2M3BA

Serine 16 phosphorylated phospholamban pentamer, hybrid solution and solid-state nmr structural ensemble
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
51
Chain Sequence
MEKVQYLTRSAIRRATIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cardiac phospholamban
publication title Structural Dynamics and Topology of Phosphorylated Phospholamban Homopentamer Reveal Its Role in the Regulation of Calcium Transport.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Membrane protein
total genus 18
structure length 51
sequence length 52
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2m3bA00
2KB7P 1FJPA 1ZLLA 1FJKA 2HYNA 2KYVA 1N7LA 2M3BA
chains in the Genus database with same CATH superfamily
3L74D 2FXMA 1SQBJ 3CX5I 5CCGA 2POHA 3HUSA 1PV3A 1SFCB 1S2EA 3FGAD 2M5AA 4IL6E 3GF7A 2A45I 5AW2B 2MJZA 3CI9A 1SQQK 1M8OB 1X79B 2I8DA 2P1JA 4UB6E 1S5LE 1NTKD 4Z1MH 2OQQA 1FZAA 3VMZA 3CCSP 3P8CD 3D71A 2BCCE 1FOSF 2E5YA 2PFXA 3SWKA 1TU3F 2Z4EA 3L75E 3I5CA 4R4LA 1YQ4C 1RHZB 3CCQP 2KYVA 1EZVE 1NU1K 2Q5UA 5AW0B 3BRTB 3JC22 1NO4A 1PGOA 1L0LK 3PLNA 1SQVE 2WPVB 1EXIA 4WY4A 3TDKA 3A0BH 1OXZA 1BGYE 1GL2C 1H88A 2K9JB 1KYOI 1YBKA 3BATA 1OVRA 3S1KA 1L0NG 2E76B 4EYYQ 2KZIA 3GHGB 3HE5B 1QVGO 2QJKC 3CD6P 4RESB 5APXA 2E75B 3FXEA 4WWIA 1SFCA 3H1HE 2HODB 4W7ZA 1LWUB 3Q3DA 1H89A 1G2CB 2W6BA 1N2DC 1OZHA 1N7SC 2OYIC 3UIAA 1T8ZA 1KFNA 1KILA 4PD4I 4DZOA 3L72E 2HR3A 5M1BA 5B5EH 4HB1A 1L0LJ 3H1KE 4PV1D 3A5TA 2J58A 1SQBG 4C7RA 2WSFH 3AEGC 1YI2P 5KLVJ 3B5NB 4Y99B 1URQC 2KS1B 5E79E 4ZNCA 3CMAP 1L2PA 2OYHB 4DCKA 3CXHH 2QJPC 2R5DA 3RK3E 2C9NY 3AECC 1KB9I 2IX7C 4DT0A 1LNQA 3NMDA 2M8RA 1SVFA 2B88A 2JDIH 4D6TJ 2FYUE 1P84E 3HE5A 4TLFA 3M91A 3F89A 4GIFA 2KZJA 1K9MQ 3B71A 4MN4C 1MKMA 1L0ND 2P10A 2HODA 3F5HA 3CXHE 3M0DA 1LWUA 3L73G 4NPEA 3PRJA 2WSSH 2KLUA 3BCCE 5KAIH 2XV5A 4PJ0H 3SFDC 1FZEA 3H1JD 3VYIA 1T3JA 5AVWB 1VQ9P 1HGZA 2H88C 2WSCH 3RK2B 4OGQC 1FZCC 1L4AB 1ZRTE 1GL2D 2K3RA 3EFFK 1SQQG 3A2AA 1DD4A 5AW8B 1JTHB 1H8AA 1YJNP 1FAVA 1UIIA 1VQ6P 2FXPA 3B5NA 1SQBD 2KS1A 1OWAA 1PP9G 3JSVC 3N4XA 1WRGA 1OX3A 1K05A 2M3EA 1FZGA 1R5LA 4I6MC 3VMYA 2IFNA 1NU1G 1N7SD 2O01J 1GZLA 1SP4A 1S3JA 5AW4B 4CPGA 5CCGC 3HUSC 1AV1A 4U3FG 1L0LG 3HRNA 4RO0A 1M90Q 2R3SA 3CWBJ 2FKWB 5DJUB 2QSIA 3MD0A 3MHVA 2NRGA 3H6PA 4GOEA 1ZW0A 5CCHA 3WU2E 1SQPE 5GTIH 1URQD 5B66H 1PPJE 1NTZE 1R8EA 2N1TB 1NVOA 1LT9B 1X8YA 2OYIB 3L73D 4LC1A 1VF5B 1NKZB 4GKGA 3NXSA 1T6AA 4N78E 1L4AA 2W83C 4IOIH 2AEFA 4D6TG 2WPRA 2BEZF 1NTMK 1CZQA 1CSBA 4XE5B 1JTHA 4WY4C 3TNUA 3D70A 3VMXA 3H1LJ 4DJGA 2LXCB 2W8ZA 3C8VA 5AVSB 1SQQD 1Q81Q 2QJPB 4H13B 2GA1A 5GTHE 1AQ5A 2P67A 4JPZB 1PP9D 1S72P 1HWTC 2KUBA 3AE9C 3WUVA 1JY2N 1X9VA 2HPCB 1FS0E 1NU1D 1IFNA 2KOGA 1ZRTD 1SQXJ 2ZFCA 1FOSE 2OTJP 4U3FD 5AVTB 1X22A 4M3LA 3S4RA 2N9YB 2O3JA 1BE3J 1J1EC 3G4SP 5CJ0A 1KILC 3KZIH 1HUCA 1E79H 2N1TA 1LT9A 2OYIA 3HTKB 1A02F 3TF5A 3CX5H 1EDJA 4OGQB 1FZCB 1YHQP 3GF3A 2A45H 4RKUJ 3VP8A 3LIEA 3VTPC 5TJHA 2V7QH 3CWBG 1NTKE 1DEBA 1OIPA 1QLED 3P8CE 1S9KD 4D6TD 1NOHA 3V5BA 1AFOA 4Y28J 1ZR2A 1PGPA 3H32A 1BCCG 1GTWA 1D7MA 3Q5PA 3H25A 2WMMA 2E43A 3L71E 4YPCA 2E76C 2GUVA 2M5AB 1LTBC 2VRSA 3M0DC 2HPCA 3B4SA 4JQ0D 1LWUC 3A0HH 2OARA 1GDTA 4C7NB 5APVA 4GT1A 2IYOA 2HLOA 2PRRA 1ZP0C 4OVNF 5APUA 1VDFA 1VQLP 2BCCJ 2MKVA 1KYOH 2XDJA 1J1DC 3H1IJ 3L75J 1JY2P 3V4WA 3AE4C 3A3YB 4LLHA 1MFTA 3B5NC 1Y47A 1IO4A 1EXJA 1SFCD 5BVZA 1SQXG 5KJ7A 1AJYA 2QEXP 1SS1A 3TYYA 2E74C 4YXDC 2WSEJ 3MUDA 3CC7P 2W90A 3Q5SA 3V2PA 1USEA 1KYOE 3P7KA 1LTJA 1WMKA 1GK6A 1BSHA 4PD4H 1T2KC 1YIJP 1N8RQ 5CMZA 1BGYJ 1BCCD 1NTMG 2KSJA 2O1JA 4AYCA 3HE4B 4HJGH 2KXPB 5CCHC 4ZKPA 2PGDA 1OW6A 4C7NA 3H1HJ 4GOFA 1ZR4A 1GU4A 3AEFC 1QGKB 1J1EB 1KILB 1KB9H 3RK2C 3D6YA 1L4AC 5K5GB 4DOJA 2AEMA 3CX5D 3L71D 3JCUH 3L72J 2UWJE 2JJLA 2LR2A 4H44C 1FU1A 2YKPA 4I2LC 