2M38A

Ptb domain of aida1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
135
Chain Sequence
b'EKLIAQSCDYKAAYLGSMLIKELRGTESTQDACAKMRANCQKSTEQMKKVPTIILSVSAKGVKFIDATNKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNLAAEIILTLGQAFEVAYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin repeat and sterile alpha motif domain-containing pro
publication title Solution structure and peptide binding of the PTB domain from the AIDA1 postsynaptic signaling scaffolding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 31
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2013-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00640 PID Phosphotyrosine interaction domain (PTB/PID)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2m38A00
2I5FA 3O96A 4KAXB 3U8ZA 1U5GA 1V61A 4B6HA 1FGZA 1OQNA 2VSZA 2W2WA 1B55A 2N0YA 5FI1A 5J3QA 2K2UA 1RJ2A 4A6HA 2KCJA 3ULBA 1NI2A 2LYDA 4D0NB 2Z0PA 2XQNM 4GMVA 1PFJA 4NSWA 1MKEA 3FSSA 2LULA 2Y8FA 3ODWA 4K2OA 1MIXA 1UPQA 3CXBB 2DN6A 2UVMA 5C16A 1X11A 2RUKB 3TFMA 4HDQA 3VOQA 3HQCA 3F5RA 2DYQA 3HK0A 3SV1A 1ZC3B 2D10A 1K5GB 3WA0A 2D11A 2EC1A 3AU5A 4F7HA 1W1HA 4WSFA 3SO6A 2ROVA 1ZC4B 2LOZA 1TQZA 1M7EA 1XD4A 5DHAB 1U5DA 1ZSQA 3DXCA 3QWMA 2YS5A 2J0JA 3PG7A 2DTCA 2DHJA 1KZGA 2RGNB 1U5FA 4TKNA 1WI1A 2M38A 3VIAA 5L81A 1ZM0A 5GOWB 3N7CA 3SYXA 3OANA 1XODA 2OQBA 4PNKA 4EJNA 4HB2B 1E5WA 1MPHA 2N23A 4H8SA 1FGYA 3FEHA 2EMTA 1EAZA 2D9XA 4HB4B 1GC6A 2YT1A 4MK0A 3NSUA 2L1CA 1WJMA 2GCLA 4P7IA 2D2QA 3PSCA 1RRPB 2Y8GA 3IVFA 4PQ0A 5HE2A 2P0DA 5LONB 1BAKA 5JHHA 2J59M 3BJIA 2OTXA 5LOPB 2ROZB 4YONA 2X18A 2KGXB 2UZSA 5KQ1A 3TCAA 3UZTA 2BCJA 4EMOA 4GN1A 2CODA 4XWXA 2RLOA 1FOEA 1U5EA 4Z2MB 1V88A 2JP2A 3TW1A 1PLSA 4NY0A 4F7GA 2R09A 3ZVRA 2DA0A 1UNRA 2YS1A 3AJ4A 1X05A 2I5CA 4ZRKA 1FAOA 2CRFA 5HE0A 5J3YA 4TYZA 5JLJB 5C5BB 2V76A 2IYBA 3PZDA 3PP2A 3U7DA 3ULCA 1SGHA 1X1FA 1U29A 3ODOA 5C79A 2KUPA 1NU2A 4HAVB 1EF1A 1U27A 1FHWA 1LB1A 3TO1A 1WGQA 4HAUB 2MKRA 4HDOA 1QQGA 2DKPA 1WJ1A 5D3XA 2DYNA 2G35A 1DDVA 4BBKA 1M7RA 5D3WA 4HAWB 4MY6A 1DDMA 3GYOA 1Z87A 4WVFB 2D4QA 3PVWA 2P0HA 2LG1A 1AQCA 1GG3A 5J3TA 4GMXB 3DXDA 3P7ZA 4HHVA 2GS0A 2CAYA 1MK9B 1J0WA 2J0MA 2R0DA 2K00A 4KVGB 1K5DB 4CYEA 1XKEA 4K17A 1MK7B 3ODXA 2P8VA 4WJ7A 2HTHB 4GPTB 2Y7BA 1DBHA 2VRWB 2HE7A 2ZPYA 3FM8C 2NZ8B 1I2HA 2D9WA 4YL8A 5JP4A 2D9VA 4KHOA 1V5UA 3KRXA 1U2BA 2Z0OA 1IRSA 1LW3A 1MIZB 2P0FA 4HB3B 5JHGA 2AEHA 4K2PA 4A6FB 2FJLA 1OY2A 1X1GA 1I7AA 4HAZB 1N3HA 1WGUA 2W2XD 1V5PA 3D8EA 2GJYA 5HE1A 4DX8A 4CHMA 3MDBC 1DROA 2COCA 1FB8A 4HAXB 2LKOA 4HAYB 3G9WA 2DFKA 4KHBB 3CIKA 4GZUA 2DLWA 3DXEA 2MFQA 1AWEA 2E2XA 3P6AA 4GXBA 2DKQA 1X86A 2DX5A 2VKIA 3SNHA 1H10A 5KQ4A 2I1KA 2D9ZA 1P3RA 3KRWA 1PMSA 4Y94A 3KZ1A 1H4RA 1NTVA 3WYFB 2J0KA 5C5BA 3F0WA 5KCVA 3QIJA 2NMBA 1KI1B 1FHXA 3QBVB 5HE3A 1P6SA 2QKLA 4HATB 1BWNA 1MAIA 1BTKA 2UZRA 3PEGA 3ZDTA 1XX0A 4F7UP 5EFXA 3KY9A 2YS3A 1EGXA 2K2JA 2YVCA 1KZ7A 3X23A 2PZ1A 2MWNB 