2M3BA

Serine 16 phosphorylated phospholamban pentamer, hybrid solution and solid-state nmr structural ensemble
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
51
Chain Sequence
b'MEKVQYLTRSAIRRATIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cardiac phospholamban
molecule tags Membrane protein
source organism Oryctolagus cuniculus
publication title Structural Dynamics and Topology of Phosphorylated Phospholamban Homopentamer Reveal Its Role in the Regulation of Calcium Transport.
pubmed doi rcsb
total genus 18
structure length 51
sequence length 52
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2m3bA00
1FJPA 2KB7P 2M3BA 1ZLLA 2HYNA 1N7LA 1FJKA 2KYVA
chains in the Genus database with same CATH superfamily
4HKZH 1NOHA 3V2NA 4ASWA 2JWAA 1FOSE 5AVTB 3H1LG 2I1JA 2IBZE 1EXJA 2AXTH 5AW5B 4XA4A 1Q82Q 2ZYAA 2WT7B 3GMAA 1FAVA 1NO4A 1LTBC 2AEJA 1J1EB 1URQC 1X8YA 3MUDC 3VN0A 3KXDA 1K8AQ 3VMZA 3VP8A 1CSBA 4H13D 3L36A 3SFDC 2XNDH 3H1HG 1YIJP 2Z5HA 1VQLP 5KAFH 2XDJA 3HD7D 2A06D 1LTJB 2NPSB 1SFCB 1T3JA 3L73G 2Q7CA 3BCCE 1PPJD 4RJTA 2HR3A 2RH0A 3H1KE 1PP9E 1PP9D 3C8VA 5KAFE 1MZ9A 1EDJA 1NTMK 1XTCC 2P58A 1OW6A 1USEA 2YO2A 3VP9A 1EZVD 2R44A 1HTLC 3G6EP 4HB1A 3RK2B 5BU8B 3U59A 5EFWB 1LT9B 2LR2A 2YXRB 1HUCA 3EFGA 1KFNA 3II6A 3T97B 1ZW0A 2YO3A 3AEDC 3GLMA 2JKVA 2YIUB 3FXDA 5AVXB 1DEEG 1SQXG 3WU2E 1W5CE 2QJYC 1RY3A 3RK2C 2WSFJ 4LLHA 1Z56A 3RBZA 1R5LA 1RF1B 1BE3G 2O3JA 2LKMA 3O8ZA 5TJHA 4EYYQ 2WITA 1RF0C 2OGUA 1T2KC 1AV1A 5AVVB 1SQBD 3MTUE 1A02J 1PGPA 2Q3EA 2FYUE 1LT1A 1SQPE 1VQ4P 1KYOE 3C9IA 1MUUA 1S4XA 3AE4C 1G2CB 3IAOA 3L73J 3CCVP 2L5GB 1TU3F 3Q5RA 1S5LH 2WPVB 3AE6C 3CC4P 3AEEC 3FX0A 4GODA 1ZXGA 3IR9A 3HTKA 1BDDA 1NWQA 2IPPA 2W8ZA 4OWFA 1H0TA 3H6PA 1VQ7P 3SWKA 3FXEA 5APYA 3WUTA 1JY2O 3N4XA 2GA1A 2E43A 1T8ZA 3TDKA 1NAFA 1UIXA 3PH0A 3V4WA 1GU4A 1PGQA 1YYCA 1RE3C 2QJPB 5KKZB 3SWFA 1NU1J 2O01J 4IFFA 1IK7A 2ZXEB 2ZT9C 1SQBG 2HG5D 1JMBA 1J1DC 1FBMA 4OVNF 4RO0A 2WT7A 4JF7A 2K37A 2M8RA 3A0BH 3KHUA 2B89A 5CJ4A 3TGUG 3TF5A 2E42A 4TT3H 3USSA 1YJ9P 2G8YA 4JBZA 2BASA 5APWA 2KZJA 3A0BE 2OYIA 2IX7C 1L0NG 2POHA 4PJ0E 2WPQA 1YJNP 3L75J 2FY8A 2WZ7A 3FWNA 5CCHC 3PHLA 1KQGB 2W90A 2RN0A 2UWJE 3B4SA 3Q5SA 2K9JA 3AEFC 1SQXE 3AE7C 3AE5C 1S2EA 3RK3B 1ZOYC 1BE3J 2IYOA 2N9YB 2XKMA 1JOCA 3LIDA 4L73A 1NU1K 4PV1C 1P84I 3EQ2A 1VQ6P 4W80A 2FYUD 1VQNP 2P1JA 1SQBE 1Q2NA 1IFPA 3CWBD 2YXQB 2W83C 2KYVA 1BCCG 3HD7A 2I8DA 3BCCG 3L74G 1L4AC 5KAIE 1E5WA 1FC2C 1X0TA 2ZXXA 1QL2A 5AVYB 4U3FD 1OIPA 3L71G 3MGNA 3L71J 2O01N 3AE1C 2MJZA 4GOFA 2JP3A 2C9NY 1LTGC 2WSSH 2M3EA 2YMYA 4I6MC 4OGQB 2K9JB 1NTKD 2WSCJ 4N3YB 4DZOA 1J1EC 1URQB 1SQVK 4WB4A 1ZR4A 5AVQB 2AEFA 4N78E 1VF5B 1SQVJ 4BWNA 1GL2D 1M1JB 2ZYGA 4JYCA 2IFNA 4H0LC 4WY4C 3H1KD 5KLVD 3KDPB 4DOJA 3L70D 1KB9I 1NAYA 1BGYD 1LWUC 1SQPK 3TGUJ 1HGZA 5AW1B 3H1JD 1FJPA 3P8MC 1M90Q 1JY3P 3L74D 2QJYB 1XTGB 1L0LD 1S1CX 3D6ZA 1RF1C 1QEXA 1QLED 4WY4A 4W7YA 1S3JA 1AVYA 1FZGA 1BCCJ 1L0LE 1JMMA 3GF7A 1FU1A 5AVZB 3E1IA 1BDCA 1KILB 3OJAB 3CC2P 1VQMP 1NHLA 3E1RA 3A3YB 1NVOA 1RE3A 2QEXP 2YKOA 3BRTB 1HF9A 1BCCD 1LNQA 1LTJA 2FYUK 2IYPA 3M0DA 4JYBA 1NTZK 2KIKA 2NRGA 2R5DA 1X22A 3IF4A 2V7QJ 2FYUG 1M1JC 1NU1G 3GHGA 1IO4A 1JY2P 1CZQA 2K1AA 2XNXA 5CCGC 1LP1B 2OYHB 2HFED 2OARA 1RE4C 3BCCJ 2KS1B 4B86A 4OGQC 3GG2A 3L70J 1FDMA 3H1KJ 2KNCA 3BRVB 1E79H 1NTKK 3H32B 4MN4C 5AVRB 1VQOP 1S9KD 1SQVD 2E75C 2IZ1A 2QVAA 3HE5B 3B5NB 3L4FA 3IFMA 4IL6X 1QL1A 4KJMA 5AW2B 2KUBA 1GU5A 2WSFH 3QWOC 5GTHE 3CD6P 5AW8B 2FYNC 5APVA 4HH2A 3AE9C 1DD4A 1PFIA 1EDLA 3AECC 3H1ID 2FXOA 4PD4E 3LW5H 1Q90D 5GTHH 3RL0g 2XZRA 3K5BA 1N73B 4PV1B 3RBXA 1X79B 3CWBG 1EZVI 1H88A 1EQ7A 1RE4A 1SFCA 2FYUJ 3H1HJ 2E74B 1GTWA 1N7LA 1OMIA 5B5EH 3L73E 4UB6H 4ZKUA 1KC8Q 3L74E 4LGDE 3CXHE 3O6QA 3JCUH 2D2CC 5AW6B 3V2RA 1JNMA 3AE8C 2IBZD 3CMAP 