1L0NE 1KC8Q 4RJTA 3H1KJ 1PIXA 4XFJA 1IC2A 2K9YA 2E75D 2HYNA 3TGUG 5KLVK 1S4XA 3H1JE 2CPSA 1W2EA 1RF1C 2B9BA 1UIXA 1IFJA 2H89C 2H43A 3NTNA 2A06G 1Q90D 4XA4A 3JCUE 2L5GB 1NAYA 2IFMA 3H1IG 4HYTB 3HD7A 3OAKA 1SQBE 1YITP 3HE4A 1JUNA 5KTBA 1K8AQ 2KNCB 1NTMD 5APYA 1GMJA 3A0BE 2N1TC 1LT9C 4HKZH 1IK9A 3BCCJ 1LTGC 2IBZG 1VF5C 2C0WA 1KYOD 1VQNP 1VQOP 5AW3B 1JO5A 1J1DB 2ZT9B 3BASA 1Q86Q 5AVVB 1ZOYC 1JY2O 1NHLA 3V2NA 4H0LB 2Q9IA 1ZV8A 2HG5D 5AW9B 1Y8AA 3CL3D 2YKOA 1PFIA 4K35A 5APSA 3AE6C 1VQMP 1DH3A 2H8PD 2E74B 4H13C 4O9BA 2C9LY 2XKMA 3L73E 1EZVI 2NPSC 2KK7A 1PGJA 2YIUC 3TGUD 3MIWA 3CCLP 5B5EE 1EQ7A 4PD4D 3MGNA 1JB0J 2Y9YA 3MP7B 2CK3H 2WZ7A 3RGUA 1HF9A 2A06D 3RK3C 4IL6X 2IBZI 3KQGA 3KHUA 4JYCA 1XTCC 1VQKP 2AXTH 3H1KG 3H1ID 1SQQE 3U1CA 2KNCA 2LXBA 3RL0C 3M9BA 1FDOA 1BDDA 4QMAA 1PP9E 2R5BA 3EWKA 3IFMA 5H2FH 2WPQA 1SQPJ 1VQ5P 1KB9D 1NTZJ 1NAFA 2W27A 3LW5J 1NU1E 4ZMDA 1M57D 4C46A 2IBZD 5KJ7C 4U3FE 5AW5B 2KSEA 4H44B 1LGHB 3TNUB 1JM0A 2I1KA 4W80A 2WQYC 2K37A 3SSUA 3MUDC 5KAIE 4PJ0E 5BU5A 2IDBA 3ABVC 5H2FE 1LTJC 1FE6A 4OWFA 1RF1B 4L73A 4EIJA 1NTKK 2G8YA 1RQVA 2JP3A 2YMYA 2WT7A 3CC2P 5CBNA 2W6JH 3O6QB 3CCMP 1S9KE 1MV8A 1FJPA 5KLVG 4D6TE 3EQ2A 2Y0CA 4NPFX 2RKLA 2D2CC 3S9OA 2XNDH 2FYZA 2KI7B 2M3BA 2WTYA 1KV4A 2QJYB 3V6IA 3CCRP 1SQXK 1GW3A 3L36A 2QIWA 4WB4A 1JEKA 3AE8C 2RN0A 3L35A 3CCJP 5BU8B 5AW7B 2SPZA 1P84I 4ASWA 4H13D 4IFDK 3Q1MA 2FYNC 3L74J 3GG2A 3PP5A 4IFFA 2NZ2A 3CXHI 3I56P 3I55P 2CPBA 4WVZA 2O01H 1QEXA 1FZBA 5GTIE 1YTZI 5B66E 1M1JB 1JMMA 1NTKJ 2IZ0A 4U7JA 3H32B 4L74A 2J5UA 1IZNB 2B87B 2NPSB 3LIDA 1RF1A 2YIUB 3L70J 1DEEG 3KYQA 1PGQA 3HD7C 2RMZA 4EDFA 1N86A 5AVUB 2XZRA 4OGQD 1LTIC 3RK3B 3AEAC 3E7KA 3O6QA 1JY3N 3V2QA 1L0LD 2Q6QA 2JEEA 1EDIA 4JBZA 1QX8A 3RL0B 5KLVD 2ZYAA 1KMIZ 2ZYDA 4R4MA 2YO3A 2O01N 1CW5A 2QVAA 1RF0A 1HH0A 1YJWP 1GK4A 1BCCE 2JO1A 4ZKUA 4KHXA 3TSIA 3BVHA 3USSA 2L91A 5CCGD 3SFEC 3L4FA 2N9BA 1Z56A 2GUSA 3FXDA 2LKMA 3BRVB 4IFMA 3V2RA 1M1JA 3KZIE 5C39A 5AVRB 1LTJB 1SQVK 5TISH 1IK7A 2B87A 2NPSA 3CX5E 5AW6B 4NPDA 2J59M 2Z5IA 2ZAEB 3L74G 3PTZA 3A7OA 3OJAB 3M9QA 1DD3A 1HVVA 2D2CB 3AE5C 3CC4P 3H1LG 1XTGB 5AVXB 3IF4A 2Y0EA 4WY4D 2E5TA 1VQPP 1NTKG 3VMAA 1IFIA 3AEBC 3WMM0 1IFPA 3QWOC 4N3YB 5KLIB 4AQRD 1JCCA 2ZT9C 3L70G 5DJTB 2FYNB 2YO2A 1N73C 4L75A 2K88A 1JCDA 1H0TB 1RE4C 3A0HE 3B8EB 4H0LC 3W68A 1NTME 3RBXA 2WVRA 1KTMA 1JY3P 1SQVJ 3CWBD 1BE3G 1LJ2A 3P32A 3H1JJ 4IL6H 1KILD 3EFGA 1LT1A 2KLVA 3M9HA 1RQUA 1KN7A 1U7MA 4WBAA 1VQ4P 1JOCA 1K73Q 3HD7B 1S5LH 1AA0A 1FC2C 1ZMEC 2Z5HA 2XNXA 3VOPA 4PV1C 2FYUK 2FFDB 3TGUE 4K3AA 1RY3A 2JR8A 4PD4E 3FWLA 1JMBA 3H1LD 2B89A 3M0AA 2A06E 2ZVNB 2WSEH 1LP1A 1KZUB 4I1LA 1NYHA 2Q1KA 2E76D 3H1IE 2Y9ZA 1H0TA 3L70D 1T3UA 2FXOA 3L37A 1VQ8P 1JNMA 2AXCA 2OGUA 1M1KQ 1WT6A 1KFMA 1FDIA 5KKZC 1KB9E 1SQXD 1VQ7P 4L76A 2OTKE 5APQA 1Q7YQ 1GW4A 3U59A 1W2BO 1VL2A 3L73J 2YKQA 2ZXXA 2BCCG 3D6ZA 1S1CX 2IBZE 1BE3D 3CCUP 4TT3H 3L75G 5CHXA 1DX7A 2ZT9D 1QL2A 1IFDA 2WSFJ 3GMAA 1NKNA 1EZVG 2FYUJ 1KQFB 2QJYC 1AQTA 3RL0g 4H0LD 1OVUA 3B5ND 2QRXA 1SQVG 1SQQJ 2QE7H 3AE3C 1RF0C 2FFDA 3II6A 3KXDA 2E74D 1A02J 4BXLA 2AEJA 3H1JG 1PP9J 2V4HA 1NGMB 3TK1A 5E79H 1SQPK 1NTZK 1BGYG 1T2KD 1N73B 4I7ZB 4YXWH 2OYOA 1RE3A 1NU1J 1PZQA 2BASA 1JY3O 1M1JC 4W7YA 3T97B 1HTLC 4U3FJ 1J2JB 4BWNA 5CCHD 2PP6A 3H1HG 1KQLA 3NFQA 1U7JA 3C9IA 1P84H 2XU6A 1YYCA 2WSCJ 2QM8A 1IFMA 2R32A 3AE2C 2FY8A 4GDOA 3RK2D 2WT7B 2QA4P 1SLQA 3OW2O 1L4AD 3L72G 1BSNA 2BCCD 2IYPA 1GD2E 1OMIA 5AVYB 1KQSO 3L75D 3GW6A 4H44D 4PV1B 5CJ4A 1S5LX 2K9JA 1EZVD 3GHGA 3R2PA 2WPSA 3ZDMA 3IAOA 5EFWB 3CPWO 1SQVD 1HGVA 3OA7A 1G2CA 2AXTE 1N73A 1CI6B 1EDLA 1MUUA 1L0LE 1Q2NA 1RE4A 2HFED 3U1AA 2FYUG 1BGYD 2BEQD 3T97A 5KLVE 1N7LA 2G3AA 2P58A 4HH2A 1YTZT 3FX0A 4BRYB 5KKZB 1VPCA 2QG4A 2WITA 2N1TD 3BCCG 1NH4A 3H1HD 1YJ9P 4A7PA 2KB7P 2OYHA 1MFZA 1VF5D 5AW1B 