2ELAA 3TVVA 4CHJA 1WVHA 2L2IA 2EJ8A 3PVUA 1DYNA 3LJUX 2GCJA 5CLQB 5DI9B 5DIFB 3SUZA 1BTNA 2ADZA 1UNPA 2CY4A 5C6RA 1ISNA 1W1DA 2RNRB 3AU4A 1UPRA 2DX1A 1FHOA 4C0AA 2COFA 2Z0QA 5D3VA 2LOXA 1W1GA 4HB0B 4KHAA 2QKMA 1Y19B 4L6EA 4A6FA 2COAA 2ELBA 2AL6A 4IAPA 2MDXA 3MPXA 4ZRJA 1UEFA 2IFSA 5DHFB 4MT7A 3D8DA 4DBBA 3V5WA 1V89A 4ZRIA 2H7EA 1TXDA 3GYPA 2H7DA 2YRYA 4A6KA 3PVLA 4K81A 3ML4A 4DXAB 1Y5OA 1UNQA 5FI0A 4DX90 1WG7A 5D3YA 3RCPA 1J19A 1GC7A 3HW2B 2EMSA 3A98B 2RSGA 2M14A 4A5KA 2I1JA 1EVHA 1SHCA 1QC6A 2YF0A 4Z2NA 1NTYA 2W2XC 1ZVRA 1XR0B 5CLLB 3M1IB 2DHKA 1OMWA 5DH9B 1P5TA 2D9YA 2YT0A 2RVBB 3KSYA 1XCGA 1V5MA 5D27A 3A8PA 3BINA 3T06A 2CY5A 3D8FA 1TJ6A 4IOYX 1DDWA 3A8QA 2Q13A 4IFSA 1Q67A 4EKUA 2DHIA 2YSZA
chains in the Genus database with same CATH superfamily
2I5FA 3O96A 4KAXB 3U8ZA 1U5GA 1V61A 2Z4DA 4B6HA 1FGZA 1T77A 4QJ4B 1OQNA 2VSZA 2W2WA 1B55A 2N0YA 5FI1A 5J3QA 2K2UA 1RJ2A 2KUQA 4A6HA 2KCJA 3ULBA 1NI2A 2LYDA 4D0NB 2Z0PA 2XQNM 4GMVA 3A58A 1PFJA 4NSWA 1MKEA 3FSSA 2LULA 2Y8FA 3ODWA 4K2OA 1MIXA 1UPQA 3CXBB 2DN6A 2NBVA 4QJ3B 2UVMA 5C16A 1X11A 2RUKB 3TFMA 4HDQA 3VOQA 3HQCA 3F5RA 2DYQA 3HK0A 3SV1A 1ZC3B 2D10A 1K5GB 3WA0A 2D11A 2EC1A 3AU5A 4F7HA 1W1HA 4WSFA 3SO6A 2ROVA 1ZC4B 2LOZA 1TQZA 1M7EA 1XD4A 5I2SA 5DHAB 1U5DA 1ZSQA 3DXCA 3QWMA 3OHMB 2YS5A 2J0JA 3PG7A 2DTCA 2DHJA 1KZGA 2RGNB 5LG4B 1U5FA 4TKNA 1WI1A 2M38A 4DIXA 3VIAA 5L81A 1ZM0A 5GOWB 3N7CA 3SYXA 3OANA 1XODA 2OQBA 4PNKA 4EJNA 4HB2B 1E5WA 1MPHA 2N23A 4H8SA 1FGYA 3FEHA 2EMTA 1EAZA 2D9XA 4HB4B 1GC6A 2YT1A 5I2MA 4MK0A 3NSUA 2L1CA 1WJMA 2GCLA 4P7IA 2D2QA 3PSCA 1RRPB 2Y8GA 3IVFA 4PQ0A 5HE2A 3NWDA 2P0DA 5LONB 1BAKA 5JHHA 2J59M 3BJIA 2OTXA 5LOPB 2ROZB 4YONA 2X18A 2KGXB 2K49A 2UZSA 5KQ1A 3TCAA 3UZTA 2BCJA 4EMOA 4GN1A 2CODA 4XWXA 2RLOA 4L1RA 1FOEA 2FJUB 3U12A 1U5EA 4Z2MB 1V88A 2JP2A 3TW1A 1PLSA 4NY0A 4F7GA 2R09A 3ZVRA 2DA0A 1UNRA 2YS1A 3AJ4A 1X05A 2I5CA 4ZRKA 1FAOA 2CRFA 5HE0A 3HIEA 4TYZA 5J3YA 5C5BB 5JLJB 2V76A 2IYBA 3PZDA 3PP2A 3U7DA 3ULCA 4OSNA 1SGHA 1X1FA 1U29A 2KIEA 3ODOA 5C79A 2KUPA 1NU2A 4HAVB 1EF1A 1U27A 1FHWA 1LB1A 3TO1A 1WGQA 4HAUB 2MKRA 4HDOA 1QQGA 2DKPA 1WJ1A 4HSIA 5D3XA 2DYNA 2G35A 1DDVA 4BBKA 1M7RA 5D3WA 4HAWB 4MY6A 1DDMA 3GYOA 1Z87A 4WVFB 2D4QA 3PVWA 3HSAA 2P0HA 2LG1A 2YT2A 1AQCA 1GG3A 5J3TA 4GMXB 3DXDA 3P7ZA 4HHVA 2GS0A 2CAYA 1MK9B 1J0WA 2J0MA 2R0DA 2K00A 4KVGB 1K5DB 4CYEA 1XKEA 4K17A 1MK7B 1MI1A 2P8VA 3ODXA 4WJ7A 2HTHB 4GPTB 2Y7BA 1DBHA 2VRWB 2HE7A 2ZPYA 3FM8C 2NZ8B 1I2HA 2D9WA 4YL8A 4CSQA 5JP4A 2D9VA 4KHOA 1V5UA 3KRXA 1U2BA 2Z0OA 1IRSA 1LW3A 1MIZB 3DCXA 2P0FA 4HB3B 5JHGA 2AEHA 4K2PA 4A6FB 2FJLA 1OY2A 1X1GA 1I7AA 4HAZB 1N3HA 2R2YA 1WGUA 2W2XD 1V5PA 3D8EA 2GJYA 5HE1A 4DX8A 4CHMA 3MDBC 1DROA 2COCA 1FB8A 4HAXB 2LKOA 4HAYB 3G9WA 2DFKA 5M4YB 4KHBB 3CIKA 4GZUA 2DLWA 3DXEA 2MFQA 1AWEA 2E2XA 3P6AA 4GXBA 2DKQA 1X86A 2DX5A 2VKIA 3SNHA 1H10A 5KQ4A 2Z59A 2I1KA 2D9ZA 1P3RA 3KRWA 1PMSA 4Y94A 3B77A 3KZ1A 1H4RA 1NTVA 3WYFB 2J0KA 5C5BA 