2M3BA

Serine 16 phosphorylated phospholamban pentamer, hybrid solution and solid-state nmr structural ensemble
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
51
Chain Sequence
MEKVQYLTRSAIRRATIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Dynamics and Topology of Phosphorylated Phospholamban Homopentamer Reveal Its Role in the Regulation of Calcium Transport.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Membrane protein
molecule keywords Cardiac phospholamban
total genus 18
structure length 51
sequence length 52
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2m3bA00
2M3BA 1ZLLA 1FJPA 2KB7P 2HYNA 1N7LA 1FJKA 2KYVA
chains in the Genus database with same CATH superfamily
2H43A 4OH8B 4GODA 1OFCX 1OX3A 2IBZD 5APXA 3RBXA 2PGDA 3T97A 2OYIA 1HWTC 1L0NJ 3GF3A 2Y0EA 2KB7P 4H0LD 3TYYA 1OW8A 5KKZB 1PPJG 2FFDA 3TNUA 1KILC 1X0TA 2HODB 2L91A 1AVOA 1FZBA 4I6MC 1MKMA 1LT9C 4XA4A 5DJTB 4L76A 1S5LX 1Y47A 1YTZI 2N9YB 5CBOA 5H2FH 5KKZC 3H25A 2JEEA 3V2PA 2C0XA 3N7NA 1KYOH 4WBAA 3W68A 5BU8B 4WWIA 1KQFB 1LWUB 5CCGD 1NTZG 1NTZE 2V7QH 1N86A 3M0AA 3CX5H 4H0LB 2I1KA 2V7QJ 3LW5J 2K1AA 4I2LC 3FX0A 4U3FD 3IR9A 2GA1A 3MUDA 2K9YA 1ZR4A 1W2BO 2WSSH 3L71E 3L71G 1BCCE 4D6TE 2IBZE 3B71A 1JY2O 3M06A 1KFNA 1KTMA 3WMM0 1EC5A 4Y28J 3WU2E 1KV4A 1KZUB 1LTBC 2AEMA 1VF5D 5GTHH 3NMDA 3H1LD 3N4XA 2XDJA 4WY4D 3HE5B 2YO3A 4L73A 2IYPA 2G3AA 3A3YB 1SQXD 1L4AC 5AVRB 1OWAA 3WUVA 1NTZK 5CCHA 2KIKA 1VQ8P 1ZV8A 1BGYJ 1L0LE 1L0LG 1RQVA 2K9JB 2C0WA 3Q5RA 1SQQE 1X79B 2FYUJ 1NAFA 5AVQB 1PGOA 2YO2A 1GU5A 1L0LD 5KLIB 2QM7A 1PP9D 1Q2NA 1Q90D 1SQVK 1W2EA 1MFZA 2B89A 3GF7A 3IF4A 5L8RJ 3CCJP 3L70J 1VQ4P 3HD7D 4TLFA 4NPFX 5APSA 2KYVA 3H1HJ 3D6ZA 5KLIC 2OYHC 3F89A 2E76C 4Z1MH 2H89C 4PD4I 2PAJA 1FZEA 2K37A 4IFMA 1N73A 1PFIA 2BEZF 2FYUK 2O01J 3WUTA 5AVVB 1Z56A 1KMIZ 3D6YA 1NTKE 3AEDC 4HJGH 3RK3D 1J2JB 3CCLP 2W83C 2N1TA 2YNYA 1SQPG 2JWDA 5APWA 1OXZA 2A06G 1HBWA 1GK6A 3L36A 4EI2A 1CI6B 1SQPD 4I1LA 1M1JA 5KLVG 2QEXP 3V2QA 3L72G 4IL6X 1PGQA 3FWNA 1W5CE 2R3SA 4ZMDA 1JM0A 1JMBA 3CWBG 5AW8B 1WMKA 1SFCA 2Q5UA 1N7SB 5KJ7A 3PP5A 1OW6A 2NPSC 4BWNA 3A5TA 1PL5A 1R5LA 3BCCD 1VQMP 4R4LA 5M1BA 3CX5D 3TSIA 2BCCD 1WRGA 1JTHA 1SLQA 2VRSA 