2M38A

Ptb domain of aida1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
135
Chain Sequence
EKLIAQSCDYKAAYLGSMLIKELRGTESTQDACAKMRANCQKSTEQMKKVPTIILSVSAKGVKFIDATNKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNLAAEIILTLGQAFEVAYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin repeat and sterile alpha motif domain-containing pro
publication title Solution structure and peptide binding of the PTB domain from the AIDA1 postsynaptic signaling scaffolding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 31
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2013-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2m38A00
2ADZA 1WJ1A 2Z0PA 1WVHA 2L2IA 4IOYX 1DYNA 3TVVA 1UNPA 3SO6A 2ROZB 1MIZB 4GN1A 5DHFB 3PG7A 1DBHA 4PNKA 4IAPA 2UZRA 3QIJA 3SNHA 1TXDA 3N7CA 3ULCA 4KHAA 2Y8FA 1DROA 4A6FB 4KVGB 1MAIA 5FI1A 1Z87A 1X05A 1FGZA 2CY5A 3WA0A 3ZVRA 2DKPA 3MPXA 3OANA 2LULA 5D27A 2YS5A 3QWMA 3VOQA 5D3VA 1P6SA 2D9WA 4YL8A 4GMVA 5FI0A 3AU5A 1SHCA 4EKUA 2Q13A 2DYNA 1FHOA 2RVBB 1TJ6A 2RSGA 4HAZB 3ML4A 4YONA 2YSZA 1KI1B 2W2XD 3AU4A 3DXDA 4GXBA 2DHIA 2J59M 1M7EA 3G9WA 4CYEA 3CIKA 5LONB 1W1DA 1NTVA 4IFSA 2EC1A 1Y19B 1BAKA 1TQZA 1K5DB 2R0DA 5HE1A 1FGYA 2VKIA 2D9YA 5CLQB 1U5FA 1MKEA 4HB3B 1KZ7A 5KCVA 4ZRJA 4HDOA 4P7IA 4HAYB 2Z0QA 2FJLA 1P3RA 2X18A 2ROVA 2I1KA 4PQ0A 2GS0A 5J3TA 1GG3A 1RJ2A 2W2XC 3CXBB 5J3YA 4GZUA 1KZGA 2N0YA 1UPQA 1XR0B 4NY0A 2MDXA 4MY6A 5D3WA 3PVUA 4HAVB 3P7ZA 1UNQA 5DHAB 4WJ7A 1DDWA 4KHBB 4MT7A 1ZVRA 1FHXA 1H10A 3D8DA 1UEFA 1NU2A 4A6KA 5C16A 2CODA 2H7DA 4HDQA 2D2QA 3ODWA 3TO1A 1GC6A 1EVHA 1SGHA 2R09A 2K00A 3PEGA 2EMTA 3V5WA 3KSYA 4WVFB 4XWXA 1ZM0A 4BBKA 2RLOA 2CRFA 2V76A 5DIFB 2HE7A 5D3XA 3PZDA 2J0JA 2KGXB 2LOZA 3T06A 2G35A 3PP2A 3QBVB 4DBBA 2HTHB 3SYXA 2OTXA 5KQ1A 3NSUA 2NMBA 2LOXA 2COCA 2VSZA 5JP4A 5J3QA 3M1IB 2MFQA 1BTNA 4L6EA 1PLSA 2COFA 4DX8A 1AQCA 1N3HA 2DTCA 3LJUX 2IYBA 2DKQA 2DN6A 2P0FA 3BJIA 2DHJA 4B6HA 1WG7A 1NTYA 3ULBA 1I7AA 1MPHA 3KY9A 4KHOA 4F7GA 2UVMA 1PMSA 4Z2NA 1UPRA 2W2WA 3WYFB 5JLJB 2I5FA 1UNRA 1ZC4B 2DX1A 1XODA 2P0DA 4GMXB 4K17A 2CAYA 2YF0A 1I2HA 2QKLA 1W1HA 2GCLA 4HAUB 5JHHA 3UZTA 1OMWA 1GC7A 1U5GA 1QC6A 1OQNA 2D11A 3P6AA 3VIAA 4GPTB 1H4RA 1ZSQA 2DHKA 2YRYA 5C79A 3FM8C 4HATB 1V88A 2ZPYA 1U29A 3ODXA 2K2JA 4A6HA 1W1GA 1V5PA 3A8PA 2E2XA 4NSWA 1WGQA 1U5DA 4HB0B 4EMOA 1U5EA 2D10A 1WI1A 4F7HA 2DX5A 2AL6A 2K2UA 5D3YA 4D0NB 3F5RA 2N23A 1RRPB 1V61A 3U7DA 2ELBA 2RGNB 3RCPA 1XKEA 1E5WA 1XX0A 5C5BA 3ODOA 3SV1A 1EGXA 1V5UA 1ISNA 3A98B 2BCJA 1EAZA 1ZC3B 4K81A 3PVLA 1FAOA 3PVWA 3D8EA 4HB2B 2YT0A 2I5CA 5EFXA 2D9VA 4Y94A 2M14A 2COAA 2YS3A 4HAWB 4A6FA 3O96A 2I1JA 5DI9B 1MK9B 4H8SA 2GCJA 2KCJA 4HAXB 4HHVA 3FSSA 3SUZA 1P5TA 2GJYA 3DXEA 1XCGA 2LYDA 1XD4A 1WGUA 3GYOA 4TYZA 4EJNA 5KQ4A 3IVFA 2DFKA 1K5GB 5CLLB 5GOWB 2Y7BA 3HW2B 5C6RA 1OY2A 1FB8A 2JP2A 2P8VA 1U2BA 1MK7B 3FEHA 2KUPA 3AJ4A 2RNRB 5LOPB 2CY4A 2DLWA 2NZ8B 4CHMA 3KRWA 3ZDTA 