3F0WA 5KCVA 3QIJA 2NMBA 1KI1B 1FHXA 3QBVB 5HE3A 1P6SA 2QKLA 4HATB 1BWNA 1MAIA 1BTKA 2UZRA 3PEGA 3ZDTA 1XX0A 4F7UP 5EFXA 3KY9A 2YS3A 1EGXA 2K2JA 2YVCA 1KZ7A 1ZYIA 3X23A 2PZ1A 2MWNB 4QXAB 2ELAA 3TVVA 4CHJA 1WVHA 2L2IA 2EJ8A 3PVUA 1DYNA 3LJUX 2GCJA 5CLQB 5DI9B 5DIFB 3SUZA 1BTNA 2ADZA 5IRSA 1UNPA 2CY4A 5C6RA 1ISNA 1W1DA 2RNRB 3AU4A 1UPRA 2DX1A 2ZKMX 1FHOA 4C0AA 2COFA 2Z0QA 5D3VA 2GUMA 2K8EA 2LOXA 1W1GA 4HB0B 3NW8A 4KHAA 2QKMA 1Y19B 4L6EA 4A6FA 2COAA 2ELBA 2AL6A 4IAPA 2MDXA 3MPXA 4OT1A 4ZRJA 1UEFA 2IFSA 5DHFB 3NWFA 4MT7A 3FVCA 3D8DA 4DBBA 2KR0A 3V5WA 1V89A 2RRFA 4ZRIA 2H7EA 4KHBA 1TXDA 3GYPA 2H7DA 3NWAA 2KIGA 2YRYA 4A6KA 3PVLA 4D6WA 4K81A 3ML4A 4DXAB 1Y5OA 1UNQA 5FI0A 4DX90 1WG7A 5D3YA 2Z14A 3RCPA 1J19A 1GC7A 3HW2B 2EMSA 3A98B 2RSGA 2M14A 4A5KA 2I1JA 1EVHA 1SHCA 1QC6A 2YF0A 4Z2NA 1NTYA 2W2XC 1ZVRA 4GOUA 1XR0B 5CLLB 3M1IB 2DHKA 4QJ5B 1OMWA 5DH9B 1P5TA 2D9YA 2YT0A 2RVBB 3KSYA 1XCGA 1V5MA 5D27A 3A8PA 3BINA 3T06A 2CY5A 3D8FA 4GNKB 1TJ6A 4IOYX 1DDWA 2Z13A 3A8QA 2Q13A 4IFSA 1Q67A 4EKUA 2DHIA 2YSZA
chains in the Genus database with same CATH topology
2I5FA 3O96A 4KAXB 3U8ZA 1U5GA 1V61A 4B6HA 1FGZA 1OQNA 2VSZA 2W2WA 1B55A 2N0YA 5FI1A 5J3QA 2K2UA 1RJ2A 4A6HA 2KCJA 3ULBA 1NI2A 2LYDA 4D0NB 2Z0PA 2XQNM 4GMVA 1PFJA 4NSWA 1MKEA 3FSSA 2LULA 2Y8FA 3ODWA 4K2OA 1MIXA 1UPQA 3CXBB 2DN6A 2UVMA 5C16A 1X11A 2RUKB 3TFMA 4HDQA 3VOQA 3HQCA 3F5RA 2DYQA 3HK0A 3SV1A 1ZC3B 2D10A 1K5GB 3WA0A 2D11A 2EC1A 3AU5A 4F7HA 1W1HA 4WSFA 3SO6A 2ROVA 1ZC4B 2LOZA 1TQZA 1M7EA 1XD4A 5DHAB 1U5DA 1ZSQA 3DXCA 3QWMA 2YS5A 2J0JA 3PG7A 2DTCA 2DHJA 1KZGA 2RGNB 1U5FA 4TKNA 1WI1A 2M38A 3VIAA 5L81A 1ZM0A 5GOWB 3N7CA 3SYXA 3OANA 1XODA 2OQBA 4PNKA 4EJNA 4HB2B 1E5WA 1MPHA 2N23A 4H8SA 1FGYA 3FEHA 2EMTA 1EAZA 2D9XA 4HB4B 1GC6A 2YT1A 4MK0A 3NSUA 2L1CA 1WJMA 2GCLA 4P7IA 2D2QA 3PSCA 1RRPB 2Y8GA 3IVFA 4PQ0A 5HE2A 2P0DA 5LONB 1BAKA 5JHHA 2J59M 3BJIA 2OTXA 5LOPB 2ROZB 4YONA 2X18A 2KGXB 2UZSA 5KQ1A 3TCAA 3UZTA 2BCJA 4EMOA 4GN1A 2CODA 4XWXA 2RLOA 1FOEA 1U5EA 4Z2MB 1V88A 2JP2A 3TW1A 1PLSA 4NY0A 4F7GA 2R09A 3ZVRA 2DA0A 1UNRA 2YS1A 3AJ4A 1X05A 2I5CA 4ZRKA 1FAOA 2CRFA 5HE0A 5J3YA 4TYZA 5JLJB 5C5BB 2V76A 2IYBA 3PZDA 3PP2A 3U7DA 3ULCA 1SGHA 1X1FA 1U29A 3ODOA 5C79A 2KUPA 1NU2A 4HAVB 1EF1A 1U27A 1FHWA 1LB1A 3TO1A 1WGQA 4HAUB 2MKRA 4HDOA 1QQGA 2DKPA 1WJ1A 5D3XA 2DYNA 2G35A 1DDVA 4BBKA 1M7RA 5D3WA 4HAWB 4MY6A 1DDMA 3GYOA 1Z87A 4WVFB 2D4QA 3PVWA 2P0HA 2LG1A 1AQCA 1GG3A 5J3TA 4GMXB 3DXDA 3P7ZA 4HHVA 2GS0A 2CAYA 1MK9B 1J0WA 2J0MA 2R0DA 2K00A 4KVGB 1K5DB 4CYEA 1XKEA 4K17A 1MK7B 3ODXA 2P8VA 4WJ7A 2HTHB 4GPTB 2Y7BA 1DBHA 2VRWB 2HE7A 2ZPYA 3FM8C 2NZ8B 1I2HA 2D9WA 4YL8A 5JP4A 2D9VA 4KHOA 1V5UA 3KRXA 1U2BA 2Z0OA 1IRSA 1LW3A 1MIZB 2P0FA 4HB3B 5JHGA 2AEHA 4K2PA 4A6FB 2FJLA 1OY2A 1X1GA 1I7AA 4HAZB 1N3HA 1WGUA 2W2XD 1V5PA 3D8EA 2GJYA 5HE1A 4DX8A 4CHMA 3MDBC 1DROA 2COCA 1FB8A 4HAXB 2LKOA 4HAYB 3G9WA 2DFKA 4KHBB 3CIKA 4GZUA 2DLWA 3DXEA 2MFQA 1AWEA 2E2XA 