1KV4A 3BVHA 5L8RJ 5BVZA 1FDIA 1YQ3C 1PL5A 4UB6E 1SQQK 1R8EA 3RGUA 1QVFO 1W2EA 1N73C 3L75D 4L74A 2QJKC 4D6TD 2QG4A 4I7ZB 1FZCB 1VDFA 2J5UA 2NZ2A 3Q3DA 1SQXK 2N1TA 3M06A 2FKWB 2E75B 2KSJA 3PJSK 3TK1A 3TGUD 1NTKG 1JY3O 2OYOA 3P8CE 3VMXA 1SLQA 3L70G 1CW5A 2IFMA 4I2LC 1M57D 3FWLA 4I1LA 4U3FE 4U3FG 1IFIA 3RL0C 5GTIE 1GL2B 2HPCA 3V4QA 3CMEP 1NKZB 1ZN5A 2KI7B 2W6AA 3CXHI 3M9QA 1URQD 1R5SA 1N7SC 2WSEJ 3H1HD 1EZVG 1VQKP 1KORA 5KJ7C 1P84H 3HTKB 2Q5UA 2BEZF 3OA7A 3RK3E 3SFEC 2BCCE 1SS1A 2OTKE 1CI6A 1OVUA 3CWBJ 3L73D 5C39A 2WQYC 3PLNA 5B66H 1AJYA 1EC5A 1L4AA 1OXZA 1KILC 2A45G 2J59M 2M3BA 2PGDA 2A45I 2M5AB 1SQBJ 2GUSA 3OAKA 3WUVA 4JPZB 3WU2H 1NH4A 3LW5J 1LT9C 2P2UA 3B5ND 1YQ4C 3CCUP 2OTLP 2WSCH 1Y8AA 5CCGA 1DD3A 1YI2P 2W27A 4PD4I 3AE2C 1VF5C 1IFJA 1KB9E 2KNCB 1M56D 1NTZE 1GD2E 1SVFA 5APQA 2B87A 2A06E 4DJGA 4C46A 1LTJC 3M0DC 1FDOA 3AEBC 3RK2D 4OH8B 1GL2C 3V2QA 1KB9H 2E75D 4Z1MH 1SQVE 3HUSA 2P10A 1FZEA 5E79E 4ASVA 3L37A 5APUA 4D6TJ 4ZMDA 1K9MQ 3CX5E 1EXIA 2K3RA 2JR8A 3B8EB 3MUDA 4U7JA 1ZR2A 2ZFCA 1DH3A 2KZIA 3Q2YA 2Q1KA 1KILD 1K04A 4K3AA 1NYHA 2E76C 3CCEP 1Q81Q 3H25A 1GW4A 1LTTC 2YMKA 1P84D 2E74D 1JO5A 1L0LJ 1NKNA 2O01H 3NXSA 3W67A 5KLIB 1T3UA 1KILE 1WMKA 3KZIH 4W7ZA 5H2FE 2Z4EA 1QX8A 2Y0DA 3D71A 3GW6A 4PV1D 2CK3H 3L72E 5CHXA 3HUSB 4WBAA 4DT0A 4ZNCA 4AUWA 3P7KA 2BCCG 1KN7A 2JEEA 3A0HE 1BSHA 3JC22 3M91A 2HLOA 1MFZA 3H1IJ 3CC7P 1FZBA 2KP8A 4CPGA 1ZRTE 1S9KE 2SPZA 1FJKA 3HUSC 1NTKJ 1S72P 5CMZA 3L70E 1SQQE 2OQQA 2K88A 3L71D 1SQBK 4GIFA 4GKGA 3AEAC 2QJPC 2VRSA 3V6IA 3BCCD 1LP1A 1OW7A 2LXCB 1T2KD 1AA0A 3VYIA 2QSIA 2OYHA 2FFDB 1GZLA 1K73Q 1J1DB 1HJ0A 3A7OA 2WTYA 3BASA 5GTIH 1MFTA 4WVZA 4UB8E 1QGKB 1RH5B 2FXPA 2IBZG 1KQFB 1Y47A 3TNUA 3V5BA 2FFDC 4BRYB 4BRYA 3U1CA 2OYHC 1DEBA 2NPSD 5CCHA 3RK3D 2JJLA 1JUNA 2DW3A 3H1IG 2Q6QA 3L35A 3H1HE 1IJDB 1K05A 1FE6A 1JTHB 1L4AD 1P84E 4EIJA 2HPCB 3S9OA 3L74J 2ITAA 4L76A 2ZT9D 3H1JJ 3B5NA 1KD1Q 4Y99B 1EDKA 1S5LX 1BGYJ 1HVVA 1M1JA 1FZAA 1WRGA 2YIUC 3H1LE 3M9BA 3CCLP 2C0WA 1KFMA 3O6QB 1OX3A 1VL2A 5KLVJ 3BATA 2JWDA 2XV5A 3UIAA 1VF5D 3ABVC 2W6JH 2E5TA 4JQ0D 3B71A 3KPEA 4D6TG 1OVVA 2FBWC 3PTZA 4N6JA 4OGQD 5KAIH 4IFDK 1SFCC 1KB9D 1N73A 1GDTA 1LGHB 4U3FJ 1HGVA 1HWTC 2QE7H 1U7MA 1HH0A 1PIXA 2AXCA 3SSUA 3WMM0 2R3CA 1NTMJ 2NPSC 1USDA 1NTMG 3CX5H 5AW3B 1KYOI 1L0NE 3KQGA 3PP5A 3MIWA 1CI6B 3MP7B 2ZJSE 1YBKA 1IC2A 1S5LE 2E5YA 1AFOA 1M8OB 2M0BA 4H44D 1OZHA 2XU6A 5AW0B 3G9RA 1N8RQ 4BXLA 1M7LA 4HYTB 5CCHD 1H89A 2WSEH 1BE3D 2BCCJ 1YHQP 5TISH 1DX7A 2IBZI 1IK9A 5KLVG 3CWBE 4C7NB 3W68A 1LTAC 3FGAD 1JCDA 2QIWA 1KYOD 2H8PD 3KZIE 3VMYA 1RQVA 3A5TA 1VQ5P 2N1TB 1RHZB 5KLVK 2ZAEB 5TISE 2Y0CA 1VPCA 3CI9A 1LTSC 2WPRA 4PD4H 1OWAA 4YPCA 3HD7C 4YTPC 3H1KG 3ITKA 3NTNA 4H0LD 2PP6A 1NGMB 3VTPC 2QA4P 1HJBA 1JEKA 2C9LY 1L0LK 1NTZJ 3EWKA 3P8CD 1WT6A 2Q9IA 2HODB 2W6BA 3HE4A 4RKUJ 3CCQP 5CBNA 3T97A 4WY4D 1YITP 2OTJP 1NU1D 3S4RA 1EZVE 5APTA 5APXA 4H13B 4H44C 3CPWO 1DIPA 4C7NA 3GHGC 1H0TB 4D6TE 1KZUB 2KOGA 1PPJG 1Y9BA 3CL3D 3TNUB 2Z5IA 3RL0B 5KKZC 1IZNB 2NPSA 3AEGC 4IFMA 3NFQA 2QRXA 2JO1A 5K5GB 4RESB 2FXMA 3B5NC 1NJIQ 1QVGO 4QMAA 4EI2A 1RQUA 3TYYA 2H89C 1G1IA 3I56P 2Y9ZA 2QM8A 1L0NK 3H1JG 5AVUB 5KJ7D 2ZVOB 1BGYG 3L72J 2MKVA 4NPEA 1FZCC 3CCSP 5CJ0A 1RF1A 3PRJA 2P7JA 2O1KA 5BU5A 3H1IE 4PD4D 5AVWB 1SQPD 1JCCA 2M5AA 3GHGB 3I5CA 4XE5B 2Y0EA 4N78D 2D2CD 1N7SD 5B5EE 2E74C 1NTKE 1U57A 2YNYA 3GF3A 4R4LA 3Q1MA 1VQ9P 4K35A 2KS1A 4HJGH 4L75A 3CX5D 1SQQJ 5AW4B 1PP9J 3V2PA 1N2DC 2GM4A 1IFNA 2H7HA 5B66E 3EFFK 1OVRA 4C7RA 1SFCD 3M9HA 2ZVNB 2KB7P 2H88C 1RF0A 3HD7B 3M0AA 3R4YA 1ZV8A 1D7MA 1IFMA 1OFCX 2I1KA 4TLFA 5KLIC 4M3LA 1NTZD 3MZWB 1L2PA 4GOEA 5APSA 2E76B 3VMAA 1SQQD 2HODA 3HE4B 4H0LB 4NPFX 1PPJE 3VOPA 2Y9YA 4EDFA 2G3AA 2KSEA 1N7SB 1SQXD 3U1AA 4ZKPA 3CCRP 1VQPP 4GT1A 2IDBA 2N1TD 2PFXA 3LIEA 1SQPJ 2OYIB 2AXTE 1SQPG 