4WSFA 1DDVA 1Y5OA 2DYQA 3TW1A 1M7RA 1PFJA 3A8QA 3HK0A 4ZRIA 1V89A 1B55A 2IFSA 2H7EA 2P0HA 4K2OA 5DH9B 1LW3A 2D9ZA 2D9XA 3KZ1A 5HE3A 1U27A 2VRWB 1X11A 1AWEA 4KAXB 1NI2A 3F0WA 3TCAA 3GYPA 2Z0OA 5HE0A 2PZ1A 2XQNM 3HQCA 4CHJA 2M38A 1QQGA 5HE2A 1WJMA 3MDBC 5JHGA 2LG1A 2AEHA 2Y8GA 3DXCA 2MWNB 3PSCA 1FHWA 2OQBA 3TFMA 2YT1A 4Z2MB 4F7UP 1MIXA 2RUKB 4HB4B 4A5KA 2D4QA 2J0MA 1J19A 1BTKA 1IRSA 1Q67A 2J0KA 2DA0A 4C0AA 4DX90 3KRXA 2YVCA 1X1GA 2L1CA 2MKRA 3BINA 4K2PA 2EMSA 2QKMA 1V5MA 1X1FA 2ELAA 4DXAB 2YS1A 4TKNA 4ZRKA 1LB1A 1DDMA 1EF1A 4MK0A 5L81A 1X86A 3D8FA 1FOEA 1BWNA 2LKOA 1J0WA 3X23A 5C5BB 3U8ZA 2UZSA 2EJ8A
chains in the Genus database with same CATH superfamily
2ADZA 1WJ1A 2Z0PA 1WVHA 2L2IA 4IOYX 1DYNA 3TVVA 2KUQA 1UNPA 3SO6A 2ROZB 1MIZB 4GN1A 5DHFB 3PG7A 1DBHA 4PNKA 4IAPA 2UZRA 3QIJA 3SNHA 1TXDA 3N7CA 3ULCA 4KHAA 2Y8FA 1DROA 4A6FB 4KVGB 1MAIA 5FI1A 1Z87A 1X05A 5M4YB 4GNKB 1FGZA 2CY5A 3WA0A 3ZVRA 2DKPA 3MPXA 3OANA 2LULA 5D27A 2K49A 2YS5A 3QWMA 3VOQA 5D3VA 1P6SA 2D9WA 1MI1A 4GMVA 4YL8A 5FI0A 3AU5A 1SHCA 4EKUA 2Q13A 2DYNA 1FHOA 2RVBB 1TJ6A 2RSGA 4HAZB 3ML4A 4YONA 2Z59A 2YSZA 1KI1B 2W2XD 3AU4A 3DXDA 4GXBA 2DHIA 2J59M 4OT1A 1M7EA 3G9WA 4CYEA 3CIKA 5LONB 1W1DA 2Z14A 1NTVA 4IFSA 2EC1A 1Y19B 1BAKA 1TQZA 1K5DB 2R0DA 5HE1A 2Z13A 1FGYA 2VKIA 2D9YA 5CLQB 1U5FA 1MKEA 4HB3B 1KZ7A 5KCVA 4ZRJA 4HDOA 4P7IA 4HAYB 2Z0QA 2FJLA 1P3RA 4DIXA 2X18A 2ROVA 2I1KA 4PQ0A 2GS0A 5J3TA 3DCXA 1GG3A 1RJ2A 2W2XC 3CXBB 5J3YA 4GZUA 1KZGA 2N0YA 1UPQA 1XR0B 2ZKMX 4NY0A 2MDXA 4MY6A 5D3WA 3PVUA 4HAVB 3P7ZA 1UNQA 5DHAB 4WJ7A 1DDWA 4KHBB 4MT7A 1ZVRA 1FHXA 1H10A 3D8DA 1UEFA 1NU2A 4A6KA 5C16A 2CODA 2H7DA 4HDQA 4QJ3B 5I2MA 2D2QA 3ODWA 3TO1A 1GC6A 1EVHA 1SGHA 2R09A 2K00A 3PEGA 2EMTA 3V5WA 5I2SA 3KSYA 4WVFB 4XWXA 1ZM0A 4BBKA 2RLOA 1ZYIA 2CRFA 2V76A 5DIFB 2HE7A 5D3XA 4CSQA 3PZDA 2J0JA 2KGXB 2LOZA 3T06A 2G35A 3PP2A 3QBVB 4DBBA 2HTHB 3SYXA 2OTXA 5KQ1A 3NSUA 2NMBA 2LOXA 2COCA 2VSZA 5JP4A 5J3QA 3M1IB 2MFQA 1BTNA 4L6EA 1PLSA 3A58A 2COFA 4DX8A 1AQCA 1N3HA 2DTCA 3LJUX 2IYBA 2DKQA 2DN6A 2P0FA 3BJIA 2DHJA 4B6HA 1WG7A 1NTYA 3ULBA 1I7AA 1MPHA 3KY9A 4KHOA 4F7GA 2UVMA 1PMSA 4Z2NA 1UPRA 2W2WA 3WYFB 5JLJB 2I5FA 1UNRA 1ZC4B 2DX1A 1XODA 2P0DA 4GMXB 4K17A 3NWAA 2CAYA 2YF0A 1I2HA 2QKLA 1W1HA 2GCLA 3NWFA 4HAUB 5JHHA 3UZTA 1OMWA 1GC7A 1U5GA 3B77A 1QC6A 1OQNA 2D11A 3P6AA 2KIGA 3VIAA 4GPTB 1H4RA 1ZSQA 2DHKA 2YRYA 5C79A 3FM8C 4HATB 2Z4DA 4QJ4B 1V88A 2ZPYA 1U29A 3ODXA 2GUMA 2FJUB 2K2JA 4A6HA 3HSAA 1W1GA 1V5PA 3A8PA 2E2XA 4NSWA 1WGQA 1U5DA 4HB0B 4EMOA 4D6WA 1U5EA 2D10A 1WI1A 4F7HA 2DX5A 2AL6A 2K2UA 5D3YA 4D0NB 3F5RA 2N23A 1RRPB 3NWDA 1V61A 3U7DA 2ELBA 2RGNB 3RCPA 2KR0A 1XKEA 1E5WA 1XX0A 5C5BA 2R2YA 3ODOA 3SV1A 1EGXA 1V5UA 1ISNA 3A98B 2BCJA 1EAZA 1ZC3B 4K81A 3PVLA 1FAOA 3PVWA 4GOUA 3D8EA 4HB2B 2YT0A 2I5CA 5EFXA 2D9VA 4Y94A 2M14A 2COAA 2YS3A 4HAWB 4A6FA 3O96A 2I1JA 5DI9B 1MK9B 4H8SA 2GCJA 2KCJA 4HAXB 3OHMB 4HHVA 3FSSA 3SUZA 1P5TA 