3P6AA 4GXBA 2DKQA 1X86A 2DX5A 2VKIA 3SNHA 1H10A 5KQ4A 2I1KA 2D9ZA 1P3RA 3KRWA 1PMSA 4Y94A 3KZ1A 1H4RA 1NTVA 3WYFB 2J0KA 5C5BA 3F0WA 5KCVA 3QIJA 2NMBA 1KI1B 1FHXA 3QBVB 5HE3A 1P6SA 2QKLA 4HATB 1BWNA 1MAIA 1BTKA 2UZRA 3PEGA 3ZDTA 1XX0A 4F7UP 5EFXA 3KY9A 2YS3A 1EGXA 2K2JA 2YVCA 1KZ7A 3X23A 2PZ1A 2MWNB 2ELAA 3TVVA 4CHJA 1WVHA 2L2IA 2EJ8A 3PVUA 1DYNA 3LJUX 2GCJA 5CLQB 5DI9B 5DIFB 3SUZA 1BTNA 2ADZA 1UNPA 2CY4A 5C6RA 1ISNA 1W1DA 2RNRB 3AU4A 1UPRA 2DX1A 1FHOA 4C0AA 2COFA 2Z0QA 5D3VA 2LOXA 1W1GA 4HB0B 4KHAA 2QKMA 1Y19B 4L6EA 4A6FA 2COAA 2ELBA 2AL6A 4IAPA 2MDXA 3MPXA 4ZRJA 1UEFA 2IFSA 5DHFB 4MT7A 3D8DA 4DBBA 3V5WA 1V89A 4ZRIA 2H7EA 1TXDA 3GYPA 2H7DA 2YRYA 4A6KA 3PVLA 4K81A 3ML4A 4DXAB 1Y5OA 1UNQA 5FI0A 4DX90 1WG7A 5D3YA 3RCPA 1J19A 1GC7A 3HW2B 2EMSA 3A98B 2RSGA 2M14A 4A5KA 2I1JA 1EVHA 1SHCA 1QC6A 2YF0A 4Z2NA 1NTYA 2W2XC 1ZVRA 1XR0B 5CLLB 3M1IB 2DHKA 1OMWA 5DH9B 1P5TA 2D9YA 2YT0A 2RVBB 3KSYA 1XCGA 1V5MA 5D27A 3A8PA 3BINA 3T06A 2CY5A 3D8FA 1TJ6A 4IOYX 1DDWA 3A8QA 2Q13A 4IFSA 1Q67A 4EKUA 2DHIA 2YSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5F A;  3O96 A;  4KAX B;  3U8Z A;  1U5G A;  1V61 A;  4B6H A;  1FGZ A;  1OQN A;  2VSZ A;  2W2W A;  1B55 A;  2N0Y A;  5FI1 A;  5J3Q A;  2K2U A;  1RJ2 A;  4A6H A;  2KCJ A;  3ULB A;  1NI2 A;  2LYD A;  4D0N B;  2Z0P A;  2XQN M;  4GMV A;  1PFJ A;  4NSW A;  1MKE A;  3FSS A;  2LUL A;  2Y8F A;  3ODW A;  4K2O A;  1MIX A;  1UPQ A;  3CXB B;  2DN6 A;  2UVM A;  5C16 A;  1X11 A;  2RUK B;  3TFM A;  4HDQ A;  3VOQ A;  3HQC A;  3F5R A;  2DYQ A;  3HK0 A;  3SV1 A;  1ZC3 B;  2D10 A;  1K5G B;  3WA0 A;  2D11 A;  2EC1 A;  3AU5 A;  4F7H A;  1W1H A;  4WSF A;  3SO6 A;  2ROV A;  1ZC4 B;  2LOZ A;  1TQZ A;  1M7E A;  1XD4 A;  5DHA B;  1U5D A;  1ZSQ A;  3DXC A;  3QWM A;  2YS5 A;  2J0J A;  3PG7 A;  2DTC A;  2DHJ A;  1KZG A;  2RGN B;  1U5F A;  4TKN A;  1WI1 A;  2M38 A;  3VIA A;  5L81 A;  1ZM0 A;  5GOW B;  3N7C A;  3SYX A;  3OAN A;  1XOD A;  2OQB A;  4PNK A;  4EJN A;  4HB2 B;  1E5W A;  1MPH A;  2N23 A;  4H8S A;  1FGY A;  3FEH A;  2EMT A;  1EAZ A;  2D9X A;  4HB4 B;  1GC6 A;  2YT1 A;  4MK0 A;  3NSU A;  2L1C A;  1WJM A;  2GCL A;  4P7I A;  2D2Q A;  3PSC A;  1RRP B;  2Y8G A;  3IVF A;  4PQ0 A;  5HE2 A;  2P0D A;  5LON B;  1BAK A;  5JHH A;  2J59 M;  3BJI A;  2OTX A;  5LOP B;  2ROZ B;  4YON A;  2X18 A;  2KGX B;  2UZS A;  5KQ1 A;  3TCA A;  3UZT A;  2BCJ A;  4EMO A;  4GN1 A;  2COD A;  4XWX A;  2RLO A;  1FOE A;  1U5E A;  4Z2M B;  1V88 A;  2JP2 A;  3TW1 A;  1PLS A;  4NY0 A;  4F7G A;  2R09 A;  3ZVR A;  2DA0 A;  1UNR A;  2YS1 A;  3AJ4 A;  1X05 A;  2I5C A;  4ZRK A;  1FAO A;  2CRF A;  5HE0 A;  5J3Y A;  4TYZ A;  5JLJ B;  5C5B B;  2V76 A;  2IYB A;  3PZD A;  3PP2 A;  3U7D A;  3ULC A;  1SGH A;  1X1F A;  1U29 A;  3ODO A;  5C79 A;  2KUP A;  1NU2 A;  4HAV B;  1EF1 A;  1U27 A;  1FHW A;  1LB1 A;  3TO1 A;  1WGQ A;  4HAU B;  2MKR A;  4HDO A;  1QQG A;  2DKP A;  1WJ1 A;  5D3X A;  2DYN A;  2G35 A;  