3C1LA 5AW7B 4AQRD 3G4SP 1L0ND 1N86A 3D6YA 1PGJA 2GUVA 3HRNA 1AVOA 1GK4A 4Y28J 4EOTA 3HE5A 3L75G 1M1KQ 1VQ8P 3NMDA 1SQQG 1MKMA 3H1JE 5CBOA 2V4HA 2OYIC 1YTZI 2BEQD 2V7QH 1MV8A 1BGYE 3Q5PA 1NTZG 3H1LJ 2RMZA 1A02F 1URQA 4KHXA 5KLVE 2N9BA 1PV3A 3E7KA 2ZYDA 4YXDC 2H43A 1NU1E 1ZP0C 3RL0D 5H2FH 2IZ0A 2PAJA 4DCKA 1SP4A 2KLVA 4AYCA 2KXPB 5DJTB 3H1LD 1LJ2A 2B88A 1JB0J 3CX5I 1J2JB 1X9VA 4Y99C 5KTBA 3KYQA 1Q86Q 2J58A 2LXBA 2R5BA 2KLUA 4WY4B 1NTME 2FFDA 3CCJP 3IN6A 4GDOA 1L0LG 1L0NJ 1LT9A 3L75E 1G2CA 3D70A 1IFDA 3CXHH 3JCUE 2WPSA 3ZDMA 4WWIA 1SQVG 5E79H 1FZFA 1FZCA 1JY3N 2B87B 1PGOA 1KYOH 1SQXJ 2R32A 3L72G 3QH9A 5DJUB 3S1KA 2WVRA 1BE3E 2ZT9B 3CCMP 2B9BA 1FOSF 2WMMA 3CXHD 3F5HA 2FYNB 2E76D 1KQLA 2R3SA 1L4AB 1GW3A 3G3ZA 1JTHA 3A2AA 2P67A 1AQ5A 4IOIH 4O9BA 4UB8H 5AW9B 3I55P 1N7SA 2BCCD 2WWWA 4LC1A 2CPSA 1FS0E 2YKPA 3AE3C 4I7ZC 2A45H 2O1JA 2QJKB 5M1BA 1UIIA 1PP9G 2HYNA 1AQTA 3SWYA 2QM7A 4H13C 3L71E 4H44B 1JY2N 5AVSB 3WUUA 4A7PA 1KILA 1KQSO 3RK3C 1G1JA 2AEMA 2A06G 2KK7A 3A0HH 1PZQA 4IL6E 1NTMD 1Q7YQ 2D2CB 3R2PA 1YJWP 1ZMEC 1H8AA 1JM0A 2Q3IA 1T6AA 3MHVA 1ZRTD 1EDIA 3JSVC 4XFJA 5KJ7A 1LTIC 1KMIZ 2K9YA 2PRRA 1BSNA 2YKQA 4IL6H 1U7JA 4KT0J 3TSIA 3G71P 1W2BO 4PJ0H 3CLQA 1YTZT 2CPBA 3L72D 3N7NA 3H32A 5CCGD 1KTMA 2RKLA 2L91A 3TGUE 3OW2O 1GMJA 2N1TC 4NPDA 1HBWA 4YXWH 3P32A 4R4MA 1GK6A 1ZLLA 3F89A 1OW8A 2JDIH 3MD0A 1LWUA 1LWUB 2FYZA 1BCCE 2C0XA 1GL2A
chains in the Genus database with same CATH topology
3V2NA 1NOHA 1FOSE 5AVTB 2I1JA 5AW5B 4XA4A 2WT7B 1FAVA 1NO4A 1LTBC 1J1EB 1URQC 1X8YA 3VN0A 3VMZA 3VP8A 1CSBA 3L36A 2Z5HA 2XDJA 3HD7D 1LTJB 2NPSB 1SFCB 1T3JA 2Q7CA 1MZ9A 1NTMK 1XTCC 2YO2A 3VP9A 1HTLC 3RK2B 5BU8B 3U59A 1LT9B 3EFGA 1HUCA 1KFNA 3II6A 2YO3A 5AVXB 1RF1B 1RY3A 3RK2C 4LLHA 1Z56A 2LKMA 3O8ZA 1T2KC 2WITA 1RF0C 5AVVB 3MTUE 3C9IA 1MUUA 1G2CB 2L5GB 3IR9A 3HTKA 1NWQA 2IPPA 3H6PA 5APYA 1JY2O 3N4XA 2E43A 1T8ZA 1NAFA 3V4WA 1GU4A 1YYCA 1RE3C 3SWFA 4IFFA 2ZXEB 2HG5D 1J1DC 1FBMA 2WT7A 4JF7A 2M8RA 5CJ4A 2E42A 2OYIA 2BASA 5APWA 1CW5A 2IX7C 2POHA 2WPQA 2WZ7A 5CCHC 3RK3B 2XKMA 3LIDA 1JOCA 1NU1K 3EQ2A 4W80A 2P1JA 2KYVA 3HD7A 1L4AC 1E5WA 1QL2A 5AVYB 3MGNA 2C9NY 2MJZA 1LTGC 2YMYA 4I6MC 4N3YB 4DZOA 1J1EC 1URQB 1SQVK 4WB4A 1ZR4A 5AVQB 4N78E 1GL2D 1M1JB 4JYCA 2IFNA 4WY4C 3KDPB 4DOJA 1LWUC 1SQPK 1HGZA 5AW1B 1FJPA 3P8MC 1JY3P 2GM4A 1RF1C 1XTGB 1A02J 1DH3A 4WY4A 4W7YA 1FZGA 1JMMA 1FU1A 5AVZB 3E1IA 1KILB 3OJAB 1NHLA 3A3YB 1RE3A 2YKOA 3BRTB 2FYUK 1LTJA 3M0DA 4JYBA 1NTZK 2R5DA 3GHGA 1M1JC 1IO4A 1JY2P 1CZQA 2XNXA 5CCGC 2OYHB 2HFED 2OARA 1RE4C 4B86A 1FDMA 3BRVB 1NTKK 3H32B 5AVRB 1S9KD 3HE5B 3L4FA 3B5NB 3IFMA 1GU5A 1QL1A 2WSFH 5AW8B 5APVA 4HH2A 1PFIA 3LW5H 2XZRA 1N73B 1X79B 1H88A 1EQ7A 1RE4A 1SFCA 1GTWA 1N7LA 4ZKUA 4LGDE 5AW6B 1JNMA 3V2RA 3BVHA 5BVZA 1SQQK 1W2EA 1N73C 1FZCB 1VDFA 1SQXK 2N1TA 3M06A 2FKWB 2KSJA 3TK1A 1JY3O 3P8CE 3VMXA 1SLQA 2IFMA 4I2LC 4I1LA 3RL0C 1IFIA 1GL2B 2HPCA 3V4QA 1NKZB 1ZN5A 2W6AA 3M9QA 1URQD 1N7SC 5KJ7C 3HTKB 2Q5UA 3OA7A 1CI6A 1L4AA 1OXZA 1KILC 2A45G 2J59M 2M3BA 2A45I 2GUSA 3OAKA 1NH4A 1LT9C 2P2UA 3B5ND 2WSCH 5CCGA 2W27A 1IFJA 1GD2E 1SVFA 5APQA 4C46A 1LTJC 3M0DC 3RK2D 4OH8B 1GL2C 3V2QA 5BU5A 3HUSA 1FZEA 3L37A 5APUA 3B8EB 3MUDA 1ZR2A 2ZFCA 1KILD 1GW4A 1LTTC 1JO5A 1NKNA 2O01H 3NXSA 1T3UA 4W7ZA 2Z4EA 4AUWA 5CHXA 3HUSB 4WBAA 3P7KA 2JEEA 3M91A 2HLOA 1MFZA 1FZBA 2KP8A 1FJKA 3HUSC 5CMZA 1SQBK 4GIFA 4GKGA 2VRSA 2OYHA 1T2KD 3VYIA 2FFDB 1GZLA 1J1DB 3A7OA 2WTYA 3BASA 3V5BA 2FFDC 3TNUA 3U1CA 2OYHC 1DEBA 2NPSD 5CCHA 3RK3D 2JJLA 1JUNA 3L35A 1IJDB 1L4AD 1JTHB 4EIJA 2HPCB 3B5NA 4Y99B 3M9BA 1HVVA 1M1JA 1FZAA 1WRGA 2C0WA 1KFMA 3BATA 2XV5A 3UIAA 3KPEA 4N6JA 4IFDK 1SFCC 1N73A 1GDTA 1LGHB 1HGVA 1HWTC 1HH0A 3WMM0 2R3CA 5AW3B 2NPSC 3KQGA 3PP5A 5AW2B 3MIWA 1CI6B 1AFOA 1IC2A 5AW0B 2XU6A 1M7LA 4HYTB 5CCHD 1H89A 2WSEH 1DX7A 