2GJYA 3DXEA 4QXAB 1XCGA 2LYDA 1XD4A 5LG4B 1WGUA 3GYOA 4TYZA 4EJNA 3HIEA 5KQ4A 3IVFA 2DFKA 2K8EA 1K5GB 5CLLB 5GOWB 2Y7BA 3HW2B 5C6RA 1OY2A 1FB8A 2JP2A 2P8VA 2RRFA 1U2BA 1MK7B 3FEHA 2KUPA 3AJ4A 2RNRB 5LOPB 2CY4A 2DLWA 2NZ8B 4CHMA 3KRWA 3ZDTA 4WSFA 1DDVA 1Y5OA 2DYQA 3TW1A 1M7RA 1PFJA 3A8QA 3HK0A 4ZRIA 4QJ5B 1V89A 1B55A 2IFSA 2H7EA 2P0HA 4K2OA 5DH9B 1LW3A 2D9ZA 2D9XA 3KZ1A 2NBVA 5HE3A 1U27A 2VRWB 1X11A 1AWEA 4KAXB 5IRSA 1NI2A 3F0WA 3TCAA 3GYPA 2Z0OA 5HE0A 2PZ1A 2XQNM 3HQCA 4CHJA 2M38A 1QQGA 5HE2A 1WJMA 1T77A 3MDBC 5JHGA 2LG1A 2AEHA 2Y8GA 3DXCA 3U12A 2MWNB 3PSCA 1FHWA 2OQBA 3TFMA 2YT1A 4Z2MB 4F7UP 1MIXA 2RUKB 4HB4B 2YT2A 4L1RA 4A5KA 2D4QA 2J0MA 1J19A 1BTKA 4OSNA 1IRSA 1Q67A 3NW8A 2J0KA 2DA0A 4C0AA 3FVCA 4DX90 2YVCA 3KRXA 1X1GA 2L1CA 2MKRA 3BINA 4K2PA 2EMSA 2QKMA 4KHBA 4HSIA 1V5MA 2KIEA 1X1FA 2ELAA 4DXAB 2YS1A 4TKNA 4ZRKA 1LB1A 1DDMA 1EF1A 4MK0A 5L81A 1X86A 3D8FA 1FOEA 1BWNA 2LKOA 1J0WA 3X23A 5C5BB 3U8ZA 2UZSA 2EJ8A
chains in the Genus database with same CATH topology
2ADZA 1WJ1A 2Z0PA 1WVHA 2L2IA 4IOYX 1DYNA 3TVVA 1UNPA 3SO6A 2ROZB 1MIZB 4GN1A 5DHFB 3PG7A 1DBHA 4PNKA 4IAPA 2UZRA 3QIJA 3SNHA 1TXDA 3N7CA 3ULCA 4KHAA 2Y8FA 1DROA 4A6FB 4KVGB 1MAIA 5FI1A 1Z87A 1X05A 1FGZA 2CY5A 3WA0A 3ZVRA 2DKPA 3MPXA 3OANA 2LULA 5D27A 2YS5A 3QWMA 3VOQA 5D3VA 1P6SA 2D9WA 4YL8A 4GMVA 5FI0A 3AU5A 1SHCA 4EKUA 2Q13A 2DYNA 1FHOA 2RVBB 1TJ6A 2RSGA 4HAZB 3ML4A 4YONA 2YSZA 1KI1B 2W2XD 3AU4A 3DXDA 4GXBA 2DHIA 2J59M 1M7EA 3G9WA 4CYEA 3CIKA 5LONB 1W1DA 1NTVA 4IFSA 2EC1A 1Y19B 1BAKA 1TQZA 1K5DB 2R0DA 5HE1A 1FGYA 2VKIA 2D9YA 5CLQB 1U5FA 1MKEA 4HB3B 1KZ7A 5KCVA 4ZRJA 4HDOA 4P7IA 4HAYB 2Z0QA 2FJLA 1P3RA 2X18A 2ROVA 2I1KA 4PQ0A 2GS0A 5J3TA 1GG3A 1RJ2A 2W2XC 3CXBB 5J3YA 4GZUA 1KZGA 2N0YA 1UPQA 1XR0B 4NY0A 2MDXA 4MY6A 5D3WA 3PVUA 4HAVB 3P7ZA 1UNQA 5DHAB 4WJ7A 1DDWA 4KHBB 4MT7A 1ZVRA 1FHXA 1H10A 3D8DA 1UEFA 1NU2A 4A6KA 5C16A 2CODA 2H7DA 4HDQA 2D2QA 3ODWA 3TO1A 1GC6A 1EVHA 1SGHA 2R09A 2K00A 3PEGA 2EMTA 3V5WA 3KSYA 4WVFB 4XWXA 1ZM0A 4BBKA 2RLOA 2CRFA 2V76A 5DIFB 2HE7A 5D3XA 3PZDA 2J0JA 2KGXB 2LOZA 3T06A 2G35A 3PP2A 3QBVB 4DBBA 2HTHB 3SYXA 2OTXA 5KQ1A 3NSUA 2NMBA 2LOXA 2COCA 2VSZA 5JP4A 5J3QA 3M1IB 2MFQA 1BTNA 4L6EA 1PLSA 2COFA 4DX8A 1AQCA 1N3HA 2DTCA 3LJUX 2IYBA 2DKQA 2DN6A 2P0FA 3BJIA 2DHJA 4B6HA 1WG7A 1NTYA 3ULBA 1I7AA 1MPHA 3KY9A 4KHOA 4F7GA 2UVMA 1PMSA 4Z2NA 1UPRA 2W2WA 3WYFB 5JLJB 2I5FA 1UNRA 1ZC4B 2DX1A 1XODA 2P0DA 4GMXB 4K17A 2CAYA 2YF0A 1I2HA 2QKLA 1W1HA 2GCLA 4HAUB 5JHHA 3UZTA 1OMWA 1GC7A 1U5GA 1QC6A 1OQNA 2D11A 3P6AA 3VIAA 4GPTB 1H4RA 1ZSQA 2DHKA 2YRYA 5C79A 3FM8C 4HATB 1V88A 2ZPYA 1U29A 3ODXA 2K2JA 4A6HA 1W1GA 1V5PA 3A8PA 2E2XA 4NSWA 1WGQA 1U5DA 4HB0B 4EMOA 1U5EA 2D10A 1WI1A 4F7HA 2DX5A 2AL6A 2K2UA 5D3YA 4D0NB 3F5RA 2N23A 1RRPB 1V61A 3U7DA 2ELBA 2RGNB 3RCPA 1XKEA 1E5WA 1XX0A 5C5BA 3ODOA 3SV1A 1EGXA 1V5UA 1ISNA 3A98B 2BCJA 1EAZA 1ZC3B 4K81A 3PVLA 1FAOA 3PVWA 3D8EA 4HB2B 2YT0A 2I5CA 5EFXA 