1G1JA 3WU2H 3KDPB 3LW5H 2I1JA 1GL2B 3P8MC 4JYBA 3L72D 1FJKA 1NWQA 2QJKB 3H1KD 1HBWA 2WWWA 2QM7A 3RBZA 5KLIC 2Q7CA 3Q5RA 2W6AA 1HJBA 3O8ZA 1OVVA 2NPSD 2JWAA 3G3ZA 1BCCJ 3FWNA 1N7SB 3C1LA 3IR9A 2P7JA 1PL5A 1W5CE 2YMKA 3SWYA 1CI6A 2KP8A 2DW3A 5GTHH 3RK3D 3G6EP 1Q82Q 1LTTC 3VN0A 2FYUD 4EOTA 3RL0D 1OFCX 1P84D 4BRYA 1K04A 3PJSK 3R4YA 1SQPG 1URQB 1PPJG 1NTZG 2IPPA 1ZN5A 1OW8A 1Y9BA 2R3CA 3CXHD 1DIPA 1FDMA 2ZYGA 1ZXGA 3L71J 2YXQB 2ZVOB 3BCCD 3WUTA 2YXRB 2Y0DA 4EI2A 2Q3IA 1HJ0A 2V7QJ 5KJ7D 3CWBE 2FFDC 2GM4A 1M7LA 3CCEP 1SFCC 1QL1A 4ASVA 1GL2A 3VP9A 1LTAC 1AVYA 2PAJA 3ITKA 2C0XA 1KILE 2ZXEB 3PHLA 1OW7A 1ZLLA 3SWFA 3CCVP 1YQ3C 4KT0J 2RH0A 1RE3C 3AE1C 2P2UA 1LTSC 4N6JA 1NJIQ 4LGDE 4UB8H 3L74E 4KJMA 1N7SA 1M56D 1BDCA 4JF7A 1QVFO 3E1IA 1NTMJ 1FZFA 3PH0A 2D2CD 1L0NK 1IJDB 3H1LE 4B86A 3AEEC 5CBOA 5APWA 2FBWC 1KQGB 3Q2YA 1FBMA 3MTUE 1URQA 1USDA 4UB8E 5APTA 3CMEP 3L70E 2E42A 2OTLP 1G1IA 1SQPD 3MZWB 3V4QA 1PPJD 1NTZD 3G71P 2KIKA 1EC5A 1MZ9A 3E1RA 4OH8B 3GHGC 1SQXE 4YTPC 5AVQB 5L8RJ 3HUSB 2E75C 3M06A 1AVOA 5TISE 1KORA 2YNYA 1SQBK 5KAFH 1RH5B 4N78D 3TGUJ 1BE3E 1LP1B 1E5WA 3K5BA 1R5SA 5AVZB 2ZJSE 1X0TA 3QH9A 4I7ZC 3CLQA 4GODA 3KPEA 3HD7D 3L71G 3GLMA 3WUUA 1EDKA 2A45G 2ITAA 3HTKA 1L0NJ 2IZ1A 2Q3EA 2M0BA 5KAFE 1FZCA 1KD1Q 4Y99C 2H7HA 2JKVA 2OYHC 3G9RA 1U57A 3AEDC 4WY4B 3W67A 2JWDA 2O1KA 2R44A 4UB6H 2K1AA 1GU5A 4AUWA 3AE7C 3N7NA 3IN6A
chains in the Genus database with same CATH topology
2WT7A 2BASA 2FXMA 1JY3O 1M1JC 4W7YA 1S9KE 1FZCB 1HTLC 1MV8A 2A45H 1FJPA 1J2JB 3EQ2A 3VP8A 3LIEA 5CCGA 3VTPC 2POHA 3HUSA 1SFCB 2FYZA 2M3BA 2WTYA 5CCHD 2PP6A 2A45I 1DEBA 1SQXK 5AW2B 1GW3A 3P8CE 1S9KD 1KQLA 2MJZA 3CI9A 3L36A 3NFQA 3C9IA 1SQQK 1X79B 4WB4A 1NOHA 2XU6A 2P1JA 3L35A 3V5BA 1YYCA 1FZAA 3VMZA 5BU8B 5AW7B 1AFOA 3P8CD 1ZR2A 2QM8A 3H32A 4IFDK 1IFMA 2R32A 1GTWA 1FOSF 3RK2D 2WT7B 1SLQA 2Z4EA 2E43A 3I5CA 3PP5A 4IFFA 1L4AD 2GUVA 1GD2E 5AVYB 2CPBA 2KYVA 1NU1K 2Q5UA 5AW0B 2O01H 5CJ4A 1LTBC 3BRTB 2VRSA 3M0DC 2HPCA 1FZBA 1NO4A 1LWUC 1YTZI 1M1JB 1L0LK 1JMMA 2OARA 3GHGA 1GDTA 4C7NB 3R2PA 5APVA 4GT1A 3H32B 2WPSA 2HLOA 2NPSB 4WY4A 3LIDA 1RF1A 5APUA 1HGVA 3KYQA 1VDFA 3OA7A 1G2CA 1OXZA 2XDJA 3HD7C 1J1DC 1N73A 1CI6B 1MUUA 1GL2C 1H88A 1N86A 1JY2P 5AVUB 1RE4A 2HFED 3BATA 3V4WA 2XZRA 3RK3B 1LTIC 3U1AA 3A3YB 3GHGB 3HE5B 4LLHA 1JY3N 3V2QA 3T97A 3B5NC 4RESB 5APXA 1IO4A 1SFCD 1N7LA 5BVZA 5KJ7A 1SFCA 2JEEA 4HH2A 1YTZT 2HODB 4W7ZA 3RL0B 3TYYA 1LWUB 1VPCA 1H89A 3MUDA 2WITA 2YO3A 2N1TD 1G2CB 1CW5A 1NH4A 1RF0A 2W6BA 3V2PA 1N2DC 3P7KA 1HH0A 2KB7P 1N7SC 2OYHA 2OYIC 1GK4A 3UIAA 1MFZA 1LTJA 1GK6A 4ZKUA 1T8ZA 5AW1B 1KFNA 4KHXA 1T2KC 3TSIA 1G1JA 3BVHA 1KILA 3KDPB 5CMZA 4DZOA 3LW5H 5CCGD 2KSJA 2I1JA 2O1JA 4AYCA 3A5TA 2J58A 3HE4B 1GL2B 3L4FA 4C7RA 2N9BA 3P8MC 1Z56A 2GUSA 4JYBA 2WSFH 2LKMA 3BRVB 5CCHC 1FJKA 4ZKPA 4IFMA 3V2RA 1M1JA 1NWQA 1HBWA 3B5NB 4Y99B 1URQC 4C7NA 2WWWA 2QM7A 2OYHB 5AVRB 2Q7CA 2W6AA 1LTJB 1ZR4A 1HJBA 1GU4A 1SQVK 3O8ZA 2NPSD 1J1EB 1KILB 2R5DA 2NPSA 3G3ZA 5AW6B 2J59M 3RK2C 2Z5IA 2C9NY 1N7SB 3IR9A 1L4AC 2IX7C 2P7JA 4DOJA 3SWYA 1CI6A 2KP8A 3NMDA 3A7OA 3OJAB 2M8RA 1SVFA 3RK3D 2JJLA 1FU1A 2YKPA 4I2LC 3M9QA 1IC2A 3HE5A 1HVVA 2HYNA 3M91A 4GIFA 1XTGB 5AVXB 1LTTC 3VN0A 5KLVK 4WY4D 4EOTA 2HODA 3RL0D 3M0DA 1IFIA 1LWUA 3WMM0 2CPSA 1W2EA 1RF1C 1URQB 1IFJA 2IPPA 1ZN5A 4N3YB 2XV5A 2H43A 4AQRD 1JCCA 2R3CA 3NTNA 1FZEA 3VYIA 1FDMA 1T3JA 2YO2A 4XA4A 5AVWB 1N73C 1HGZA 2WSCH 2L5GB 1JCDA 2IFMA 1RE4C 3RK2B 3B8EB 2Q3IA 4HYTB 5KJ7D 1FZCC 3HD7A 1L4AB 1JY3P 2FFDC 1GL2D 3OAKA 2GM4A 1M7LA 1SFCC 1QL1A 3HE4A 1GL2A 5KTBA 3VP9A 1JUNA 1LTAC 2PAJA 3A2AA 5AW8B 1JTHB 5APYA 2C0XA 1H8AA 1FAVA 2ZXEB 3B5NA 1OWAA 1ZLLA 2N1TC 3SWFA 3P32A 1LT9C 3N4XA 1WRGA 1IK9A 1KILD 3EFGA 2KLVA 3M9HA 1RE3C 1FZGA 1LTGC 4I6MC 2C0WA 2P2UA 1LTSC 3VMYA 4N6JA 4WBAA 5AW3B 1JOCA 4LGDE 2IFNA 