1IK9A 4C7NB 1LTAC 1JCDA 2H8PD 3VMYA 3A5TA 2N1TB 5KLVK 1VPCA 3CI9A 1LTSC 2WPRA 1OWAA 3HD7C 3NTNA 2PP6A 1HJBA 3VTPC 2C9LY 1L0LK 3P8CD 1WT6A 2Q9IA 2HODB 2W6BA 3HE4A 3T97A 4WY4D 5APTA 5APXA 4C7NA 3GHGC 1KZUB 2KOGA 3CL3D 3TNUB 2Z5IA 3RL0B 2NPSA 4IFMA 3NFQA 4RESB 2FXMA 3B5NC 3TYYA 1G1IA 2QM8A 1L0NK 5KJ7D 5AVUB 5CJ0A 1RF1A 2P7JA 2O1KA 5AVWB 1JCCA 3GHGB 3I5CA 4XE5B 4N78D 1N7SD 2YNYA 5AW4B 3V2PA 1N2DC 1IFNA 2H7HA 4C7RA 1SFCD 3M9HA 2KB7P 3HD7B 1RF0A 3M0AA 1ZV8A 1IFMA 2I1KA 4M3LA 5APSA 2HODA 3HE4B 3VOPA 1N7SB 3U1AA 4ZKPA 4GT1A 2N1TD 3LIEA 2OYIB 5AW7B 4AQRD 1N86A 2GUVA 3HRNA 4EOTA 1GK4A 3HE5A 3NMDA 2OYIC 1YTZI 1MV8A 1A02F 1URQA 4KHXA 2N9BA 2H43A 3RL0D 2PAJA 1SP4A 2KLVA 4AYCA 1J2JB 1X9VA 4Y99C 5KTBA 3KYQA 2J58A 2R5BA 4WY4B 2FFDA 1LT9A 1G2CA 1IFDA 2WPSA 1FZFA 1FZCA 1JY3N 2R32A 1FOSF 1KQLA 1L4AB 3G3ZA 1GW3A 1JTHA 3A2AA 2P67A 1AQ5A 4O9BA 5AW9B 1N7SA 2WWWA 4LC1A 2CPSA 2YKPA 1FZCC 2A45H 2O1JA 2HYNA 3SWYA 2QM7A 5AVSB 1JY2N 1KILA 3RK3C 1G1JA 3R2PA 1H8AA 2Q3IA 5KJ7A 1LTIC 2YKQA 1S9KE 3TSIA 3CLQA 1YTZT 2CPBA 3N7NA 3H32A 5CCGD 2N1TC 1HBWA 3P32A 1GK6A 1ZLLA 3MD0A 1LWUA 1LWUB 2FYZA 2C0XA 1GL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJP A;  2KB7 P;  2M3B A;  1ZLL A;  2HYN A;  1N7L A;  1FJK A;  2KYV A; 
#chains in the Genus database with same CATH topology
 4HKZ H;  1NOH A;  3V2N A;  4ASW A;  2JWA A;  1FOS E;  5AVT B;  3H1L G;  2I1J A;  2IBZ E;  1EXJ A;  2AXT H;  5AW5 B;  4XA4 A;  1Q82 Q;  2ZYA A;  2WT7 B;  3GMA A;  1FAV A;  1NO4 A;  1LTB C;  2AEJ A;  1J1E B;  1URQ C;  1X8Y A;  3MUD C;  3VN0 A;  3KXD A;  1K8A Q;  3VMZ A;  3VP8 A;  1CSB A;  4H13 D;  3L36 A;  3SFD C;  2XND H;  3H1H G;  1YIJ P;  2Z5H A;  1VQL P;  5KAF H;  2XDJ A;  3HD7 D;  2A06 D;  1LTJ B;  2NPS B;  1SFC B;  1T3J A;  3L73 G;  2Q7C A;  3BCC E;  1PPJ D;  4RJT A;  2HR3 A;  2RH0 A;  3H1K E;  1PP9 E;  1PP9 D;  3C8V A;  5KAF E;  1MZ9 A;  1EDJ A;  1NTM K;  1XTC C;  2P58 A;  1OW6 A;  1USE A;  2YO2 A;  3VP9 A;  1EZV D;  2R44 A;  1HTL C;  3G6E P;  4HB1 A;  3RK2 B;  5BU8 B;  3U59 A;  5EFW B;  1LT9 B;  2LR2 A;  2YXR B;  1HUC A;  3EFG A;  1KFN A;  3II6 A;  3T97 B;  1ZW0 A;  2YO3 A;  3AED C;  3GLM A;  2JKV A;  2YIU B;  3FXD A;  5AVX B;  1DEE G;  1SQX G;  3WU2 E;  1W5C E;  2QJY C;  1RY3 A;  3RK2 C;  2WSF J;  4LLH A;  1Z56 A;  3RBZ A;  1R5L A;  1RF1 B;  1BE3 G;  2O3J A;  2LKM A;  3O8Z A;  5TJH A;  4EYY Q;  2WIT A;  1RF0 C;  2OGU A;  1T2K C;  1AV1 A;  5AVV B;  1SQB D;  3MTU E;  1A02 J;  1PGP A;  2Q3E A;  2FYU E;  1LT1 A;  1SQP E;  1VQ4 P;  1KYO E;  3C9I A;  1MUU A;  1S4X A;  3AE4 C;  1G2C B;  3IAO A;  3L73 J;  3CCV P;  2L5G B;  1TU3 F;  3Q5R A;  1S5L H;  2WPV B;  3AE6 C;  3CC4 P;  3AEE C;  3FX0 A;  4GOD A;  1ZXG A;  3IR9 A;  3HTK A;  1BDD A;  1NWQ A;  2IPP A;  2W8Z A;  4OWF A;  1H0T A;  3H6P A;  1VQ7 P;  3SWK A;  3FXE A;  5APY A;  3WUT A;  1JY2 O;  3N4X A;  2GA1 A;  2E43 A;  1T8Z A;  3TDK A;  1NAF A;  1UIX A;  3PH0 A;  3V4W A;  1GU4 A;  1PGQ A;  1YYC A;  1RE3 C;  2QJP B;  5KKZ B;  3SWF A;  1NU1 J;  2O01 J;  4IFF A;  1IK7 A;  2ZXE B;  2ZT9 C;  1SQB G;  2HG5 D;  1JMB A;  1J1D C;  1FBM A;  4OVN F;  4RO0 A;  2WT7 A;  4JF7 A;  2K37 A;  2M8R A;  3A0B H;  3KHU A;  2B89 A;  5CJ4 A;  3TGU G;  3TF5 A;  2E42 A;  4TT3 H;  3USS A;  1YJ9 P;  2G8Y A;  4JBZ A;  2BAS A;  5APW A;  2KZJ A;  3A0B E;  2OYI A;  2IX7 C;  1L0N G;  2POH A;  4PJ0 E;  2WPQ A;  1YJN P;  3L75 J;  2FY8 A;  2WZ7 A;  3FWN A;  5CCH C;  3PHL A;  1KQG B;  2W90 A;  2RN0 A;  2UWJ E;  3B4S A;  3Q5S A;  2K9J A;  3AEF C;  1SQX E;  3AE7 C;  3AE5 C;  1S2E A;  3RK3 B;  1ZOY C;  1BE3 J;  2IYO A;  2N9Y B;  2XKM A;  1JOC A;  3LID A;  4L73 A;  1NU1 K;  4PV1 C;  1P84 I;  3EQ2 A;  1VQ6 P;  4W80 A;  2FYU D;  1VQN P;  2P1J A;  1SQB E;  1Q2N A;  1IFP A;  3CWB D;  2YXQ B;  2W83 C;  2KYV A;  1BCC G;  3HD7 