1DDV A;  4BBK A;  1M7R A;  5D3W A;  4HAW B;  4MY6 A;  1DDM A;  3GYO A;  1Z87 A;  4WVF B;  2D4Q A;  3PVW A;  2P0H A;  2LG1 A;  1AQC A;  1GG3 A;  5J3T A;  4GMX B;  3DXD A;  3P7Z A;  4HHV A;  2GS0 A;  2CAY A;  1MK9 B;  1J0W A;  2J0M A;  2R0D A;  2K00 A;  4KVG B;  1K5D B;  4CYE A;  1XKE A;  4K17 A;  1MK7 B;  3ODX A;  2P8V A;  4WJ7 A;  2HTH B;  4GPT B;  2Y7B A;  1DBH A;  2VRW B;  2HE7 A;  2ZPY A;  3FM8 C;  2NZ8 B;  1I2H A;  2D9W A;  4YL8 A;  5JP4 A;  2D9V A;  4KHO A;  1V5U A;  3KRX A;  1U2B A;  2Z0O A;  1IRS A;  1LW3 A;  1MIZ B;  2P0F A;  4HB3 B;  5JHG A;  2AEH A;  4K2P A;  4A6F B;  2FJL A;  1OY2 A;  1X1G A;  1I7A A;  4HAZ B;  1N3H A;  1WGU A;  2W2X D;  1V5P A;  3D8E A;  2GJY A;  5HE1 A;  4DX8 A;  4CHM A;  3MDB C;  1DRO A;  2COC A;  1FB8 A;  4HAX B;  2LKO A;  4HAY B;  3G9W A;  2DFK A;  4KHB B;  3CIK A;  4GZU A;  2DLW A;  3DXE A;  2MFQ A;  1AWE A;  2E2X A;  3P6A A;  4GXB A;  2DKQ A;  1X86 A;  2DX5 A;  2VKI A;  3SNH A;  1H10 A;  5KQ4 A;  2I1K A;  2D9Z A;  1P3R A;  3KRW A;  1PMS A;  4Y94 A;  3KZ1 A;  1H4R A;  1NTV A;  3WYF B;  2J0K A;  5C5B A;  3F0W A;  5KCV A;  3QIJ A;  2NMB A;  1KI1 B;  1FHX A;  3QBV B;  5HE3 A;  1P6S A;  2QKL A;  4HAT B;  1BWN A;  1MAI A;  1BTK A;  2UZR A;  3PEG A;  3ZDT A;  1XX0 A;  4F7U P;  5EFX A;  3KY9 A;  2YS3 A;  1EGX A;  2K2J A;  2YVC A;  1KZ7 A;  3X23 A;  2PZ1 A;  2MWN B;  2ELA A;  3TVV A;  4CHJ A;  1WVH A;  2L2I A;  2EJ8 A;  3PVU A;  1DYN A;  3LJU X;  2GCJ A;  5CLQ B;  5DI9 B;  5DIF B;  3SUZ A;  1BTN A;  2ADZ A;  1UNP A;  2CY4 A;  5C6R A;  1ISN A;  1W1D A;  2RNR B;  3AU4 A;  1UPR A;  2DX1 A;  1FHO A;  4C0A A;  2COF A;  2Z0Q A;  5D3V A;  2LOX A;  1W1G A;  4HB0 B;  4KHA A;  2QKM A;  1Y19 B;  4L6E A;  4A6F A;  2COA A;  2ELB A;  2AL6 A;  4IAP A;  2MDX A;  3MPX A;  4ZRJ A;  1UEF A;  2IFS A;  5DHF B;  4MT7 A;  3D8D A;  4DBB A;  3V5W A;  1V89 A;  4ZRI A;  2H7E A;  1TXD A;  3GYP A;  2H7D A;  2YRY A;  4A6K A;  3PVL A;  4K81 A;  3ML4 A;  4DXA B;  1Y5O A;  1UNQ A;  5FI0 A;  4DX9 0;  1WG7 A;  5D3Y A;  3RCP A;  1J19 A;  1GC7 A;  3HW2 B;  2EMS A;  3A98 B;  2RSG A;  2M14 A;  4A5K A;  2I1J A;  1EVH A;  1SHC A;  1QC6 A;  2YF0 A;  4Z2N A;  1NTY A;  2W2X C;  1ZVR A;  1XR0 B;  5CLL B;  3M1I B;  2DHK A;  1OMW A;  5DH9 B;  1P5T A;  2D9Y A;  2YT0 A;  2RVB B;  3KSY A;  1XCG A;  1V5M A;  5D27 A;  3A8P A;  3BIN A;  3T06 A;  2CY5 A;  3D8F A;  1TJ6 A;  4IOY X;  1DDW A;  3A8Q A;  2Q13 A;  4IFS A;  1Q67 A;  4EKU A;  2DHI A;  2YSZ A; 
#chains in the Genus database with same CATH topology