2D9VA 4Y94A 2M14A 2COAA 2YS3A 4HAWB 4A6FA 3O96A 2I1JA 5DI9B 1MK9B 4H8SA 2GCJA 2KCJA 4HAXB 4HHVA 3FSSA 3SUZA 1P5TA 2GJYA 3DXEA 1XCGA 2LYDA 1XD4A 1WGUA 3GYOA 4TYZA 4EJNA 5KQ4A 3IVFA 2DFKA 1K5GB 5CLLB 5GOWB 2Y7BA 3HW2B 5C6RA 1OY2A 1FB8A 2JP2A 2P8VA 1U2BA 1MK7B 3FEHA 2KUPA 3AJ4A 2RNRB 5LOPB 2CY4A 2DLWA 2NZ8B 4CHMA 3KRWA 3ZDTA 4WSFA 1DDVA 1Y5OA 2DYQA 3TW1A 1M7RA 1PFJA 3A8QA 3HK0A 4ZRIA 1V89A 1B55A 2IFSA 2H7EA 2P0HA 4K2OA 5DH9B 1LW3A 2D9ZA 2D9XA 3KZ1A 5HE3A 1U27A 2VRWB 1X11A 1AWEA 4KAXB 1NI2A 3F0WA 3TCAA 3GYPA 2Z0OA 5HE0A 2PZ1A 2XQNM 3HQCA 4CHJA 2M38A 1QQGA 5HE2A 1WJMA 3MDBC 5JHGA 2LG1A 2AEHA 2Y8GA 3DXCA 2MWNB 3PSCA 1FHWA 2OQBA 3TFMA 2YT1A 4Z2MB 4F7UP 1MIXA 2RUKB 4HB4B 4A5KA 2D4QA 2J0MA 1J19A 1BTKA 1IRSA 1Q67A 2J0KA 2DA0A 4C0AA 4DX90 3KRXA 2YVCA 1X1GA 2L1CA 2MKRA 3BINA 4K2PA 2EMSA 2QKMA 1V5MA 1X1FA 2ELAA 4DXAB 2YS1A 4TKNA 4ZRKA 1LB1A 1DDMA 1EF1A 4MK0A 5L81A 1X86A 3D8FA 1FOEA 1BWNA 2LKOA 1J0WA 3X23A 5C5BB 3U8ZA 2UZSA 2EJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADZ A;  1WJ1 A;  2Z0P A;  1WVH A;  2L2I A;  4IOY X;  1DYN A;  3TVV A;  1UNP A;  3SO6 A;  2ROZ B;  1MIZ B;  4GN1 A;  5DHF B;  3PG7 A;  1DBH A;  4PNK A;  4IAP A;  2UZR A;  3QIJ A;  3SNH A;  1TXD A;  3N7C A;  3ULC A;  4KHA A;  2Y8F A;  1DRO A;  4A6F B;  4KVG B;  1MAI A;  5FI1 A;  1Z87 A;  1X05 A;  1FGZ A;  2CY5 A;  3WA0 A;  3ZVR A;  2DKP A;  3MPX A;  3OAN A;  2LUL A;  5D27 A;  2YS5 A;  3QWM A;  3VOQ A;  5D3V A;  1P6S A;  2D9W A;  4YL8 A;  4GMV A;  5FI0 A;  3AU5 A;  1SHC A;  4EKU A;  2Q13 A;  2DYN A;  1FHO A;  2RVB B;  1TJ6 A;  2RSG A;  4HAZ B;  3ML4 A;  4YON A;  2YSZ A;  1KI1 B;  2W2X D;  3AU4 A;  3DXD A;  4GXB A;  2DHI A;  2J59 M;  1M7E A;  3G9W A;  4CYE A;  3CIK A;  5LON B;  1W1D A;  1NTV A;  4IFS A;  2EC1 A;  1Y19 B;  1BAK A;  1TQZ A;  1K5D B;  2R0D A;  5HE1 A;  1FGY A;  2VKI A;  2D9Y A;  5CLQ B;  1U5F A;  1MKE A;  4HB3 B;  1KZ7 A;  5KCV A;  4ZRJ A;  4HDO A;  4P7I A;  4HAY B;  2Z0Q A;  2FJL A;  1P3R A;  2X18 A;  2ROV A;  2I1K A;  4PQ0 A;  2GS0 A;  5J3T A;  1GG3 A;  1RJ2 A;  2W2X C;  3CXB B;  5J3Y A;  4GZU A;  1KZG A;  2N0Y A;  1UPQ A;  1XR0 B;  4NY0 A;  2MDX A;  4MY6 A;  5D3W A;  3PVU A;  4HAV B;  3P7Z A;  1UNQ A;  5DHA B;  4WJ7 A;  1DDW A;  4KHB B;  4MT7 A;  1ZVR A;  1FHX A;  1H10 A;  3D8D A;  1UEF A;  1NU2 A;  4A6K A;  5C16 A;  2COD A;  2H7D A;  4HDQ A;  2D2Q A;  3ODW A;  3TO1 A;  1GC6 A;  1EVH A;  1SGH A;  2R09 A;  2K00 A;  3PEG A;  2EMT A;  3V5W A;  3KSY A;  4WVF B;  4XWX A;  1ZM0 A;  4BBK A;  2RLO A;  2CRF A;  2V76 A;  5DIF B;  2HE7 A;  5D3X A;  3PZD A;  2J0J A;  2KGX B;  2LOZ A;  3T06 A;  2G35 A;  3PP2 A;  3QBV B;  4DBB A;  2HTH B;  3SYX A;  2OTX A;  5KQ1 A;  3NSU A;  2NMB A;  2LOX A;  2COC A;  2VSZ A;  5JP4 A;  5J3Q A;  3M1I B;  2MFQ A;  1BTN A;  4L6E A;  1PLS A;  2COF A;  4DX8 A;  1AQC A;  1N3H A;  2DTC A;  3LJU X;  2IYB A;  2DKQ A;  2DN6 A;  2P0F A;  3BJI A;  2DHJ A;  4B6H A;  