A;  2I8D A;  3BCC G;  3L74 G;  1L4A C;  5KAI E;  1E5W A;  1FC2 C;  1X0T A;  2ZXX A;  1QL2 A;  5AVY B;  4U3F D;  1OIP A;  3L71 G;  3MGN A;  3L71 J;  2O01 N;  3AE1 C;  2MJZ A;  4GOF A;  2JP3 A;  2C9N Y;  1LTG C;  2WSS H;  2M3E A;  2YMY A;  4I6M C;  4OGQ B;  2K9J B;  1NTK D;  2WSC J;  4N3Y B;  4DZO A;  1J1E C;  1URQ B;  1SQV K;  4WB4 A;  1ZR4 A;  5AVQ B;  2AEF A;  4N78 E;  1VF5 B;  1SQV J;  4BWN A;  1GL2 D;  1M1J B;  2ZYG A;  4JYC A;  2IFN A;  4H0L C;  4WY4 C;  3H1K D;  5KLV D;  3KDP B;  4DOJ A;  3L70 D;  1KB9 I;  1NAY A;  1BGY D;  1LWU C;  1SQP K;  3TGU J;  1HGZ A;  5AW1 B;  3H1J D;  1FJP A;  3P8M C;  1M90 Q;  1JY3 P;  3L74 D;  2QJY B;  1XTG B;  1L0L D;  1S1C X;  3D6Z A;  1RF1 C;  1QEX A;  1QLE D;  4WY4 A;  4W7Y A;  1S3J A;  1AVY A;  1FZG A;  1BCC J;  1L0L E;  1JMM A;  3GF7 A;  1FU1 A;  5AVZ B;  3E1I A;  1BDC A;  1KIL B;  3OJA B;  3CC2 P;  1VQM P;  1NHL A;  3E1R A;  3A3Y B;  1NVO A;  1RE3 A;  2QEX P;  2YKO A;  3BRT B;  1HF9 A;  1BCC D;  1LNQ A;  1LTJ A;  2FYU K;  2IYP A;  3M0D A;  4JYB A;  1NTZ K;  2KIK A;  2NRG A;  2R5D A;  1X22 A;  3IF4 A;  2V7Q J;  2FYU G;  1M1J C;  1NU1 G;  3GHG A;  1IO4 A;  1JY2 P;  1CZQ A;  2K1A A;  2XNX A;  5CCG C;  1LP1 B;  2OYH B;  2HFE D;  2OAR A;  1RE4 C;  3BCC J;  2KS1 B;  4B86 A;  4OGQ C;  3GG2 A;  3L70 J;  1FDM A;  3H1K J;  2KNC A;  3BRV B;  1E79 H;  1NTK K;  3H32 B;  4MN4 C;  5AVR B;  1VQO P;  1S9K D;  1SQV D;  2E75 C;  2IZ1 A;  2QVA A;  3HE5 B;  3B5N B;  3L4F A;  3IFM A;  4IL6 X;  1QL1 A;  4KJM A;  5AW2 B;  2KUB A;  1GU5 A;  2WSF H;  3QWO C;  5GTH E;  3CD6 P;  5AW8 B;  2FYN C;  5APV A;  4HH2 A;  3AE9 C;  1DD4 A;  1PFI A;  1EDL A;  3AEC C;  3H1I D;  2FXO A;  4PD4 E;  3LW5 H;  1Q90 D;  5GTH H;  3RL0 g;  2XZR A;  3K5B A;  1N73 B;  4PV1 B;  3RBX A;  1X79 B;  3CWB G;  1EZV I;  1H88 A;  1EQ7 A;  1RE4 A;  1SFC A;  2FYU J;  3H1H J;  2E74 B;  1GTW A;  1N7L A;  1OMI A;  5B5E H;  3L73 E;  4UB6 H;  4ZKU A;  1KC8 Q;  3L74 E;  4LGD E;  3CXH E;  3O6Q A;  3JCU H;  2D2C C;  5AW6 B;  3V2R A;  1JNM A;  3AE8 C;  2IBZ D;  3CMA P;  1KV4 A;  3BVH A;  5L8R J;  5BVZ A;  1FDI A;  1YQ3 C;  1PL5 A;  4UB6 E;  1SQQ K;  1R8E A;  3RGU A;  1QVF O;  1W2E A;  1N73 C;  3L75 D;  4L74 A;  2QJK C;  4D6T D;  2QG4 A;  4I7Z B;  1FZC B;  1VDF A;  2J5U A;  2NZ2 A;  3Q3D A;  1SQX K;  2N1T A;  3M06 A;  2FKW B;  2E75 B;  2KSJ A;  3PJS K;  3TK1 A;  3TGU D;  1NTK G;  1JY3 O;  2OYO A;  3P8C E;  3VMX A;  1SLQ A;  3L70 G;  1CW5 A;  2IFM A;  4I2L C;  1M57 D;  3FWL A;  4I1L A;  4U3F E;  4U3F G;  1IFI A;  3RL0 C;  5GTI E;  1GL2 B;  2HPC A;  3V4Q A;  3CME P;  1NKZ B;  1ZN5 A;  2KI7 B;  2W6A A;  3CXH I;  3M9Q A;  1URQ D;  1R5S A;  1N7S C;  2WSE J;  3H1H D;  1EZV G;  1VQK P;  1KOR A;  5KJ7 C;  1P84 H;  3HTK B;  2Q5U A;  2BEZ F;  3OA7 A;  3RK3 E;  3SFE C;  2BCC E;  1SS1 A;  2OTK E;  1CI6 A;  1OVU A;  3CWB J;  3L73 D;  5C39 A;  2WQY C;  3PLN A;  5B66 H;  1AJY A;  1EC5 A;  1L4A A;  1OXZ A;  1KIL C;  2A45 G;  2J59 M;  2M3B A;  2PGD A;  2A45 I;  2M5A B;  1SQB J;  2GUS A;  3OAK A;  3WUV A;  4JPZ B;  3WU2 H;  1NH4 A;  3LW5 J;  1LT9 C;  2P2U A;  3B5N D;  1YQ4 C;  3CCU P;  2OTL P;  2WSC H;  1Y8A A;  5CCG A;  1DD3 A;  1YI2 P;  2W27 A;  4PD4 I;  3AE2 C;  1VF5 C;  1IFJ A;  1KB9 E;  2KNC B;  1M56 D;  1NTZ E;  1GD2 E;  1SVF A;  5APQ A;  2B87 A;  2A06 E;  4DJG A;  4C46 A;  1LTJ C;  3M0D C;  1FDO A;  3AEB C;  3RK2 D;  4OH8 B;  1GL2 C;  3V2Q A;  1KB9 H;  2E75 D;  4Z1M H;  1SQV E;  3HUS A;  2P10 A;  1FZE A;  5E79 E;  4ASV A;  3L37 A;  5APU A;  4D6T J;  4ZMD A;  1K9M Q;  3CX5 E;  1EXI A;  2K3R A;  2JR8 A;  3B8E B;  3MUD A;  4U7J A;  1ZR2 A;  2ZFC A;  1DH3 A;  2KZI A;  3Q2Y A;  2Q1K A;  1KIL D;  1K04 A;  4K3A A;  1NYH A;  2E76 C;  3CCE P;  1Q81 Q;  3H25 A;  1GW4 A;  1LTT C;  2YMK A;  1P84 D;  2E74 D;  1JO5 A;  1L0L