1N7SD 3HD7B 1JO5A 1J1DB 1GZLA 1SP4A 3BASA 5AW4B 1N7SA 5CCGC 2Z5HA 2XNXA 3HUSC 5AVVB 1JY2O 3VOPA 4JF7A 1NHLA 3V2NA 3E1IA 3HRNA 1FZFA 2Q9IA 1ZV8A 2HG5D 5AW9B 2FKWB 3CL3D 1L0NK 1IJDB 2FYUK 2FFDB 2YKOA 4B86A 1PFIA 3MD0A 5APSA 3H6PA 1RY3A 1DH3A 2H8PD 5APWA 5CCHA 4O9BA 2C9LY 2XKMA 1FBMA 2NPSC 1URQD 3MTUE 3MIWA 1URQA 3M0AA 1EQ7A 5APTA 2N1TB 1X8YA 1LT9B 2OYIB 2E42A 3MGNA 2WSEH 1G1IA 1KZUB 4I1LA 3V4QA 2WZ7A 4LC1A 1MZ9A 1NKZB 4OH8B 4GKGA 3NXSA 1T3UA 3RK3C 3KQGA 3GHGC 3L37A 4JYCA 1XTCC 4N78E 1L4AA 5AVQB 3HUSB 3M06A 2WPRA 1JNMA 1NTMK 1CZQA 3U1CA 1WT6A 1KFMA 2YNYA 1CSBA 4XE5B 1JTHA 1SQBK 4WY4C 3TNUA 3RL0C 3M9BA 4N78D 3VMXA 5APQA 1GW4A 5AVSB 3U59A 2R5BA 1E5WA 3IFMA 2WPQA 5AVZB 2YKQA 1NAFA 2W27A 1AQ5A 2P67A 3CLQA 3KPEA 5CHXA 3HD7D 1DX7A 1QL2A 1IFDA 4C46A 1HWTC 2A45G 1NKNA 5KJ7C 3HTKA 1JY2N 5AW5B 1X9VA 2HPCB 1LGHB 3TNUB 2I1KA 1IFNA 4W80A 2KOGA 3B5ND 2ZFCA 1FOSE 1FZCA 4Y99C 5BU5A 2H7HA 1RF0C 5AVTB 2FFDA 4M3LA 2OYHC 3II6A 1LTJC 1A02J 4WY4B 1RF1B 1J1EC 5CJ0A 4EIJA 1KILC 1NTKK 2O1KA 1HUCA 3TK1A 1SQPK 1GU5A 2N1TA 4AUWA 1LT9A 2YMYA 2OYIA 1NTZK 3HTKB 1T2KD 1N73B 1A02F 3N7NA 1RE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KB7 P;  1FJP A;  1ZLL A;  1FJK A;  2HYN A;  2KYV A;  1N7L A;  2M3B A; 
#chains in the Genus database with same CATH topology
 3L74 D;  2FXM A;  1SQB J;  3CX5 I;  5CCG A;  2POH A;  3HUS A;  1PV3 A;  1SFC B;  1S2E A;  3FGA D;  2M5A A;  4IL6 E;  3GF7 A;  2A45 I;  5AW2 B;  2MJZ A;  3CI9 A;  1SQQ K;  1M8O B;  1X79 B;  2I8D A;  2P1J A;  4UB6 E;  1S5L E;  1NTK D;  4Z1M H;  2OQQ A;  1FZA A;  3VMZ A;  3CCS P;  3P8C D;  3D71 A;  2BCC E;  1FOS F;  2E5Y A;  2PFX A;  3SWK A;  1TU3 F;  2Z4E A;  3L75 E;  3I5C A;  4R4L A;  1YQ4 C;  1RHZ B;  3CCQ P;  2KYV A;  1EZV E;  1NU1 K;  2Q5U A;  5AW0 B;  3BRT B;  3JC2 2;  1NO4 A;  1PGO A;  1L0L K;  3PLN A;  1SQV E;  2WPV B;  1EXI A;  4WY4 A;  3TDK A;  3A0B H;  1OXZ A;  1BGY E;  1GL2 C;  1H88 A;  2K9J B;  1KYO I;  1YBK A;  3BAT A;  1OVR A;  3S1K A;  1L0N G;  2E76 B;  4EYY Q;  2KZI A;  3GHG B;  3HE5 B;  1QVG O;  2QJK C;  3CD6 P;  4RES B;  5APX A;  2E75 B;  3FXE A;  4WWI A;  1SFC A;  3H1H E;  2HOD B;  4W7Z A;  1LWU B;  3Q3D A;  1H89 A;  1G2C B;  2W6B A;  1N2D C;  1OZH A;  1N7S C;  2OYI C;  3UIA A;  1T8Z A;  1KFN A;  1KIL A;  4PD4 I;  4DZO A;  3L72 E;  2HR3 A;  5M1B A;  5B5E H;  4HB1 A;  1L0L J;  3H1K E;  4PV1 D;  3A5T A;  2J58 A;  1SQB G;  4C7R A;  2WSF H;  3AEG C;  1YI2 P;  5KLV J;  3B5N B;  4Y99 B;  1URQ C;  2KS1 B;  5E79 E;  4ZNC A;  3CMA P;  1L2P A;  2OYH B;  4DCK A;  3CXH H;  2QJP C;  2R5D A;  3RK3 E;  2C9N Y;  3AEC C;  1KB9 I;  2IX7 C;  4DT0 A;  1LNQ A;  3NMD A;  2M8R A;  1SVF A;  2B88 A;  2JDI H;  4D6T J;  2FYU E;  1P84 E;  3HE5 A;  4TLF A;  3M91 A;  3F89 A;  4GIF A;  2KZJ A;  1K9M Q;  3B71 A;  4MN4 C;  1MKM A;  1L0N D;  2P10 A;  2HOD A;  3F5H A;  3CXH E;  3M0D A;  1LWU A;  3L73 G;  4NPE A;  3PRJ A;  2WSS H;  2KLU A;  3BCC E;  5KAI H;  2XV5 A;  4PJ0 H;  3SFD C;  1FZE A;  3H1J D;  3VYI A;  1T3J A;  5AVW B;  1VQ9 P;  1HGZ A;  2H88 C;  2WSC H;  3RK2 B;  4OGQ C;  1FZC C;  1L4A B;  1ZRT E;  1GL2 D;  2K3R A;  3EFF K;  1SQQ G;  3A2A A;  1DD4 A;  5AW8 B;  1JTH B;  1H8A A;  1YJN P;  1FAV A;  1UII A;  1VQ6 P;  2FXP A;  3B5N A;  1SQB D;  2KS1 A;  1OWA A;  1PP9 G;  3JSV C;  3N4X A;  1WRG A;  1OX3 A;  1K05 A;  2M3E A;  1FZG A;  1R5L A;  4I6M C;  3VMY A;  2IFN A;  1NU1 G;  1N7S D;  2O01 J;  1GZL A;  1SP4 A;  1S3J A;  5AW4 B;  4CPG A;  5CCG C;  3HUS C;  1AV1 A;  4U3F G;  1L0L G;  3HRN A;  4RO0 A;  1M90 Q;  2R3S A;  3CWB J;  2FKW B;  5DJU B;  2QSI A;  3MD0 A;  3MHV A;  2NRG A;  3H6P A;  4GOE A;  1ZW0 A;  5CCH A;  3WU2 E;  1SQP E;  5GTI H;  1URQ D;  5B66 H;  1PPJ E;  1NTZ E;  1R8E A;  2N1T B;  1NVO A;  1LT9 B;  1X8Y A;  2OYI B;  3L73 D;  4LC1 A;  1VF5 