1WG7 A;  1NTY A;  3ULB A;  1I7A A;  1MPH A;  3KY9 A;  4KHO A;  4F7G A;  2UVM A;  1PMS A;  4Z2N A;  1UPR A;  2W2W A;  3WYF B;  5JLJ B;  2I5F A;  1UNR A;  1ZC4 B;  2DX1 A;  1XOD A;  2P0D A;  4GMX B;  4K17 A;  2CAY A;  2YF0 A;  1I2H A;  2QKL A;  1W1H A;  2GCL A;  4HAU B;  5JHH A;  3UZT A;  1OMW A;  1GC7 A;  1U5G A;  1QC6 A;  1OQN A;  2D11 A;  3P6A A;  3VIA A;  4GPT B;  1H4R A;  1ZSQ A;  2DHK A;  2YRY A;  5C79 A;  3FM8 C;  4HAT B;  1V88 A;  2ZPY A;  1U29 A;  3ODX A;  2K2J A;  4A6H A;  1W1G A;  1V5P A;  3A8P A;  2E2X A;  4NSW A;  1WGQ A;  1U5D A;  4HB0 B;  4EMO A;  1U5E A;  2D10 A;  1WI1 A;  4F7H A;  2DX5 A;  2AL6 A;  2K2U A;  5D3Y A;  4D0N B;  3F5R A;  2N23 A;  1RRP B;  1V61 A;  3U7D A;  2ELB A;  2RGN B;  3RCP A;  1XKE A;  1E5W A;  1XX0 A;  5C5B A;  3ODO A;  3SV1 A;  1EGX A;  1V5U A;  1ISN A;  3A98 B;  2BCJ A;  1EAZ A;  1ZC3 B;  4K81 A;  3PVL A;  1FAO A;  3PVW A;  3D8E A;  4HB2 B;  2YT0 A;  2I5C A;  5EFX A;  2D9V A;  4Y94 A;  2M14 A;  2COA A;  2YS3 A;  4HAW B;  4A6F A;  3O96 A;  2I1J A;  5DI9 B;  1MK9 B;  4H8S A;  2GCJ A;  2KCJ A;  4HAX B;  4HHV A;  3FSS A;  3SUZ A;  1P5T A;  2GJY A;  3DXE A;  1XCG A;  2LYD A;  1XD4 A;  1WGU A;  3GYO A;  4TYZ A;  4EJN A;  5KQ4 A;  3IVF A;  2DFK A;  1K5G B;  5CLL B;  5GOW B;  2Y7B A;  3HW2 B;  5C6R A;  1OY2 A;  1FB8 A;  2JP2 A;  2P8V A;  1U2B A;  1MK7 B;  3FEH A;  2KUP A;  3AJ4 A;  2RNR B;  5LOP B;  2CY4 A;  2DLW A;  2NZ8 B;  4CHM A;  3KRW A;  3ZDT A;  4WSF A;  1DDV A;  1Y5O A;  2DYQ A;  3TW1 A;  1M7R A;  1PFJ A;  3A8Q A;  3HK0 A;  4ZRI A;  1V89 A;  1B55 A;  2IFS A;  2H7E A;  2P0H A;  4K2O A;  5DH9 B;  1LW3 A;  2D9Z A;  2D9X A;  3KZ1 A;  5HE3 A;  1U27 A;  2VRW B;  1X11 A;  1AWE A;  4KAX B;  1NI2 A;  3F0W A;  3TCA A;  3GYP A;  2Z0O A;  5HE0 A;  2PZ1 A;  2XQN M;  3HQC A;  4CHJ A;  2M38 A;  1QQG A;  5HE2 A;  1WJM A;  3MDB C;  5JHG A;  2LG1 A;  2AEH A;  2Y8G A;  3DXC A;  2MWN B;  3PSC A;  1FHW A;  2OQB A;  3TFM A;  2YT1 A;  4Z2M B;  4F7U P;  1MIX A;  2RUK B;  4HB4 B;  4A5K A;  2D4Q A;  2J0M A;  1J19 A;  1BTK A;  1IRS A;  1Q67 A;  2J0K A;  2DA0 A;  4C0A A;  4DX9 0;  3KRX A;  2YVC A;  1X1G A;  2L1C A;  2MKR A;  3BIN A;  4K2P A;  2EMS A;  2QKM A;  1V5M A;  1X1F A;  2ELA A;  4DXA B;  2YS1 A;  4TKN A;  4ZRK A;  1LB1 A;  1DDM A;  1EF1 A;  4MK0 A;  5L81 A;  1X86 A;  3D8F A;  1FOE A;  1BWN A;  2LKO A;  1J0W A;  3X23 A;  5C5B B;  3U8Z A;  2UZS A;  2EJ8 A; 
#chains in the Genus database with same CATH topology
 2ADZ A;  1WJ1 A;  2Z0P A;  1WVH A;  2L2I A;  4IOY X;  1DYN A;  3TVV A;  2KUQ A;  1UNP A;  3SO6 A;  2ROZ B;  1MIZ B;  4GN1 A;  5DHF B;  3PG7 A;  1DBH A;  4PNK A;  4IAP A;  2UZR A;  3QIJ A;  3SNH A;  1TXD A;  3N7C A;  3ULC A;  4KHA A;  2Y8F A;  1DRO A;  4A6F B;  4KVG B;  1MAI A;  5FI1 A;  1Z87 A;  1X05 A;  5M4Y B;  4GNK B;  1FGZ A;  2CY5 A;  3WA0 A;  3ZVR A;  2DKP A;  3MPX A;  3OAN A;  2LUL A;  5D27 A;  2K49 A;  2YS5 A;  3QWM A;  