J;  1NKN A;  2O01 H;  3NXS A;  3W67 A;  5KLI B;  1T3U A;  1KIL E;  1WMK A;  3KZI H;  4W7Z A;  5H2F E;  2Z4E A;  1QX8 A;  2Y0D A;  3D71 A;  3GW6 A;  4PV1 D;  2CK3 H;  3L72 E;  5CHX A;  3HUS B;  4WBA A;  4DT0 A;  4ZNC A;  4AUW A;  3P7K A;  2BCC G;  1KN7 A;  2JEE A;  3A0H E;  1BSH A;  3JC2 2;  3M91 A;  2HLO A;  1MFZ A;  3H1I J;  3CC7 P;  1FZB A;  2KP8 A;  4CPG A;  1ZRT E;  1S9K E;  2SPZ A;  1FJK A;  3HUS C;  1NTK J;  1S72 P;  5CMZ A;  3L70 E;  1SQQ E;  2OQQ A;  2K88 A;  3L71 D;  1SQB K;  4GIF A;  4GKG A;  3AEA C;  2QJP C;  2VRS A;  3V6I A;  3BCC D;  1LP1 A;  1OW7 A;  2LXC B;  1T2K D;  1AA0 A;  3VYI A;  2QSI A;  2OYH A;  2FFD B;  1GZL A;  1K73 Q;  1J1D B;  1HJ0 A;  3A7O A;  2WTY A;  3BAS A;  5GTI H;  1MFT A;  4WVZ A;  4UB8 E;  1QGK B;  1RH5 B;  2FXP A;  2IBZ G;  1KQF B;  1Y47 A;  3TNU A;  3V5B A;  2FFD C;  4BRY B;  4BRY A;  3U1C A;  2OYH C;  1DEB A;  2NPS D;  5CCH A;  3RK3 D;  2JJL A;  1JUN A;  2DW3 A;  3H1I G;  2Q6Q A;  3L35 A;  3H1H E;  1IJD B;  1K05 A;  1FE6 A;  1JTH B;  1L4A D;  1P84 E;  4EIJ A;  2HPC B;  3S9O A;  3L74 J;  2ITA A;  4L76 A;  2ZT9 D;  3H1J J;  3B5N A;  1KD1 Q;  4Y99 B;  1EDK A;  1S5L X;  1BGY J;  1HVV A;  1M1J A;  1FZA A;  1WRG A;  2YIU C;  3H1L E;  3M9B A;  3CCL P;  2C0W A;  1KFM A;  3O6Q B;  1OX3 A;  1VL2 A;  5KLV J;  3BAT A;  2JWD A;  2XV5 A;  3UIA A;  1VF5 D;  3ABV C;  2W6J H;  2E5T A;  4JQ0 D;  3B71 A;  3KPE A;  4D6T G;  1OVV A;  2FBW C;  3PTZ A;  4N6J A;  4OGQ D;  5KAI H;  4IFD K;  1SFC C;  1KB9 D;  1N73 A;  1GDT A;  1LGH B;  4U3F J;  1HGV A;  1HWT C;  2QE7 H;  1U7M A;  1HH0 A;  1PIX A;  2AXC A;  3SSU A;  3WMM 0;  2R3C A;  1NTM J;  2NPS C;  1USD A;  1NTM G;  3CX5 H;  5AW3 B;  1KYO I;  1L0N E;  3KQG A;  3PP5 A;  3MIW A;  1CI6 B;  3MP7 B;  2ZJS E;  1YBK A;  1IC2 A;  1S5L E;  2E5Y A;  1AFO A;  1M8O B;  2M0B A;  4H44 D;  1OZH A;  2XU6 A;  5AW0 B;  3G9R A;  1N8R Q;  4BXL A;  1M7L A;  4HYT B;  5CCH D;  1H89 A;  2WSE H;  1BE3 D;  2BCC J;  1YHQ P;  5TIS H;  1DX7 A;  2IBZ I;  1IK9 A;  5KLV G;  3CWB E;  4C7N B;  3W68 A;  1LTA C;  3FGA D;  1JCD A;  2QIW A;  1KYO D;  2H8P D;  3KZI E;  3VMY A;  1RQV A;  3A5T A;  1VQ5 P;  2N1T B;  1RHZ B;  5KLV K;  2ZAE B;  5TIS E;  2Y0C A;  1VPC A;  3CI9 A;  1LTS C;  2WPR A;  4PD4 H;  1OWA A;  4YPC A;  3HD7 C;  4YTP C;  3H1K G;  3ITK A;  3NTN A;  4H0L D;  2PP6 A;  1NGM B;  3VTP C;  2QA4 P;  1HJB A;  1JEK A;  2C9L Y;  1L0L K;  1NTZ J;  3EWK A;  3P8C D;  1WT6 A;  2Q9I A;  2HOD B;  2W6B A;  3HE4 A;  4RKU J;  3CCQ P;  5CBN A;  3T97 A;  4WY4 D;  1YIT P;  2OTJ P;  1NU1 D;  3S4R A;  1EZV E;  5APT A;  5APX A;  4H13 B;  4H44 C;  3CPW O;  1DIP A;  4C7N A;  3GHG C;  1H0T B;  4D6T E;  1KZU B;  2KOG A;  1PPJ G;  1Y9B A;  3CL3 D;  3TNU B;  2Z5I A;  3RL0 B;  5KKZ C;  1IZN B;  2NPS A;  3AEG C;  4IFM A;  3NFQ A;  2QRX A;  2JO1 A;  5K5G B;  4RES B;  2FXM A;  3B5N C;  1NJI Q;  1QVG O;  4QMA A;  4EI2 A;  1RQU A;  3TYY A;  2H89 C;  1G1I A;  3I56 P;  2Y9Z A;  2QM8 A;  1L0N K;  3H1J G;  5AVU B;  5KJ7 D;  2ZVO B;  1BGY G;  3L72 J;  2MKV A;  4NPE A;  1FZC C;  3CCS P;  5CJ0 A;  1RF1 A;  3PRJ A;  2P7J A;  2O1K A;  5BU5 A;  3H1I E;  4PD4 D;  5AVW B;  1SQP D;  1JCC A;  2M5A A;  3GHG B;  3I5C A;  4XE5 B;  2Y0E A;  4N78 D;  2D2C D;  1N7S D;  5B5E E;  2E74 C;  1NTK E;  1U57 A;  2YNY A;  3GF3 A;  4R4L A;  3Q1M A;  1VQ9 P;  4K35 A;  2KS1 A;  4HJG H;  4L75 A;  3CX5 D;  1SQQ J;  5AW4 B;  1PP9 J;  3V2P A;  1N2D C;  2GM4 A;  1IFN A;  2H7H A;  5B66 E;  3EFF K;  1OVR A;  4C7R A;  1SFC D;  3M9H A;  2ZVN B;  2KB7 P;  2H88 C;  1RF0 A;  3HD7 B;  3M0A A;  3R4Y A;  1ZV8 A;  1D7M A;  1IFM A;  1OFC X;  2I1K A;  4TLF A;  5KLI C;  4M3L A;  1NTZ D;  3MZW B;  1L2P A;  4GOE A;  5APS A;  2E76 B;  3VMA A;  1SQQ D;  2HOD A;  3HE4 B;  4H0L B;  4NPF X;  1PPJ E;  3VOP A;  2Y9Y A;  