 2I5F A;  3O96 A;  4KAX B;  3U8Z A;  1U5G A;  1V61 A;  2Z4D A;  4B6H A;  1FGZ A;  1T77 A;  4QJ4 B;  1OQN A;  2VSZ A;  2W2W A;  1B55 A;  2N0Y A;  5FI1 A;  5J3Q A;  2K2U A;  1RJ2 A;  2KUQ A;  4A6H A;  2KCJ A;  3ULB A;  1NI2 A;  2LYD A;  4D0N B;  2Z0P A;  2XQN M;  4GMV A;  3A58 A;  1PFJ A;  4NSW A;  1MKE A;  3FSS A;  2LUL A;  2Y8F A;  3ODW A;  4K2O A;  1MIX A;  1UPQ A;  3CXB B;  2DN6 A;  2NBV A;  4QJ3 B;  2UVM A;  5C16 A;  1X11 A;  2RUK B;  3TFM A;  4HDQ A;  3VOQ A;  3HQC A;  3F5R A;  2DYQ A;  3HK0 A;  3SV1 A;  1ZC3 B;  2D10 A;  1K5G B;  3WA0 A;  2D11 A;  2EC1 A;  3AU5 A;  4F7H A;  1W1H A;  4WSF A;  3SO6 A;  2ROV A;  1ZC4 B;  2LOZ A;  1TQZ A;  1M7E A;  1XD4 A;  5I2S A;  5DHA B;  1U5D A;  1ZSQ A;  3DXC A;  3QWM A;  3OHM B;  2YS5 A;  2J0J A;  3PG7 A;  2DTC A;  2DHJ A;  1KZG A;  2RGN B;  5LG4 B;  1U5F A;  4TKN A;  1WI1 A;  2M38 A;  4DIX A;  3VIA A;  5L81 A;  1ZM0 A;  5GOW B;  3N7C A;  3SYX A;  3OAN A;  1XOD A;  2OQB A;  4PNK A;  4EJN A;  4HB2 B;  1E5W A;  1MPH A;  2N23 A;  4H8S A;  1FGY A;  3FEH A;  2EMT A;  1EAZ A;  2D9X A;  4HB4 B;  1GC6 A;  2YT1 A;  5I2M A;  4MK0 A;  3NSU A;  2L1C A;  1WJM A;  2GCL A;  4P7I A;  2D2Q A;  3PSC A;  1RRP B;  2Y8G A;  3IVF A;  4PQ0 A;  5HE2 A;  3NWD A;  2P0D A;  5LON B;  1BAK A;  5JHH A;  2J59 M;  3BJI A;  2OTX A;  5LOP B;  2ROZ B;  4YON A;  2X18 A;  2KGX B;  2K49 A;  2UZS A;  5KQ1 A;  3TCA A;  3UZT A;  2BCJ A;  4EMO A;  4GN1 A;  2COD A;  4XWX A;  2RLO A;  4L1R A;  1FOE A;  2FJU B;  3U12 A;  1U5E A;  4Z2M B;  1V88 A;  2JP2 A;  3TW1 A;  1PLS A;  4NY0 A;  4F7G A;  2R09 A;  3ZVR A;  2DA0 A;  1UNR A;  2YS1 A;  3AJ4 A;  1X05 A;  2I5C A;  4ZRK A;  1FAO A;  2CRF A;  5HE0 A;  3HIE A;  4TYZ A;  5J3Y A;  5C5B B;  5JLJ B;  2V76 A;  2IYB A;  3PZD A;  3PP2 A;  3U7D A;  3ULC A;  4OSN A;  1SGH A;  1X1F A;  1U29 A;  2KIE A;  3ODO A;  5C79 A;  2KUP A;  1NU2 A;  4HAV B;  1EF1 A;  1U27 A;  1FHW A;  1LB1 A;  3TO1 A;  1WGQ A;  4HAU B;  2MKR A;  4HDO A;  1QQG A;  2DKP A;  1WJ1 A;  4HSI A;  5D3X A;  2DYN A;  2G35 A;  1DDV A;  4BBK A;  1M7R A;  5D3W A;  4HAW B;  4MY6 A;  1DDM A;  3GYO A;  1Z87 A;  4WVF B;  2D4Q A;  3PVW A;  3HSA A;  2P0H A;  2LG1 A;  2YT2 A;  1AQC A;  1GG3 A;  5J3T A;  4GMX B;  3DXD A;  3P7Z A;  4HHV A;  2GS0 A;  2CAY A;  1MK9 B;  1J0W A;  2J0M A;  2R0D A;  2K00 A;  4KVG B;  1K5D B;  4CYE A;  1XKE A;  4K17 A;  1MK7 B;  1MI1 A;  2P8V A;  3ODX A;  4WJ7 A;  2HTH B;  4GPT B;  2Y7B A;  1DBH A;  2VRW B;  2HE7 A;  2ZPY A;  3FM8 C;  2NZ8 B;  1I2H A;  2D9W A;  4YL8 A;  4CSQ A;  5JP4 A;  2D9V A;  4KHO A;  1V5U A;  3KRX A;  1U2B A;  2Z0O A;  1IRS A;  1LW3 A;  1MIZ B;  3DCX A;  2P0F A;  4HB3 B;  5JHG A;  2AEH A;  4K2P A;  4A6F B;  2FJL A;  1OY2 A;  1X1G A;  1I7A A;  4HAZ B;  1N3H A;  2R2Y A;  1WGU A;  2W2X D;  1V5P A;  3D8E A;  2GJY A;  5HE1 A;  4DX8 A;  4CHM A;  3MDB C;  1DRO A;  2COC A;  1FB8 A;  4HAX B;  2LKO A;  4HAY B;  3G9W A;  2DFK A;  5M4Y B;  4KHB B;  3CIK A;  4GZU A;  2DLW A;  3DXE A;  2MFQ A;  1AWE A;  2E2X A;  3P6A A;  4GXB A;  2DKQ A;  1X86 A;  2DX5 A;  2VKI A;  3SNH A;  1H10 A;  5KQ4 A;  2Z59 A;  2I1K A;  2D9Z A;  1P3R A;  3KRW A;  1PMS A;  4Y94 A;  3B77 A;  3KZ1 A;  1H4R A;  1NTV A;  3WYF B;  2J0K A;  5C5B A;  3F0W A;  5KCV A;  3QIJ A;  2NMB A;  1KI1 B;  1FHX A;  3QBV B;  5HE3 A;  1P6S A;  2QKL A;  4HAT B;  1BWN A;  1MAI A;  