B;  1NKZ B;  4GKG A;  3NXS A;  1T6A A;  4N78 E;  1L4A A;  2W83 C;  4IOI H;  2AEF A;  4D6T G;  2WPR A;  2BEZ F;  1NTM K;  1CZQ A;  1CSB A;  4XE5 B;  1JTH A;  4WY4 C;  3TNU A;  3D70 A;  3VMX A;  3H1L J;  4DJG A;  2LXC B;  2W8Z A;  3C8V A;  5AVS B;  1SQQ D;  1Q81 Q;  2QJP B;  4H13 B;  2GA1 A;  5GTH E;  1AQ5 A;  2P67 A;  4JPZ B;  1PP9 D;  1S72 P;  1HWT C;  2KUB A;  3AE9 C;  3WUV A;  1JY2 N;  1X9V A;  2HPC B;  1FS0 E;  1NU1 D;  1IFN A;  2KOG A;  1ZRT D;  1SQX J;  2ZFC A;  1FOS E;  2OTJ P;  4U3F D;  5AVT B;  1X22 A;  4M3L A;  3S4R A;  2N9Y B;  2O3J A;  1BE3 J;  1J1E C;  3G4S P;  5CJ0 A;  1KIL C;  3KZI H;  1HUC A;  1E79 H;  2N1T A;  1LT9 A;  2OYI A;  3HTK B;  1A02 F;  3TF5 A;  3CX5 H;  1EDJ A;  4OGQ B;  1FZC B;  1YHQ P;  3GF3 A;  2A45 H;  4RKU J;  3VP8 A;  3LIE A;  3VTP C;  5TJH A;  2V7Q H;  3CWB G;  1NTK E;  1DEB A;  1OIP A;  1QLE D;  3P8C E;  1S9K D;  4D6T D;  1NOH A;  3V5B A;  1AFO A;  4Y28 J;  1ZR2 A;  1PGP A;  3H32 A;  1BCC G;  1GTW A;  1D7M A;  3Q5P A;  3H25 A;  2WMM A;  2E43 A;  3L71 E;  4YPC A;  2E76 C;  2GUV A;  2M5A B;  1LTB C;  2VRS A;  3M0D C;  2HPC A;  3B4S A;  4JQ0 D;  1LWU C;  3A0H H;  2OAR A;  1GDT A;  4C7N B;  5APV A;  4GT1 A;  2IYO A;  2HLO A;  2PRR A;  1ZP0 C;  4OVN F;  5APU A;  1VDF A;  1VQL P;  2BCC J;  2MKV A;  1KYO H;  2XDJ A;  1J1D C;  3H1I J;  3L75 J;  1JY2 P;  3V4W A;  3AE4 C;  3A3Y B;  4LLH A;  1MFT A;  3B5N C;  1Y47 A;  1IO4 A;  1EXJ A;  1SFC D;  5BVZ A;  1SQX G;  5KJ7 A;  1AJY A;  2QEX P;  1SS1 A;  3TYY A;  2E74 C;  4YXD C;  2WSE J;  3MUD A;  3CC7 P;  2W90 A;  3Q5S A;  3V2P A;  1USE A;  1KYO E;  3P7K A;  1LTJ A;  1WMK A;  1GK6 A;  1BSH A;  4PD4 H;  1T2K C;  1YIJ P;  1N8R Q;  5CMZ A;  1BGY J;  1BCC D;  1NTM G;  2KSJ A;  2O1J A;  4AYC A;  3HE4 B;  4HJG H;  2KXP B;  5CCH C;  4ZKP A;  2PGD A;  1OW6 A;  4C7N A;  3H1H J;  4GOF A;  1ZR4 A;  1GU4 A;  3AEF C;  1QGK B;  1J1E B;  1KIL B;  1KB9 H;  3RK2 C;  3D6Y A;  1L4A C;  5K5G B;  4DOJ A;  2AEM A;  3CX5 D;  3L71 D;  3JCU H;  3L72 J;  2UWJ E;  2JJL A;  2LR2 A;  4H44 C;  1FU1 A;  2YKP A;  4I2L C;  1L0N E;  1KC8 Q;  4RJT A;  3H1K J;  1PIX A;  4XFJ A;  1IC2 A;  2K9Y A;  2E75 D;  2HYN A;  3TGU G;  5KLV K;  1S4X A;  3H1J E;  2CPS A;  1W2E A;  1RF1 C;  2B9B A;  1UIX A;  1IFJ A;  2H89 C;  2H43 A;  3NTN A;  2A06 G;  1Q90 D;  4XA4 A;  3JCU E;  2L5G B;  1NAY A;  2IFM A;  3H1I G;  4HYT B;  3HD7 A;  3OAK A;  1SQB E;  1YIT P;  3HE4 A;  1JUN A;  5KTB A;  1K8A Q;  2KNC B;  1NTM D;  5APY A;  1GMJ A;  3A0B E;  2N1T C;  1LT9 C;  4HKZ H;  1IK9 A;  3BCC J;  1LTG C;  2IBZ G;  1VF5 C;  2C0W A;  1KYO D;  1VQN P;  1VQO P;  5AW3 B;  1JO5 A;  1J1D B;  2ZT9 B;  3BAS A;  1Q86 Q;  5AVV B;  1ZOY C;  1JY2 O;  1NHL A;  3V2N A;  4H0L B;  2Q9I A;  1ZV8 A;  2HG5 D;  5AW9 B;  1Y8A A;  3CL3 D;  2YKO A;  1PFI A;  4K35 A;  5APS A;  3AE6 C;  1VQM P;  1DH3 A;  2H8P D;  2E74 B;  4H13 C;  4O9B A;  2C9L Y;  2XKM A;  3L73 E;  1EZV I;  2NPS C;  2KK7 A;  1PGJ A;  2YIU C;  3TGU D;  3MIW A;  3CCL P;  5B5E E;  1EQ7 A;  4PD4 D;  3MGN A;  1JB0 J;  2Y9Y A;  3MP7 B;  2CK3 H;  2WZ7 A;  3RGU A;  1HF9 A;  2A06 D;  3RK3 C;  4IL6 X;  2IBZ I;  3KQG A;  3KHU A;  4JYC A;  1XTC C;  1VQK P;  2AXT H;  3H1K G;  3H1I D;  1SQQ E;  3U1C A;  2KNC A;  2LXB A;  3RL0 C;  3M9B A;  1FDO A;  1BDD A;  4QMA A;  1PP9 E;  2R5B A;  3EWK A;  3IFM A;  5H2F H;  2WPQ A;  1SQP J;  1VQ5 P;  1KB9 D;  1NTZ J;  1NAF A;  2W27 A;  3LW5 J;  1NU1 E;  4ZMD A;  1M57 D;  4C46 A;  2IBZ D;  5KJ7 C;  4U3F E;  5AW5 B;  2KSE A;  4H44 B;  1LGH B;  3TNU B;  1JM0 A;  2I1K A;  4W80 A;  2WQY C;  2K37 A;  3SSU A;  3MUD C;  5KAI E;  4PJ0 E;  5BU5 A;  2IDB A;  3ABV C;  5H2F E;  1LTJ C;  1FE6 A;  4OWF A;  1RF1 B;  4L73 A;  4EIJ A;  1NTK K;  2G8Y A;  1RQV A;  2JP3 A;  2YMY A;  2WT7 A;  3CC2 P;  5CBN A;  2W6J H;  