4EDF A;  2G3A A;  2KSE A;  1N7S B;  1SQX D;  3U1A A;  4ZKP A;  3CCR P;  1VQP P;  4GT1 A;  2IDB A;  2N1T D;  2PFX A;  3LIE A;  1SQP J;  2OYI B;  2AXT E;  1SQP G;  3C1L A;  5AW7 B;  4AQR D;  3G4S P;  1L0N D;  1N86 A;  3D6Y A;  1PGJ A;  2GUV A;  3HRN A;  1AVO A;  1GK4 A;  4Y28 J;  4EOT A;  3HE5 A;  3L75 G;  1M1K Q;  1VQ8 P;  3NMD A;  1SQQ G;  1MKM A;  3H1J E;  5CBO A;  2V4H A;  2OYI C;  1YTZ I;  2BEQ D;  2V7Q H;  1MV8 A;  1BGY E;  3Q5P A;  1NTZ G;  3H1L J;  2RMZ A;  1A02 F;  1URQ A;  4KHX A;  5KLV E;  2N9B A;  1PV3 A;  3E7K A;  2ZYD A;  4YXD C;  2H43 A;  1NU1 E;  1ZP0 C;  3RL0 D;  5H2F H;  2IZ0 A;  2PAJ A;  4DCK A;  1SP4 A;  2KLV A;  4AYC A;  2KXP B;  5DJT B;  3H1L D;  1LJ2 A;  2B88 A;  1JB0 J;  3CX5 I;  1J2J B;  1X9V A;  4Y99 C;  5KTB A;  3KYQ A;  1Q86 Q;  2J58 A;  2LXB A;  2R5B A;  2KLU A;  4WY4 B;  1NTM E;  2FFD A;  3CCJ P;  3IN6 A;  4GDO A;  1L0L G;  1L0N J;  1LT9 A;  3L75 E;  1G2C A;  3D70 A;  1IFD A;  3CXH H;  3JCU E;  2WPS A;  3ZDM A;  4WWI A;  1SQV G;  5E79 H;  1FZF A;  1FZC A;  1JY3 N;  2B87 B;  1PGO A;  1KYO H;  1SQX J;  2R32 A;  3L72 G;  3QH9 A;  5DJU B;  3S1K A;  2WVR A;  1BE3 E;  2ZT9 B;  3CCM P;  2B9B A;  1FOS F;  2WMM A;  3CXH D;  3F5H A;  2FYN B;  2E76 D;  1KQL A;  2R3S A;  1L4A B;  1GW3 A;  3G3Z A;  1JTH A;  3A2A A;  2P67 A;  1AQ5 A;  4IOI H;  4O9B A;  4UB8 H;  5AW9 B;  3I55 P;  1N7S A;  2BCC D;  2WWW A;  4LC1 A;  2CPS A;  1FS0 E;  2YKP A;  3AE3 C;  4I7Z C;  2A45 H;  2O1J A;  2QJK B;  5M1B A;  1UII A;  1PP9 G;  2HYN A;  1AQT A;  3SWY A;  2QM7 A;  4H13 C;  3L71 E;  4H44 B;  1JY2 N;  5AVS B;  3WUU A;  4A7P A;  1KIL A;  1KQS O;  3RK3 C;  1G1J A;  2AEM A;  2A06 G;  2KK7 A;  3A0H H;  1PZQ A;  4IL6 E;  1NTM D;  1Q7Y Q;  2D2C B;  3R2P A;  1YJW P;  1ZME C;  1H8A A;  1JM0 A;  2Q3I A;  1T6A A;  3MHV A;  1ZRT D;  1EDI A;  3JSV C;  4XFJ A;  5KJ7 A;  1LTI C;  1KMI Z;  2K9Y A;  2PRR A;  1BSN A;  2YKQ A;  4IL6 H;  1U7J A;  4KT0 J;  3TSI A;  3G71 P;  1W2B O;  4PJ0 H;  3CLQ A;  1YTZ T;  2CPB A;  3L72 D;  3N7N A;  3H32 A;  5CCG D;  1KTM A;  2RKL A;  2L91 A;  3TGU E;  3OW2 O;  1GMJ A;  2N1T C;  4NPD A;  1HBW A;  4YXW H;  3P32 A;  4R4M A;  1GK6 A;  1ZLL A;  3F89 A;  1OW8 A;  2JDI H;  3MD0 A;  1LWU A;  1LWU B;  2FYZ A;  1BCC E;  2C0X A;  1GL2 A; 
#chains in the Genus database with same CATH homology
 3V2N A;  1NOH A;  1FOS E;  5AVT B;  2I1J A;  5AW5 B;  4XA4 A;  2WT7 B;  1FAV A;  1NO4 A;  1LTB C;  1J1E B;  1URQ C;  1X8Y A;  3VN0 A;  3VMZ A;  3VP8 A;  1CSB A;  3L36 A;  2Z5H A;  2XDJ A;  3HD7 D;  1LTJ B;  2NPS B;  1SFC B;  1T3J A;  2Q7C A;  1MZ9 A;  1NTM K;  1XTC C;  2YO2 A;  3VP9 A;  1HTL C;  3RK2 B;  5BU8 B;  3U59 A;  1LT9 B;  3EFG A;  1HUC A;  1KFN A;  3II6 A;  2YO3 A;  5AVX B;  1RF1 B;  1RY3 A;  3RK2 C;  4LLH A;  1Z56 A;  2LKM A;  3O8Z A;  1T2K C;  2WIT A;  1RF0 C;  5AVV B;  3MTU E;  3C9I A;  1MUU A;  1G2C B;  2L5G B;  3IR9 A;  3HTK A;  1NWQ A;  2IPP A;  3H6P A;  5APY A;  1JY2 O;  3N4X A;  2E43 A;  1T8Z A;  1NAF A;  3V4W A;  1GU4 A;  1YYC A;  1RE3 C;  3SWF A;  4IFF A;  2ZXE B;  2HG5 D;  1J1D C;  1FBM A;  2WT7 A;  4JF7 A;  2M8R A;  5CJ4 A;  2E42 A;  2OYI A;  2BAS A;  5APW A;  1CW5 A;  2IX7 C;  2POH A;  2WPQ A;  2WZ7 A;  5CCH C;  3RK3 B;  2XKM A;  3LID A;  1JOC A;  1NU1 K;  3EQ2 A;  4W80 A;  2P1J A;  2KYV A;  3HD7 A;  1L4A C;  1E5W A;  1QL2 A;  5AVY B;  3MGN A;  2C9N Y;  2MJZ A;  1LTG C;  2YMY A;  4I6M C;  4N3Y B;  4DZO A;  1J1E C;  1URQ B;  1SQV K;  4WB4 A;  1ZR4 A;  5AVQ B;  4N78 E;  1GL2 D;  1M1J B;  4JYC A;  2IFN A;  4WY4 C;  3KDP B;  4DOJ A;  1LWU C;  1SQP K;  1HGZ A;  5AW1 B;  1FJP A;  3P8M C;  1JY3 P;  2GM4 A;  1RF1 C;  1XTG B;  1A02 J;  1DH3 A;  4WY4 A;  4W7Y A;  1FZG A;  1JMM A;  1FU1 A;  5AVZ B;  3E1I A;  1KIL B;  3OJA B;  1NHL A;  3A3Y B;  1RE3 A;  2YKO A;  3BRT