2IPPA 2OYHB 1KILA 2J58A 5APQA 1X22A 3RK3E 1E79H 2HPCB 2FY8A 2BCCE 2JDIH 4W80A 3G6EP 1D7MA 1JCDA 1KQLA 1DX7A 1X8YA 3RK2C 3H1LG 2A06E 1LTJA 3W67A 1YHQP 2IFNA 3C8VA 1FZGA 1AFOA 3M9HA 4EIJA 3T97B 1N7SD 3I55P 1MZ9A 2KS1B 5CHXA 1VQOP 1AV1A 3KQGA 1M56D 2YMKA 2Q9IA 2B87B 2ZFCA 3TK1A 3AEGC 3Q1MA 1JY3N 2WSFH 2H7HA 2WT7A 2JWAA 1JY2N 1GTWA 1SQBG 3H1IJ 3S4RA 4BRYA 3JSVC 2WMMA 1BCCG 1S72P 2NRGA 4HB1A 1FJKA 1SQXE 1KB9D 1T3UA 2WZ7A 3VOPA 1N7SC 1QVFO 2HR3A 3BATA 2FFDC 1G2CB 4JYCA 4PJ0E 4RESB 3RK3B 3AEAC 2CK3H 2E43A 2RN0A 2HLOA 5CCGA 1M1JC 4IL6E 5TISH 3BRTB 3MD0A 1FJPA 1J1DB 1PP9E 1BE3G 2R32A 3L70D 2N1TC 5TISE 1YI2P 3CX5E 1LWUC 1ZLLA 1LTGC 1VQLP 1IJDB 2AEJA 3KZIH 3M9BA 1EQ7A 4H0LC 3U1CA 1EDLA 1H0TB 5EFWB 1VPCA 3O6QB 2E75B 2KOGA 1EZVD 2Q6QA 5AVXB 3RL0g 1UIXA 3NTNA 5KAFH 3BVHA 4H13B 5AVZB 1AQTA 1NOHA 2HG5D 1X9VA 1GZLA 5KAFE 3RL0C 1U57A 2GUVA 2J59M 3LW5H 3KXDA 4RJTA 1XTGB 3CC4P 4JBZA 1KB9I 1LTTC 1OMIA 2E75C 3S1KA 5KAIH 1XTCC 1SQPE 3O8ZA 2G8YA 3RK3C 4D6TD 1HJBA 1FZCA 1EXIA 2A06D 2AXTH 3Q5PA 3GG2A 1H89A 1VQNP 2BCCG 1KD1Q 1J1EB 2ZVNB 4GOFA 1BE3J 1IFMA 1NTKD 1VQ5P 3A0HE 1LJ2A 1BDDA 5KLVE 1QVGO 4BRYB 3AE2C 1MFTA 3TGUJ 4TT3H 3G9RA 2XKMA 1AVYA 4IL6H 1IFIA 3I5CA 1VF5C 4N78E 4PJ0H 3UIAA 3VMZA 2KZIA 3GHGA 4LC1A 4EDFA 1MUUA 3L75J 1HH0A 1SQVD 1RY3A 1KB9E 1JNMA 1KFMA 1N7LA 1YITP 4ZKUA 3O6QA 1FAVA 2IX7C 5H2FE 3CCRP 2KI7B 1KYOD 3BCCG 1IFNA 3PLNA 1DEEG 1YTZT 3H1IG 3PJSK 1N2DC 3RL0B 4YXDC 2HPCA 2Y9YA 2P67A 2M3EA 3H6PA 1LT1A 1OIPA 2M5AB 3EFGA 3L37A 2QJPB 2E74B 3OAKA 2B9BA 1ZR2A 1A02F 2XU6A 2FFDB 1N7SA 3TDKA 1FZAA 2OTKE 3H1LJ 3JCUH 1KQGB 3OJAB 1S5LH 3S9OA 1QL1A 3G4SP 3VN0A 2WSEH 4UB6H 1LTAC 2AEFA 2WSEJ 2Z5IA 2WSCH 1FOSE 2MJZA 2YKPA 2WTYA 2KP8A 3GLMA 1DD4A 1HJ0A 1GL2D 1HTLC 5AVUB 1BGYD 1IFDA 2JKVA 2XNDH 1SP4A 1UIIA 3AE5C 3L71D 4H44C 2N1TB 4KHXA 3SWKA 3Q3DA 1KC8Q 1OVRA 2ZYGA 3CWBJ 4HH2A 3EFFK 1M90Q 4H13D 1BE3E 4YTPC 1Q86Q 5KLVJ 2IBZG 4L75A 3KHUA 1NTKK 3A0BE 2D2CD 2Y0CA 5DJUB 1SQVE 2DW3A 2WPQA 2W8ZA 1YJ9P 5KLVD 5AW5B 3Q5SA 1VQPP 1EZVE 2XZRA 3F5HA 1KN7A 1E5WA 1TU3F 1ZMEC 1LP1B 4WY4B 3V2RA 3U1AA 1L0LK 2I1JA 2OYHA 2YIUC 1JTHB 3AE7C 4JQ0D 3RK2B 3L70E 5GTHE 3D71A 1K9MQ 2Z4EA 4PD4D 3WU2H 2KZJA 1JY2P 3P8MC 1OVUA 3B5NC 4K35A 1EDIA 