3VOQ A;  5D3V A;  1P6S A;  2D9W A;  1MI1 A;  4GMV A;  4YL8 A;  5FI0 A;  3AU5 A;  1SHC A;  4EKU A;  2Q13 A;  2DYN A;  1FHO A;  2RVB B;  1TJ6 A;  2RSG A;  4HAZ B;  3ML4 A;  4YON A;  2Z59 A;  2YSZ A;  1KI1 B;  2W2X D;  3AU4 A;  3DXD A;  4GXB A;  2DHI A;  2J59 M;  4OT1 A;  1M7E A;  3G9W A;  4CYE A;  3CIK A;  5LON B;  1W1D A;  2Z14 A;  1NTV A;  4IFS A;  2EC1 A;  1Y19 B;  1BAK A;  1TQZ A;  1K5D B;  2R0D A;  5HE1 A;  2Z13 A;  1FGY A;  2VKI A;  2D9Y A;  5CLQ B;  1U5F A;  1MKE A;  4HB3 B;  1KZ7 A;  5KCV A;  4ZRJ A;  4HDO A;  4P7I A;  4HAY B;  2Z0Q A;  2FJL A;  1P3R A;  4DIX A;  2X18 A;  2ROV A;  2I1K A;  4PQ0 A;  2GS0 A;  5J3T A;  3DCX A;  1GG3 A;  1RJ2 A;  2W2X C;  3CXB B;  5J3Y A;  4GZU A;  1KZG A;  2N0Y A;  1UPQ A;  1XR0 B;  2ZKM X;  4NY0 A;  2MDX A;  4MY6 A;  5D3W A;  3PVU A;  4HAV B;  3P7Z A;  1UNQ A;  5DHA B;  4WJ7 A;  1DDW A;  4KHB B;  4MT7 A;  1ZVR A;  1FHX A;  1H10 A;  3D8D A;  1UEF A;  1NU2 A;  4A6K A;  5C16 A;  2COD A;  2H7D A;  4HDQ A;  4QJ3 B;  5I2M A;  2D2Q A;  3ODW A;  3TO1 A;  1GC6 A;  1EVH A;  1SGH A;  2R09 A;  2K00 A;  3PEG A;  2EMT A;  3V5W A;  5I2S A;  3KSY A;  4WVF B;  4XWX A;  1ZM0 A;  4BBK A;  2RLO A;  1ZYI A;  2CRF A;  2V76 A;  5DIF B;  2HE7 A;  5D3X A;  4CSQ A;  3PZD A;  2J0J A;  2KGX B;  2LOZ A;  3T06 A;  2G35 A;  3PP2 A;  3QBV B;  4DBB A;  2HTH B;  3SYX A;  2OTX A;  5KQ1 A;  3NSU A;  2NMB A;  2LOX A;  2COC A;  2VSZ A;  5JP4 A;  5J3Q A;  3M1I B;  2MFQ A;  1BTN A;  4L6E A;  1PLS A;  3A58 A;  2COF A;  4DX8 A;  1AQC A;  1N3H A;  2DTC A;  3LJU X;  2IYB A;  2DKQ A;  2DN6 A;  2P0F A;  3BJI A;  2DHJ A;  4B6H A;  1WG7 A;  1NTY A;  3ULB A;  1I7A A;  1MPH A;  3KY9 A;  4KHO A;  4F7G A;  2UVM A;  1PMS A;  4Z2N A;  1UPR A;  2W2W A;  3WYF B;  5JLJ B;  2I5F A;  1UNR A;  1ZC4 B;  2DX1 A;  1XOD A;  2P0D A;  4GMX B;  4K17 A;  3NWA A;  2CAY A;  2YF0 A;  1I2H A;  2QKL A;  1W1H A;  2GCL A;  3NWF A;  4HAU B;  5JHH A;  3UZT A;  1OMW A;  1GC7 A;  1U5G A;  3B77 A;  1QC6 A;  1OQN A;  2D11 A;  3P6A A;  2KIG A;  3VIA A;  4GPT B;  1H4R A;  1ZSQ A;  2DHK A;  2YRY A;  5C79 A;  3FM8 C;  4HAT B;  2Z4D A;  4QJ4 B;  1V88 A;  2ZPY A;  1U29 A;  3ODX A;  2GUM A;  2FJU B;  2K2J A;  4A6H A;  3HSA A;  1W1G A;  1V5P A;  3A8P A;  2E2X A;  4NSW A;  1WGQ A;  1U5D A;  4HB0 B;  4EMO A;  4D6W A;  1U5E A;  2D10 A;  1WI1 A;  4F7H A;  2DX5 A;  2AL6 A;  2K2U A;  5D3Y A;  4D0N B;  3F5R A;  2N23 A;  1RRP B;  3NWD A;  1V61 A;  3U7D A;  2ELB A;  2RGN B;  3RCP A;  2KR0 A;  1XKE A;  1E5W A;  1XX0 A;  5C5B A;  2R2Y A;  3ODO A;  3SV1 A;  1EGX A;  1V5U A;  1ISN A;  3A98 B;  2BCJ A;  1EAZ A;  1ZC3 B;  4K81 A;  3PVL A;  1FAO A;  3PVW A;  4GOU A;  3D8E A;  4HB2 B;  2YT0 A;  2I5C A;  5EFX A;  2D9V A;  4Y94 A;  2M14 A;  2COA A;  2YS3 A;  4HAW B;  4A6F A;  3O96 A;  2I1J A;  5DI9 B;  1MK9 B;  4H8S A;  2GCJ A;  2KCJ A;  4HAX B;  3OHM B;  4HHV A;  3FSS A;  3SUZ A;  1P5T A;  2GJY A;  3DXE A;  4QXA B;  