B;  2FYU K;  1LTJ A;  3M0D A;  4JYB A;  1NTZ K;  2R5D A;  3GHG A;  1M1J C;  1IO4 A;  1JY2 P;  1CZQ A;  2XNX A;  5CCG C;  2OYH B;  2HFE D;  2OAR A;  1RE4 C;  4B86 A;  1FDM A;  3BRV B;  1NTK K;  3H32 B;  5AVR B;  1S9K D;  3HE5 B;  3L4F A;  3B5N B;  3IFM A;  1GU5 A;  1QL1 A;  2WSF H;  5AW8 B;  5APV A;  4HH2 A;  1PFI A;  3LW5 H;  2XZR A;  1N73 B;  1X79 B;  1H88 A;  1EQ7 A;  1RE4 A;  1SFC A;  1GTW A;  1N7L A;  4ZKU A;  4LGD E;  5AW6 B;  1JNM A;  3V2R A;  3BVH A;  5BVZ A;  1SQQ K;  1W2E A;  1N73 C;  1FZC B;  1VDF A;  1SQX K;  2N1T A;  3M06 A;  2FKW B;  2KSJ A;  3TK1 A;  1JY3 O;  3P8C E;  3VMX A;  1SLQ A;  2IFM A;  4I2L C;  4I1L A;  3RL0 C;  1IFI A;  1GL2 B;  2HPC A;  3V4Q A;  1NKZ B;  1ZN5 A;  2W6A A;  3M9Q A;  1URQ D;  1N7S C;  5KJ7 C;  3HTK B;  2Q5U A;  3OA7 A;  1CI6 A;  1L4A A;  1OXZ A;  1KIL C;  2A45 G;  2J59 M;  2M3B A;  2A45 I;  2GUS A;  3OAK A;  1NH4 A;  1LT9 C;  2P2U A;  3B5N D;  2WSC H;  5CCG A;  2W27 A;  1IFJ A;  1GD2 E;  1SVF A;  5APQ A;  4C46 A;  1LTJ C;  3M0D C;  3RK2 D;  4OH8 B;  1GL2 C;  3V2Q A;  5BU5 A;  3HUS A;  1FZE A;  3L37 A;  5APU A;  3B8E B;  3MUD A;  1ZR2 A;  2ZFC A;  1KIL D;  1GW4 A;  1LTT C;  1JO5 A;  1NKN A;  2O01 H;  3NXS A;  1T3U A;  4W7Z A;  2Z4E A;  4AUW A;  5CHX A;  3HUS B;  4WBA A;  3P7K A;  2JEE A;  3M91 A;  2HLO A;  1MFZ A;  1FZB A;  2KP8 A;  1FJK A;  3HUS C;  5CMZ A;  1SQB K;  4GIF A;  4GKG A;  2VRS A;  2OYH A;  1T2K D;  3VYI A;  2FFD B;  1GZL A;  1J1D B;  3A7O A;  2WTY A;  3BAS A;  3V5B A;  2FFD C;  3TNU A;  3U1C A;  2OYH C;  1DEB A;  2NPS D;  5CCH A;  3RK3 D;  2JJL A;  1JUN A;  3L35 A;  1IJD B;  1L4A D;  1JTH B;  4EIJ A;  2HPC B;  3B5N A;  4Y99 B;  3M9B A;  1HVV A;  1M1J A;  1FZA A;  1WRG A;  2C0W A;  1KFM A;  3BAT A;  2XV5 A;  3UIA A;  3KPE A;  4N6J A;  4IFD K;  1SFC C;  1N73 A;  1GDT A;  1LGH B;  1HGV A;  1HWT C;  1HH0 A;  3WMM 0;  2R3C A;  5AW3 B;  2NPS C;  3KQG A;  3PP5 A;  5AW2 B;  3MIW A;  1CI6 B;  1AFO A;  1IC2 A;  5AW0 B;  2XU6 A;  1M7L A;  4HYT B;  5CCH D;  1H89 A;  2WSE H;  1DX7 A;  1IK9 A;  4C7N B;  1LTA C;  1JCD A;  2H8P D;  3VMY A;  3A5T A;  2N1T B;  5KLV K;  1VPC A;  3CI9 A;  1LTS C;  2WPR A;  1OWA A;  3HD7 C;  3NTN A;  2PP6 A;  1HJB A;  3VTP C;  2C9L Y;  1L0L K;  3P8C D;  1WT6 A;  2Q9I A;  2HOD B;  2W6B A;  3HE4 A;  3T97 A;  4WY4 D;  5APT A;  5APX A;  4C7N A;  3GHG C;  1KZU B;  2KOG A;  3CL3 D;  3TNU B;  2Z5I A;  3RL0 B;  2NPS A;  4IFM A;  3NFQ A;  4RES B;  2FXM A;  3B5N C;  3TYY A;  1G1I A;  2QM8 A;  1L0N K;  5KJ7 D;  5AVU B;  5CJ0 A;  1RF1 A;  2P7J A;  2O1K A;  5AVW B;  1JCC A;  3GHG B;  3I5C A;  4XE5 B;  4N78 D;  1N7S D;  2YNY A;  5AW4 B;  3V2P A;  1N2D C;  1IFN A;  2H7H A;  4C7R A;  1SFC D;  3M9H A;  2KB7 P;  3HD7 B;  1RF0 A;  3M0A A;  1ZV8 A;  1IFM A;  2I1K A;  4M3L A;  5APS A;  2HOD A;  3HE4 B;  3VOP A;  1N7S B;  3U1A A;  4ZKP A;  4GT1 A;  2N1T D;  3LIE A;  2OYI B;  5AW7 B;  4AQR D;  1N86 A;  2GUV A;  3HRN A;  4EOT A;  1GK4 A;  3HE5 A;  3NMD A;  2OYI C;  1YTZ I;  1MV8 A;  1A02 F;  1URQ A;  4KHX A;  2N9B A;  2H43 A;  3RL0 D;  2PAJ A;  1SP4 A;  2KLV A;  4AYC A;  1J2J B;  1X9V A;  4Y99 C;  5KTB A;  3KYQ A;  2J58 A;  2R5B A;  4WY4 B;  2FFD A;  1LT9 A;  1G2C A;  1IFD A;  2WPS A;  1FZF A;  1FZC A;  1JY3 N;  2R32 A;  1FOS F;  1KQL A;  1L4A B;  3G3Z A;  1GW3 A;  1JTH A;  3A2A A;  2P67 A;  1AQ5 A;  4O9B A;  5AW9 B;  1N7S A;  2WWW A;  4LC1 A;  2CPS A;  2YKP A;  1FZC C;  2A45 H;  2O1J A;  2HYN A;  3SWY A;  2QM7 A;  5AVS B;  1JY2 N;  1KIL A;  3RK3 C;  1G1J A;  3R2P A;  1H8A A;  2Q3I A;  5KJ7 A;  1LTI C;  2YKQ A;  1S9K E;  3TSI A;  3CLQ A;  1YTZ T;  2CPB A;  3N7N A;  3H32 A;  5CCG D;  2N1T C;  1HBW A;  3P32 A;  1GK6 A;  1ZLL A;  3MD0 A;  1LWU A;  1LWU B;  2FYZ A;  2C0X A;  1GL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...