3O6Q B;  3CCM P;  1S9K E;  1MV8 A;  1FJP A;  5KLV G;  4D6T E;  3EQ2 A;  2Y0C A;  4NPF X;  2RKL A;  2D2C C;  3S9O A;  2XND H;  2FYZ A;  2KI7 B;  2M3B A;  2WTY A;  1KV4 A;  2QJY B;  3V6I A;  3CCR P;  1SQX K;  1GW3 A;  3L36 A;  2QIW A;  4WB4 A;  1JEK A;  3AE8 C;  2RN0 A;  3L35 A;  3CCJ P;  5BU8 B;  5AW7 B;  2SPZ A;  1P84 I;  4ASW A;  4H13 D;  4IFD K;  3Q1M A;  2FYN C;  3L74 J;  3GG2 A;  3PP5 A;  4IFF A;  2NZ2 A;  3CXH I;  3I56 P;  3I55 P;  2CPB A;  4WVZ A;  2O01 H;  1QEX A;  1FZB A;  5GTI E;  1YTZ I;  5B66 E;  1M1J B;  1JMM A;  1NTK J;  2IZ0 A;  4U7J A;  3H32 B;  4L74 A;  2J5U A;  1IZN B;  2B87 B;  2NPS B;  3LID A;  1RF1 A;  2YIU B;  3L70 J;  1DEE G;  3KYQ A;  1PGQ A;  3HD7 C;  2RMZ A;  4EDF A;  1N86 A;  5AVU B;  2XZR A;  4OGQ D;  1LTI C;  3RK3 B;  3AEA C;  3E7K A;  3O6Q A;  1JY3 N;  3V2Q A;  1L0L D;  2Q6Q A;  2JEE A;  1EDI A;  4JBZ A;  1QX8 A;  3RL0 B;  5KLV D;  2ZYA A;  1KMI Z;  2ZYD A;  4R4M A;  2YO3 A;  2O01 N;  1CW5 A;  2QVA A;  1RF0 A;  1HH0 A;  1YJW P;  1GK4 A;  1BCC E;  2JO1 A;  4ZKU A;  4KHX A;  3TSI A;  3BVH A;  3USS A;  2L91 A;  5CCG D;  3SFE C;  3L4F A;  2N9B A;  1Z56 A;  2GUS A;  3FXD A;  2LKM A;  3BRV B;  4IFM A;  3V2R A;  1M1J A;  3KZI E;  5C39 A;  5AVR B;  1LTJ B;  1SQV K;  5TIS H;  1IK7 A;  2B87 A;  2NPS A;  3CX5 E;  5AW6 B;  4NPD A;  2J59 M;  2Z5I A;  2ZAE B;  3L74 G;  3PTZ A;  3A7O A;  3OJA B;  3M9Q A;  1DD3 A;  1HVV A;  2D2C B;  3AE5 C;  3CC4 P;  3H1L G;  1XTG B;  5AVX B;  3IF4 A;  2Y0E A;  4WY4 D;  2E5T A;  1VQP P;  1NTK G;  3VMA A;  1IFI A;  3AEB C;  3WMM 0;  1IFP A;  3QWO C;  4N3Y B;  5KLI B;  4AQR D;  1JCC A;  2ZT9 C;  3L70 G;  5DJT B;  2FYN B;  2YO2 A;  1N73 C;  4L75 A;  2K88 A;  1JCD A;  1H0T B;  1RE4 C;  3A0H E;  3B8E B;  4H0L C;  3W68 A;  1NTM E;  3RBX A;  2WVR A;  1KTM A;  1JY3 P;  1SQV J;  3CWB D;  1BE3 G;  1LJ2 A;  3P32 A;  3H1J J;  4IL6 H;  1KIL D;  3EFG A;  1LT1 A;  2KLV A;  3M9H A;  1RQU A;  1KN7 A;  1U7M A;  4WBA A;  1VQ4 P;  1JOC A;  1K73 Q;  3HD7 B;  1S5L H;  1AA0 A;  1FC2 C;  1ZME C;  2Z5H A;  2XNX A;  3VOP A;  4PV1 C;  2FYU K;  2FFD B;  3TGU E;  4K3A A;  1RY3 A;  2JR8 A;  4PD4 E;  3FWL A;  1JMB A;  3H1L D;  2B89 A;  3M0A A;  2A06 E;  2ZVN B;  2WSE H;  1LP1 A;  1KZU B;  4I1L A;  1NYH A;  2Q1K A;  2E76 D;  3H1I E;  2Y9Z A;  1H0T A;  3L70 D;  1T3U A;  2FXO A;  3L37 A;  1VQ8 P;  1JNM A;  2AXC A;  2OGU A;  1M1K Q;  1WT6 A;  1KFM A;  1FDI A;  5KKZ C;  1KB9 E;  1SQX D;  1VQ7 P;  4L76 A;  2OTK E;  5APQ A;  1Q7Y Q;  1GW4 A;  3U59 A;  1W2B O;  1VL2 A;  3L73 J;  2YKQ A;  2ZXX A;  2BCC G;  3D6Z A;  1S1C X;  2IBZ E;  1BE3 D;  3CCU P;  4TT3 H;  3L75 G;  5CHX A;  1DX7 A;  2ZT9 D;  1QL2 A;  1IFD A;  2WSF J;  3GMA A;  1NKN A;  1EZV G;  2FYU J;  1KQF B;  2QJY C;  1AQT A;  3RL0 g;  4H0L D;  1OVU A;  3B5N D;  2QRX A;  1SQV G;  1SQQ J;  2QE7 H;  3AE3 C;  1RF0 C;  2FFD A;  3II6 A;  3KXD A;  2E74 D;  1A02 J;  4BXL A;  2AEJ A;  3H1J G;  1PP9 J;  2V4H A;  1NGM B;  3TK1 A;  5E79 H;  1SQP K;  1NTZ K;  1BGY G;  1T2K D;  1N73 B;  4I7Z B;  4YXW H;  2OYO A;  1RE3 A;  1NU1 J;  1PZQ A;  2BAS A;  1JY3 O;  1M1J C;  4W7Y A;  3T97 B;  1HTL C;  4U3F J;  1J2J B;  4BWN A;  5CCH D;  2PP6 A;  3H1H G;  1KQL A;  3NFQ A;  1U7J A;  3C9I A;  1P84 H;  2XU6 A;  1YYC A;  2WSC J;  2QM8 A;  1IFM A;  2R32 A;  3AE2 C;  2FY8 A;  4GDO A;  3RK2 D;  2WT7 B;  2QA4 P;  1SLQ A;  3OW2 O;  1L4A D;  3L72 G;  1BSN A;  2BCC D;  2IYP A;  1GD2 E;  1OMI A;  5AVY B;  1KQS O;  3L75 D;  3GW6 A;  4H44 D;  4PV1 B;  5CJ4 A;  1S5L X;  2K9J A;  1EZV D;  3GHG A;  3R2P A;  2WPS A;  3ZDM A;  3IAO A;  5EFW B;  3CPW O;  1SQV D;  1HGV A;  3OA7 A;  1G2C A;  2AXT E;  1N73 A;  1CI6 B;  1EDL A;  1MUU A;  1L0L E;  1Q2N A;  1RE4 A;  2HFE D;  3U1A A;  2FYU G;  1BGY D;  2BEQ D;  3T97 A;  5KLV E;  1N7L A;  2G3A A;  2P58 