 4M1GL 5DUBB 1YEGL 1BFVH 1IEHA 1U42A 4WWKD 1IFHL 2IPTL 3GFUA 2UWEA 2VQ1B 1OTUC 3CFDA 2APBA 4ZPVB 4OQ1A 3UTTD 4LLQB 1Y6MR 5FGCE 5CCKL 1N5AB 5K93A 1FFQA 1N0XH 3D6GA 4OFYD 4L3AA 2AW2A 4S2SA 1CL7I 4O51B 2FATL 3QCTL 1BJ1H 3OBAA 1MHPH 5EC2B 1FFOB 1DEDA 4FQ2H 5GHWL 4MD5A 2Q8AL 3UTZA 5IQ7H 1CFSA 4NJ9L 4U49A 4FQXB 3HUJB 1IGCL 4KJYB 2AJYL 2VXQH 1N5YL 1RMFL 3NGBB 1N59B 5LGJA 5GZNC 4NPYA 4O9HH 4XP4L 4JHWL 2QSCL 5FO7B 3GIVA 5LBSL 2BSRB 4RRPA 1S9XA 2IQ9L 2J8UF 1A6VL 1KENH 4M5YL 5D8JH 3UC0H 4XGZB 4DGYH 5KJRL 4I0PD 4O2EA 1FFNB