1BTK A;  2UZR A;  3PEG A;  3ZDT A;  1XX0 A;  4F7U P;  5EFX A;  3KY9 A;  2YS3 A;  1EGX A;  2K2J A;  2YVC A;  1KZ7 A;  1ZYI A;  3X23 A;  2PZ1 A;  2MWN B;  4QXA B;  2ELA A;  3TVV A;  4CHJ A;  1WVH A;  2L2I A;  2EJ8 A;  3PVU A;  1DYN A;  3LJU X;  2GCJ A;  5CLQ B;  5DI9 B;  5DIF B;  3SUZ A;  1BTN A;  2ADZ A;  5IRS A;  1UNP A;  2CY4 A;  5C6R A;  1ISN A;  1W1D A;  2RNR B;  3AU4 A;  1UPR A;  2DX1 A;  2ZKM X;  1FHO A;  4C0A A;  2COF A;  2Z0Q A;  5D3V A;  2GUM A;  2K8E A;  2LOX A;  1W1G A;  4HB0 B;  3NW8 A;  4KHA A;  2QKM A;  1Y19 B;  4L6E A;  4A6F A;  2COA A;  2ELB A;  2AL6 A;  4IAP A;  2MDX A;  3MPX A;  4OT1 A;  4ZRJ A;  1UEF A;  2IFS A;  5DHF B;  3NWF A;  4MT7 A;  3FVC A;  3D8D A;  4DBB A;  2KR0 A;  3V5W A;  1V89 A;  2RRF A;  4ZRI A;  2H7E A;  4KHB A;  1TXD A;  3GYP A;  2H7D A;  3NWA A;  2KIG A;  2YRY A;  4A6K A;  3PVL A;  4D6W A;  4K81 A;  3ML4 A;  4DXA B;  1Y5O A;  1UNQ A;  5FI0 A;  4DX9 0;  1WG7 A;  5D3Y A;  2Z14 A;  3RCP A;  1J19 A;  1GC7 A;  3HW2 B;  2EMS A;  3A98 B;  2RSG A;  2M14 A;  4A5K A;  2I1J A;  1EVH A;  1SHC A;  1QC6 A;  2YF0 A;  4Z2N A;  1NTY A;  2W2X C;  1ZVR A;  4GOU A;  1XR0 B;  5CLL B;  3M1I B;  2DHK A;  4QJ5 B;  1OMW A;  5DH9 B;  1P5T A;  2D9Y A;  2YT0 A;  2RVB B;  3KSY A;  1XCG A;  1V5M A;  5D27 A;  3A8P A;  3BIN A;  3T06 A;  2CY5 A;  3D8F A;  4GNK B;  1TJ6 A;  4IOY X;  1DDW A;  2Z13 A;  3A8Q A;  2Q13 A;  4IFS A;  1Q67 A;  4EKU A;  2DHI A;  2YSZ A; 
#chains in the Genus database with same CATH homology
 2I5F A;  3O96 A;  4KAX B;  3U8Z A;  1U5G A;  1V61 A;  4B6H A;  1FGZ A;  1OQN A;  2VSZ A;  2W2W A;  1B55 A;  2N0Y A;  5FI1 A;  5J3Q A;  2K2U A;  1RJ2 A;  4A6H A;  2KCJ A;  3ULB A;  1NI2 A;  2LYD A;  4D0N B;  2Z0P A;  2XQN M;  4GMV A;  1PFJ A;  4NSW A;  1MKE A;  3FSS A;  2LUL A;  2Y8F A;  3ODW A;  4K2O A;  1MIX A;  1UPQ A;  3CXB B;  2DN6 A;  2UVM A;  5C16 A;  1X11 A;  2RUK B;  3TFM A;  4HDQ A;  3VOQ A;  3HQC A;  3F5R A;  2DYQ A;  3HK0 A;  3SV1 A;  1ZC3 B;  2D10 A;  1K5G B;  3WA0 A;  2D11 A;  2EC1 A;  3AU5 A;  4F7H A;  1W1H A;  4WSF A;  3SO6 A;  2ROV A;  1ZC4 B;  2LOZ A;  1TQZ A;  1M7E A;  1XD4 A;  5DHA B;  1U5D A;  1ZSQ A;  3DXC A;  3QWM A;  2YS5 A;  2J0J A;  3PG7 A;  2DTC A;  2DHJ A;  1KZG A;  2RGN B;  1U5F A;  4TKN A;  1WI1 A;  2M38 A;  3VIA A;  5L81 A;  1ZM0 A;  5GOW B;  3N7C A;  3SYX A;  3OAN A;  1XOD A;  2OQB A;  4PNK A;  4EJN A;  4HB2 B;  1E5W A;  1MPH A;  2N23 A;  4H8S A;  1FGY A;  3FEH A;  2EMT A;  1EAZ A;  2D9X A;  4HB4 B;  1GC6 A;  2YT1 A;  4MK0 A;  3NSU A;  2L1C A;  1WJM A;  2GCL A;  4P7I A;  2D2Q A;  3PSC A;  1RRP B;  2Y8G A;  3IVF A;  4PQ0 A;  5HE2 A;  2P0D A;  5LON B;  1BAK A;  5JHH A;  2J59 M;  3BJI A;  2OTX A;  5LOP B;  2ROZ B;  4YON A;  2X18 A;  2KGX B;  2UZS A;  5KQ1 A;  3TCA A;  3UZT A;  2BCJ A;  4EMO A;  4GN1 A;  2COD A;  4XWX A;  2RLO A;  1FOE A;  1U5E A;  4Z2M B;  1V88 A;  2JP2 A;  3TW1 A;  1PLS A;  4NY0 A;  4F7G A;  2R09 A;  