A;  4HH2 A;  1YTZ T;  3FX0 A;  4BRY B;  5KKZ B;  1VPC A;  2QG4 A;  2WIT A;  2N1T D;  3BCC G;  1NH4 A;  3H1H D;  1YJ9 P;  4A7P A;  2KB7 P;  2OYH A;  1MFZ A;  1VF5 D;  5AW1 B;  1G1J A;  3WU2 H;  3KDP B;  3LW5 H;  2I1J A;  1GL2 B;  3P8M C;  4JYB A;  3L72 D;  1FJK A;  1NWQ A;  2QJK B;  3H1K D;  1HBW A;  2WWW A;  2QM7 A;  3RBZ A;  5KLI C;  2Q7C A;  3Q5R A;  2W6A A;  1HJB A;  3O8Z A;  1OVV A;  2NPS D;  2JWA A;  3G3Z A;  1BCC J;  3FWN A;  1N7S B;  3C1L A;  3IR9 A;  2P7J A;  1PL5 A;  1W5C E;  2YMK A;  3SWY A;  1CI6 A;  2KP8 A;  2DW3 A;  5GTH H;  3RK3 D;  3G6E P;  1Q82 Q;  1LTT C;  3VN0 A;  2FYU D;  4EOT A;  3RL0 D;  1OFC X;  1P84 D;  4BRY A;  1K04 A;  3PJS K;  3R4Y A;  1SQP G;  1URQ B;  1PPJ G;  1NTZ G;  2IPP A;  1ZN5 A;  1OW8 A;  1Y9B A;  2R3C A;  3CXH D;  1DIP A;  1FDM A;  2ZYG A;  1ZXG A;  3L71 J;  2YXQ B;  2ZVO B;  3BCC D;  3WUT A;  2YXR B;  2Y0D A;  4EI2 A;  2Q3I A;  1HJ0 A;  2V7Q J;  5KJ7 D;  3CWB E;  2FFD C;  2GM4 A;  1M7L A;  3CCE P;  1SFC C;  1QL1 A;  4ASV A;  1GL2 A;  3VP9 A;  1LTA C;  1AVY A;  2PAJ A;  3ITK A;  2C0X A;  1KIL E;  2ZXE B;  3PHL A;  1OW7 A;  1ZLL A;  3SWF A;  3CCV P;  1YQ3 C;  4KT0 J;  2RH0 A;  1RE3 C;  3AE1 C;  2P2U A;  1LTS C;  4N6J A;  1NJI Q;  4LGD E;  4UB8 H;  3L74 E;  4KJM A;  1N7S A;  1M56 D;  1BDC A;  4JF7 A;  1QVF O;  3E1I A;  1NTM J;  1FZF A;  3PH0 A;  2D2C D;  1L0N K;  1IJD B;  3H1L E;  4B86 A;  3AEE C;  5CBO A;  5APW A;  2FBW C;  1KQG B;  3Q2Y A;  1FBM A;  3MTU E;  1URQ A;  1USD A;  4UB8 E;  5APT A;  3CME P;  3L70 E;  2E42 A;  2OTL P;  1G1I A;  1SQP D;  3MZW B;  3V4Q A;  1PPJ D;  1NTZ D;  3G71 P;  2KIK A;  1EC5 A;  1MZ9 A;  3E1R A;  4OH8 B;  3GHG C;  1SQX E;  4YTP C;  5AVQ B;  5L8R J;  3HUS B;  2E75 C;  3M06 A;  1AVO A;  5TIS E;  1KOR A;  2YNY A;  1SQB K;  5KAF H;  1RH5 B;  4N78 D;  3TGU J;  1BE3 E;  1LP1 B;  1E5W A;  3K5B A;  1R5S A;  5AVZ B;  2ZJS E;  1X0T A;  3QH9 A;  4I7Z C;  3CLQ A;  4GOD A;  3KPE A;  3HD7 D;  3L71 G;  3GLM A;  3WUU A;  1EDK A;  2A45 G;  2ITA A;  3HTK A;  1L0N J;  2IZ1 A;  2Q3E A;  2M0B A;  5KAF E;  1FZC A;  1KD1 Q;  4Y99 C;  2H7H A;  2JKV A;  2OYH C;  3G9R A;  1U57 A;  3AED C;  4WY4 B;  3W67 A;  2JWD A;  2O1K A;  2R44 A;  4UB6 H;  2K1A A;  1GU5 A;  4AUW A;  3AE7 C;  3N7N A;  3IN6 A; 
#chains in the Genus database with same CATH homology
 2WT7 A;  2BAS A;  2FXM A;  1JY3 O;  1M1J C;  4W7Y A;  1S9K E;  1FZC B;  1HTL C;  1MV8 A;  2A45 H;  1FJP A;  1J2J B;  3EQ2 A;  3VP8 A;  3LIE A;  5CCG A;  3VTP C;  2POH A;  3HUS A;  1SFC B;  2FYZ A;  2M3B A;  2WTY A;  5CCH D;  2PP6 A;  2A45 I;  1DEB A;  1SQX K;  5AW2 B;  1GW3 A;  3P8C E;  1S9K D;  1KQL A;  2MJZ A;  3CI9 A;  3L36 A;  3NFQ A;  3C9I A;  1SQQ K;  1X79 B;  4WB4 A;  1NOH A;  2XU6 A;  2P1J A;  3L35 A;  3V5B A;  1YYC A;  1FZA A;  3VMZ A;  5BU8 B;  5AW7 B;  1AFO A;  3P8C D;  1ZR2 A;  2QM8 A;  3H32 A;  4IFD K;  1IFM A;  2R32 A;  1GTW A;  1FOS F;  3RK2 D;  2WT7 B;  1SLQ A;  2Z4E A;  2E43 A;  3I5C A;  3PP5 A;  4IFF A;  1L4A D;  2GUV A;  1GD2 E;  5AVY B;  2CPB A;  2KYV A;  1NU1 K;  2Q5U A;  5AW0 B;  2O01 H;  5CJ4 A;  1LTB C;  3BRT B;  2VRS A;  3M0D C;  2HPC A;  1FZB A;  1NO4 A;  1LWU C;  1YTZ I;  1M1J B;  1L0L K;  1JMM A;  2OAR A;  3GHG A;  1GDT A;  4C7N B;  3R2P A;  5APV A;  4GT1 A;  3H32 B;  2WPS A;  2HLO A;  2NPS B;  4WY4 A;  3LID A;  1RF1 A;  5APU A;  1HGV A;  3KYQ A;  1VDF A;  3OA7 A;  1G2C A;  1OXZ A;  2XDJ A;  3HD7 C;  1J1D C;  1N73 A;  1CI6 B;  1MUU A;  1GL2 C;  1H88 A;  1N86 A;  1JY2 P;  5AVU B;  1RE4 A;  2HFE D;  3BAT A;  3V4W A;  2XZR A;  3RK3 B;  1LTI C;  3U1A A;  3A3Y B;  3GHG B;  3HE5 B;  4LLH A;  1JY3 N;  3V2Q A;  3T97 A;  3B5N C;  4RES B;  5APX A;  1IO4 A;  1SFC D;  1N7L A;  5BVZ A;  5KJ7 A;  1SFC A;  2JEE A;  4HH2 A;  1YTZ T;  2HOD B;  4W7Z A;  3RL0 B;  3TYY A;  