1XCG A;  2LYD A;  1XD4 A;  5LG4 B;  1WGU A;  3GYO A;  4TYZ A;  4EJN A;  3HIE A;  5KQ4 A;  3IVF A;  2DFK A;  2K8E A;  1K5G B;  5CLL B;  5GOW B;  2Y7B A;  3HW2 B;  5C6R A;  1OY2 A;  1FB8 A;  2JP2 A;  2P8V A;  2RRF A;  1U2B A;  1MK7 B;  3FEH A;  2KUP A;  3AJ4 A;  2RNR B;  5LOP B;  2CY4 A;  2DLW A;  2NZ8 B;  4CHM A;  3KRW A;  3ZDT A;  4WSF A;  1DDV A;  1Y5O A;  2DYQ A;  3TW1 A;  1M7R A;  1PFJ A;  3A8Q A;  3HK0 A;  4ZRI A;  4QJ5 B;  1V89 A;  1B55 A;  2IFS A;  2H7E A;  2P0H A;  4K2O A;  5DH9 B;  1LW3 A;  2D9Z A;  2D9X A;  3KZ1 A;  2NBV A;  5HE3 A;  1U27 A;  2VRW B;  1X11 A;  1AWE A;  4KAX B;  5IRS A;  1NI2 A;  3F0W A;  3TCA A;  3GYP A;  2Z0O A;  5HE0 A;  2PZ1 A;  2XQN M;  3HQC A;  4CHJ A;  2M38 A;  1QQG A;  5HE2 A;  1WJM A;  1T77 A;  3MDB C;  5JHG A;  2LG1 A;  2AEH A;  2Y8G A;  3DXC A;  3U12 A;  2MWN B;  3PSC A;  1FHW A;  2OQB A;  3TFM A;  2YT1 A;  4Z2M B;  4F7U P;  1MIX A;  2RUK B;  4HB4 B;  2YT2 A;  4L1R A;  4A5K A;  2D4Q A;  2J0M A;  1J19 A;  1BTK A;  4OSN A;  1IRS A;  1Q67 A;  3NW8 A;  2J0K A;  2DA0 A;  4C0A A;  3FVC A;  4DX9 0;  2YVC A;  3KRX A;  1X1G A;  2L1C A;  2MKR A;  3BIN A;  4K2P A;  2EMS A;  2QKM A;  4KHB A;  4HSI A;  1V5M A;  2KIE A;  1X1F A;  2ELA A;  4DXA B;  2YS1 A;  4TKN A;  4ZRK A;  1LB1 A;  1DDM A;  1EF1 A;  4MK0 A;  5L81 A;  1X86 A;  3D8F A;  1FOE A;  1BWN A;  2LKO A;  1J0W A;  3X23 A;  5C5B B;  3U8Z A;  2UZS A;  2EJ8 A; 
#chains in the Genus database with same CATH homology
 2ADZ A;  1WJ1 A;  2Z0P A;  1WVH A;  2L2I A;  4IOY X;  1DYN A;  3TVV A;  1UNP A;  3SO6 A;  2ROZ B;  1MIZ B;  4GN1 A;  5DHF B;  3PG7 A;  1DBH A;  4PNK A;  4IAP A;  2UZR A;  3QIJ A;  3SNH A;  1TXD A;  3N7C A;  3ULC A;  4KHA A;  2Y8F A;  1DRO A;  4A6F B;  4KVG B;  1MAI A;  5FI1 A;  1Z87 A;  1X05 A;  1FGZ A;  2CY5 A;  3WA0 A;  3ZVR A;  2DKP A;  3MPX A;  3OAN A;  2LUL A;  5D27 A;  2YS5 A;  3QWM A;  3VOQ A;  5D3V A;  1P6S A;  2D9W A;  4YL8 A;  4GMV A;  5FI0 A;  3AU5 A;  1SHC A;  4EKU A;  2Q13 A;  2DYN A;  1FHO A;  2RVB B;  1TJ6 A;  2RSG A;  4HAZ B;  3ML4 A;  4YON A;  2YSZ A;  1KI1 B;  2W2X D;  3AU4 A;  3DXD A;  4GXB A;  2DHI A;  2J59 M;  1M7E A;  3G9W A;  4CYE A;  3CIK A;  5LON B;  1W1D A;  1NTV A;  4IFS A;  2EC1 A;  1Y19 B;  1BAK A;  1TQZ A;  1K5D B;  2R0D A;  5HE1 A;  1FGY A;  2VKI A;  2D9Y A;  5CLQ B;  1U5F A;  1MKE A;  4HB3 B;  1KZ7 A;  5KCV A;  4ZRJ A;  4HDO A;  4P7I A;  4HAY B;  2Z0Q A;  2FJL A;  1P3R A;  2X18 A;  2ROV A;  2I1K A;  4PQ0 A;  2GS0 A;  5J3T A;  1GG3 A;  1RJ2 A;  2W2X C;  3CXB B;  5J3Y A;  4GZU A;  1KZG A;  2N0Y A;  1UPQ A;  1XR0 B;  4NY0 A;  2MDX A;  4MY6 A;  5D3W A;  3PVU A;  4HAV B;  3P7Z A;  1UNQ A;  5DHA B;  4WJ7 A;  1DDW A;  4KHB B;  4MT7 A;  1ZVR A;  1FHX A;  1H10 A;  3D8D A;  1UEF A;  1NU2 A;  4A6K A;  5C16 A;  2COD A;  2H7D A;  4HDQ A;  2D2Q A;  3ODW A;  3TO1 A;  1GC6 A;  1EVH A;  1SGH A;  2R09 A;  2K00 A;  3PEG A;  2EMT A;  3V5W A;  3KSY