3ZVR A;  2DA0 A;  1UNR A;  2YS1 A;  3AJ4 A;  1X05 A;  2I5C A;  4ZRK A;  1FAO A;  2CRF A;  5HE0 A;  5J3Y A;  4TYZ A;  5JLJ B;  5C5B B;  2V76 A;  2IYB A;  3PZD A;  3PP2 A;  3U7D A;  3ULC A;  1SGH A;  1X1F A;  1U29 A;  3ODO A;  5C79 A;  2KUP A;  1NU2 A;  4HAV B;  1EF1 A;  1U27 A;  1FHW A;  1LB1 A;  3TO1 A;  1WGQ A;  4HAU B;  2MKR A;  4HDO A;  1QQG A;  2DKP A;  1WJ1 A;  5D3X A;  2DYN A;  2G35 A;  1DDV A;  4BBK A;  1M7R A;  5D3W A;  4HAW B;  4MY6 A;  1DDM A;  3GYO A;  1Z87 A;  4WVF B;  2D4Q A;  3PVW A;  2P0H A;  2LG1 A;  1AQC A;  1GG3 A;  5J3T A;  4GMX B;  3DXD A;  3P7Z A;  4HHV A;  2GS0 A;  2CAY A;  1MK9 B;  1J0W A;  2J0M A;  2R0D A;  2K00 A;  4KVG B;  1K5D B;  4CYE A;  1XKE A;  4K17 A;  1MK7 B;  3ODX A;  2P8V A;  4WJ7 A;  2HTH B;  4GPT B;  2Y7B A;  1DBH A;  2VRW B;  2HE7 A;  2ZPY A;  3FM8 C;  2NZ8 B;  1I2H A;  2D9W A;  4YL8 A;  5JP4 A;  2D9V A;  4KHO A;  1V5U A;  3KRX A;  1U2B A;  2Z0O A;  1IRS A;  1LW3 A;  1MIZ B;  2P0F A;  4HB3 B;  5JHG A;  2AEH A;  4K2P A;  4A6F B;  2FJL A;  1OY2 A;  1X1G A;  1I7A A;  4HAZ B;  1N3H A;  1WGU A;  2W2X D;  1V5P A;  3D8E A;  2GJY A;  5HE1 A;  4DX8 A;  4CHM A;  3MDB C;  1DRO A;  2COC A;  1FB8 A;  4HAX B;  2LKO A;  4HAY B;  3G9W A;  2DFK A;  4KHB B;  3CIK A;  4GZU A;  2DLW A;  3DXE A;  2MFQ A;  1AWE A;  2E2X A;  3P6A A;  4GXB A;  2DKQ A;  1X86 A;  2DX5 A;  2VKI A;  3SNH A;  1H10 A;  5KQ4 A;  2I1K A;  2D9Z A;  1P3R A;  3KRW A;  1PMS A;  4Y94 A;  3KZ1 A;  1H4R A;  1NTV A;  3WYF B;  2J0K A;  5C5B A;  3F0W A;  5KCV A;  3QIJ A;  2NMB A;  1KI1 B;  1FHX A;  3QBV B;  5HE3 A;  1P6S A;  2QKL A;  4HAT B;  1BWN A;  1MAI A;  1BTK A;  2UZR A;  3PEG A;  3ZDT A;  1XX0 A;  4F7U P;  5EFX A;  3KY9 A;  2YS3 A;  1EGX A;  2K2J A;  2YVC A;  1KZ7 A;  3X23 A;  2PZ1 A;  2MWN B;  2ELA A;  3TVV A;  4CHJ A;  1WVH A;  2L2I A;  2EJ8 A;  3PVU A;  1DYN A;  3LJU X;  2GCJ A;  5CLQ B;  5DI9 B;  5DIF B;  3SUZ A;  1BTN A;  2ADZ A;  1UNP A;  2CY4 A;  5C6R A;  1ISN A;  1W1D A;  2RNR B;  3AU4 A;  1UPR A;  2DX1 A;  1FHO A;  4C0A A;  2COF A;  2Z0Q A;  5D3V A;  2LOX A;  1W1G A;  4HB0 B;  4KHA A;  2QKM A;  1Y19 B;  4L6E A;  4A6F A;  2COA A;  2ELB A;  2AL6 A;  4IAP A;  2MDX A;  3MPX A;  4ZRJ A;  1UEF A;  2IFS A;  5DHF B;  4MT7 A;  3D8D A;  4DBB A;  3V5W A;  1V89 A;  4ZRI A;  2H7E A;  1TXD A;  3GYP A;  2H7D A;  2YRY A;  4A6K A;  3PVL A;  4K81 A;  3ML4 A;  4DXA B;  1Y5O A;  1UNQ A;  5FI0 A;  4DX9 0;  1WG7 A;  5D3Y A;  3RCP A;  1J19 A;  1GC7 A;  3HW2 B;  2EMS A;  3A98 B;  2RSG A;  2M14 A;  4A5K A;  2I1J A;  1EVH A;  1SHC A;  1QC6 A;  2YF0 A;  4Z2N A;  1NTY A;  2W2X C;  1ZVR A;  1XR0 B;  5CLL B;  3M1I B;  2DHK A;  1OMW A;  5DH9 B;  1P5T A;  2D9Y A;  2YT0 A;  2RVB B;  3KSY A;  1XCG A;  1V5M A;  5D27 A;  3A8P A;  3BIN A;  3T06 A;  2CY5 A;  3D8F A;  1TJ6 A;  4IOY X;  1DDW A;  3A8Q A;  2Q13 A;  4IFS A;  1Q67 A;  4EKU A;  2DHI A;  2YSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...