1LWU B;  1VPC A;  1H89 A;  3MUD A;  2WIT A;  2YO3 A;  2N1T D;  1G2C B;  1CW5 A;  1NH4 A;  1RF0 A;  2W6B A;  3V2P A;  1N2D C;  3P7K A;  1HH0 A;  2KB7 P;  1N7S C;  2OYH A;  2OYI C;  1GK4 A;  3UIA A;  1MFZ A;  1LTJ A;  1GK6 A;  4ZKU A;  1T8Z A;  5AW1 B;  1KFN A;  4KHX A;  1T2K C;  3TSI A;  1G1J A;  3BVH A;  1KIL A;  3KDP B;  5CMZ A;  4DZO A;  3LW5 H;  5CCG D;  2KSJ A;  2I1J A;  2O1J A;  4AYC A;  3A5T A;  2J58 A;  3HE4 B;  1GL2 B;  3L4F A;  4C7R A;  2N9B A;  3P8M C;  1Z56 A;  2GUS A;  4JYB A;  2WSF H;  2LKM A;  3BRV B;  5CCH C;  1FJK A;  4ZKP A;  4IFM A;  3V2R A;  1M1J A;  1NWQ A;  1HBW A;  3B5N B;  4Y99 B;  1URQ C;  4C7N A;  2WWW A;  2QM7 A;  2OYH B;  5AVR B;  2Q7C A;  2W6A A;  1LTJ B;  1ZR4 A;  1HJB A;  1GU4 A;  1SQV K;  3O8Z A;  2NPS D;  1J1E B;  1KIL B;  2R5D A;  2NPS A;  3G3Z A;  5AW6 B;  2J59 M;  3RK2 C;  2Z5I A;  2C9N Y;  1N7S B;  3IR9 A;  1L4A C;  2IX7 C;  2P7J A;  4DOJ A;  3SWY A;  1CI6 A;  2KP8 A;  3NMD A;  3A7O A;  3OJA B;  2M8R A;  1SVF A;  3RK3 D;  2JJL A;  1FU1 A;  2YKP A;  4I2L C;  3M9Q A;  1IC2 A;  3HE5 A;  1HVV A;  2HYN A;  3M91 A;  4GIF A;  1XTG B;  5AVX B;  1LTT C;  3VN0 A;  5KLV K;  4WY4 D;  4EOT A;  2HOD A;  3RL0 D;  3M0D A;  1IFI A;  1LWU A;  3WMM 0;  2CPS A;  1W2E A;  1RF1 C;  1URQ B;  1IFJ A;  2IPP A;  1ZN5 A;  4N3Y B;  2XV5 A;  2H43 A;  4AQR D;  1JCC A;  2R3C A;  3NTN A;  1FZE A;  3VYI A;  1FDM A;  1T3J A;  2YO2 A;  4XA4 A;  5AVW B;  1N73 C;  1HGZ A;  2WSC H;  2L5G B;  1JCD A;  2IFM A;  1RE4 C;  3RK2 B;  3B8E B;  2Q3I A;  4HYT B;  5KJ7 D;  1FZC C;  3HD7 A;  1L4A B;  1JY3 P;  2FFD C;  1GL2 D;  3OAK A;  2GM4 A;  1M7L A;  1SFC C;  1QL1 A;  3HE4 A;  1GL2 A;  5KTB A;  3VP9 A;  1JUN A;  1LTA C;  2PAJ A;  3A2A A;  5AW8 B;  1JTH B;  5APY A;  2C0X A;  1H8A A;  1FAV A;  2ZXE B;  3B5N A;  1OWA A;  1ZLL A;  2N1T C;  3SWF A;  3P32 A;  1LT9 C;  3N4X A;  1WRG A;  1IK9 A;  1KIL D;  3EFG A;  2KLV A;  3M9H A;  1RE3 C;  1FZG A;  1LTG C;  4I6M C;  2C0W A;  2P2U A;  1LTS C;  3VMY A;  4N6J A;  4WBA A;  5AW3 B;  1JOC A;  4LGD E;  2IFN A;  1N7S D;  3HD7 B;  1JO5 A;  1J1D B;  1GZL A;  1SP4 A;  3BAS A;  5AW4 B;  1N7S A;  5CCG C;  2Z5H A;  2XNX A;  3HUS C;  5AVV B;  1JY2 O;  3VOP A;  4JF7 A;  1NHL A;  3V2N A;  3E1I A;  3HRN A;  1FZF A;  2Q9I A;  1ZV8 A;  2HG5 D;  5AW9 B;  2FKW B;  3CL3 D;  1L0N K;  1IJD B;  2FYU K;  2FFD B;  2YKO A;  4B86 A;  1PFI A;  3MD0 A;  5APS A;  3H6P A;  1RY3 A;  1DH3 A;  2H8P D;  5APW A;  5CCH A;  4O9B A;  2C9L Y;  2XKM A;  1FBM A;  2NPS C;  1URQ D;  3MTU E;  3MIW A;  1URQ A;  3M0A A;  1EQ7 A;  5APT A;  2N1T B;  1X8Y A;  1LT9 B;  2OYI B;  2E42 A;  3MGN A;  2WSE H;  1G1I A;  1KZU B;  4I1L A;  3V4Q A;  2WZ7 A;  4LC1 A;  1MZ9 A;  1NKZ B;  4OH8 B;  4GKG A;  3NXS A;  1T3U A;  3RK3 C;  3KQG A;  3GHG C;  3L37 A;  4JYC A;  1XTC C;  4N78 E;  1L4A A;  5AVQ B;  3HUS B;  3M06 A;  2WPR A;  1JNM A;  1NTM K;  1CZQ A;  3U1C A;  1WT6 A;  1KFM A;  2YNY A;  1CSB A;  4XE5 B;  1JTH A;  1SQB K;  4WY4 C;  3TNU A;  3RL0 C;  3M9B A;  4N78 D;  3VMX A;  5APQ A;  1GW4 A;  5AVS B;  3U59 A;  2R5B A;  1E5W A;  3IFM A;  2WPQ A;  5AVZ B;  2YKQ A;  1NAF A;  2W27 A;  1AQ5 A;  2P67 A;  3CLQ A;  3KPE A;  5CHX A;  3HD7 D;  1DX7 A;  1QL2 A;  1IFD A;  4C46 A;  1HWT C;  2A45 G;  1NKN A;  5KJ7 C;  3HTK A;  1JY2 N;  5AW5 B;  1X9V A;  2HPC B;  1LGH B;  3TNU B;  2I1K A;  1IFN A;  4W80 A;  2KOG A;  3B5N D;  2ZFC A;  1FOS E;  1FZC A;  4Y99 C;  5BU5 A;  2H7H A;  1RF0 C;  5AVT B;  2FFD A;  4M3L A;  2OYH C;  3II6 A;  1LTJ C;  1A02 J;  4WY4 B;  1RF1 B;  1J1E C;  5CJ0 A;  4EIJ A;  1KIL C;  1NTK K;  2O1K A;  1HUC A;  3TK1 A;  1SQP K;  1GU5 A;  2N1T A;  4AUW A;  1LT9 A;  2YMY A;  2OYI A;  1NTZ K;  3HTK B;  1T2K D;  1N73 B;  1A02 F;  3N7N A;  1RE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...