A;  4WVF B;  4XWX A;  1ZM0 A;  4BBK A;  2RLO A;  2CRF A;  2V76 A;  5DIF B;  2HE7 A;  5D3X A;  3PZD A;  2J0J A;  2KGX B;  2LOZ A;  3T06 A;  2G35 A;  3PP2 A;  3QBV B;  4DBB A;  2HTH B;  3SYX A;  2OTX A;  5KQ1 A;  3NSU A;  2NMB A;  2LOX A;  2COC A;  2VSZ A;  5JP4 A;  5J3Q A;  3M1I B;  2MFQ A;  1BTN A;  4L6E A;  1PLS A;  2COF A;  4DX8 A;  1AQC A;  1N3H A;  2DTC A;  3LJU X;  2IYB A;  2DKQ A;  2DN6 A;  2P0F A;  3BJI A;  2DHJ A;  4B6H A;  1WG7 A;  1NTY A;  3ULB A;  1I7A A;  1MPH A;  3KY9 A;  4KHO A;  4F7G A;  2UVM A;  1PMS A;  4Z2N A;  1UPR A;  2W2W A;  3WYF B;  5JLJ B;  2I5F A;  1UNR A;  1ZC4 B;  2DX1 A;  1XOD A;  2P0D A;  4GMX B;  4K17 A;  2CAY A;  2YF0 A;  1I2H A;  2QKL A;  1W1H A;  2GCL A;  4HAU B;  5JHH A;  3UZT A;  1OMW A;  1GC7 A;  1U5G A;  1QC6 A;  1OQN A;  2D11 A;  3P6A A;  3VIA A;  4GPT B;  1H4R A;  1ZSQ A;  2DHK A;  2YRY A;  5C79 A;  3FM8 C;  4HAT B;  1V88 A;  2ZPY A;  1U29 A;  3ODX A;  2K2J A;  4A6H A;  1W1G A;  1V5P A;  3A8P A;  2E2X A;  4NSW A;  1WGQ A;  1U5D A;  4HB0 B;  4EMO A;  1U5E A;  2D10 A;  1WI1 A;  4F7H A;  2DX5 A;  2AL6 A;  2K2U A;  5D3Y A;  4D0N B;  3F5R A;  2N23 A;  1RRP B;  1V61 A;  3U7D A;  2ELB A;  2RGN B;  3RCP A;  1XKE A;  1E5W A;  1XX0 A;  5C5B A;  3ODO A;  3SV1 A;  1EGX A;  1V5U A;  1ISN A;  3A98 B;  2BCJ A;  1EAZ A;  1ZC3 B;  4K81 A;  3PVL A;  1FAO A;  3PVW A;  3D8E A;  4HB2 B;  2YT0 A;  2I5C A;  5EFX A;  2D9V A;  4Y94 A;  2M14 A;  2COA A;  2YS3 A;  4HAW B;  4A6F A;  3O96 A;  2I1J A;  5DI9 B;  1MK9 B;  4H8S A;  2GCJ A;  2KCJ A;  4HAX B;  4HHV A;  3FSS A;  3SUZ A;  1P5T A;  2GJY A;  3DXE A;  1XCG A;  2LYD A;  1XD4 A;  1WGU A;  3GYO A;  4TYZ A;  4EJN A;  5KQ4 A;  3IVF A;  2DFK A;  1K5G B;  5CLL B;  5GOW B;  2Y7B A;  3HW2 B;  5C6R A;  1OY2 A;  1FB8 A;  2JP2 A;  2P8V A;  1U2B A;  1MK7 B;  3FEH A;  2KUP A;  3AJ4 A;  2RNR B;  5LOP B;  2CY4 A;  2DLW A;  2NZ8 B;  4CHM A;  3KRW A;  3ZDT A;  4WSF A;  1DDV A;  1Y5O A;  2DYQ A;  3TW1 A;  1M7R A;  1PFJ A;  3A8Q A;  3HK0 A;  4ZRI A;  1V89 A;  1B55 A;  2IFS A;  2H7E A;  2P0H A;  4K2O A;  5DH9 B;  1LW3 A;  2D9Z A;  2D9X A;  3KZ1 A;  5HE3 A;  1U27 A;  2VRW B;  1X11 A;  1AWE A;  4KAX B;  1NI2 A;  3F0W A;  3TCA A;  3GYP A;  2Z0O A;  5HE0 A;  2PZ1 A;  2XQN M;  3HQC A;  4CHJ A;  2M38 A;  1QQG A;  5HE2 A;  1WJM A;  3MDB C;  5JHG A;  2LG1 A;  2AEH A;  2Y8G A;  3DXC A;  2MWN B;  3PSC A;  1FHW A;  2OQB A;  3TFM A;  2YT1 A;  4Z2M B;  4F7U P;  1MIX A;  2RUK B;  4HB4 B;  4A5K A;  2D4Q A;  2J0M A;  1J19 A;  1BTK A;  1IRS A;  1Q67 A;  2J0K A;  2DA0 A;  4C0A A;  4DX9 0;  3KRX A;  2YVC A;  1X1G A;  2L1C A;  2MKR A;  3BIN A;  4K2P A;  2EMS A;  2QKM A;  1V5M A;  1X1F A;  2ELA A;  4DXA B;  2YS1 A;  4TKN A;  4ZRK A;  1LB1 A;  1DDM A;  1EF1 A;  4MK0 A;  5L81 A;  1X86 A;  3D8F A;  1FOE A;  1BWN A;  2LKO A;  1J0W A;  3X23 A;  5C5B B;  3U8Z A;  2UZS A;  2EJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...