2K9JA 5B5EH 5K5GB 1J1EC 1P84H 2QG4A 4UB8E 5APTA 1S5LE 3JCUE 3C1LA 4DT0A 1VL2A 4RO0A 1CZQA 1T6AA 3V2NA 1ZOYC 5KJ7C 2YXQB 1RE4A 1S4XA 3IAOA 3PH0A 1CI6A 3KPEA 2A45G 2FYUG 4OGQB 5APUA 4N6JA 3RL0D 1GW3A 1L0LJ 2O1KA 3BCCJ 1JUNA 4IOIH 1DEBA 4WY4C 1KB9H 1SQPK 2FXOA 2FYNC 5CCHD 2C9LY 4AUWA 1L0NE 3L75G 2IZ1A 1YBKA 1BE3D 2KUBA 3CC7P 1LWUA 4ASVA 1NJIQ 1IO4A 1JCCA 3TGUG 3H1HE 2ZJSE 1VF5B 3MUDC 1U7MA 1MV8A 1QEXA 2KSEA 1U7JA 1YJWP 1PGJA 4YXWH 2OTLP 1NTME 3SFDC 2XNXA 5AW1B 2OTJP 3LIDA 1AQ5A 3WUUA 1P84I 2BCCJ 2AXTE 3CL3D 2IFMA 1N8RQ 1NTMD 2IYOA 3A2AA 4C7NB 1NTZJ 1T3JA 5KAIE 1YIJP 1IFPA 1KYOE 3P8CE 4LLHA 2O01H 1FC2C 4XFJA 3EQ2A 1A02J 1G2CA 4GDOA 3BRVB 4R4MA 2WSCJ 1PPJD 3HUSA 1N73B 1L0ND 2JP3A 5AVYB 2KLVA 2RMZA 1KILE 3PHLA 3M0DC 4DCKA 2R44A 2W6AA 3GMAA 2SPZA 3LIEA 1NU1K 1M8OB 1HGZA 2IDBA 1L4AD 1SQBK 4YPCA 3CCQP 2B87A 4KJMA 4A7PA 5BVZA 3AE3C 3VP9A 2KS1A 2M3BA 2ZVOB 1IZNB 4N78D 3NFQA 4CPGA 1RF1B 3JC22 1H88A 2P2UA 3L73G 2MKVA 5CJ4A 3V4QA 1P84D 2H88C 1NKZB 4JYBA 3MGNA 4PD4E 1VQKP 1S2EA 1LTJC 2H8PD 3H1ID 4PV1C 5CJ0A 1RF0A 2D2CB 5CCGC 1Q82Q 1GU4A 2ZT9C 3TF5A 1NU1G 1EZVI 1GMJA 1BCCJ 1USEA 1BSHA 1LT9A 1SQBJ 1VDFA 3H32B 1S3JA 1Y9BA 4NPEA 1SQXJ 2E75D 2YIUB 3P8CD 2RKLA 1SFCC 1PV3A 1NH4A 3HE4A 3TGUD 1DH3A 4DJGA 1OW7A 1USDA 3EWKA 3CXHE 1PP9J 3QH9A 1OZHA 1QL2A 2HFED 1EDKA 1G1JA 3KDPB 4JF7A 2OQQA 5AW4B 3CPWO 2LR2A 1RHZB 3CXHD 3HTKA 3HUSC 1ZXGA 4I7ZB 3H1HD 1PIXA 1SFCD 3CI9A 5KJ7D 4U7JA 3G3ZA 3H1KE 1LTJB 1NU1D 1URQA 1RE3C 4C7NA 3AEFC 1EXJA 2FYNB 3A0BH 5KTBA 3A7OA 1YQ4C 1J1DC 2IZ0A 1KYOI 2ZT9D 2FKWB 3AE8C 3B5ND 3L72J 4U3FG 1RF1A 2QE7H 2Q7CA 2E76D 2FBWC 4C7RA 3IN6A 3P7KA 4D6TJ 3CCMP 3KYQA 2QJYB 3AEEC 1YYCA 1SQPJ 1CSBA 1ZN5A 1SFCB 3B4SA 1WT6A 2E42A 1URQD 2CPSA 1BSNA 3K5BA 5B5EE 1SQVG 1YJNP 3AE6C 2M0BA 2PRRA 3H1IE 3HUSB 3MIWA 5AW9B 1AJYA 3H1JG 3FXEA 2Q3IA 2WVRA 1KQSO 3E7KA 3HD7A 3CXHH 3H1HG 3HD7B 3M91A 3CXHI 4LGDE 2V4HA 4Y99C 3H1JD 3L70G 1AA0A 3L74E 3MHVA 2WWWA 4H44D 2L5GB 4W7YA 1QX8A 5AW2B 3VMXA 4PV1D 1Q7YQ 1CW5A 2E74D 1VQ6P 2E5YA 2O3JA 2ZYDA 3P32A 1JO5A 1NAYA 3AE1C 2I8DA 3FGAD 1KILD 1KORA 2N9BA 3CCEP 1BGYG 1BGYE 2E76B 2WPSA 4C46A 2B88A 2D2CC 2R5BA 2RH0A 3R2PA 1NYHA 3AE9C 3H1KD 1IC2A 5BU5A 1HGVA 1NO4A 2GM4A 1SQQK 1NWQA 2E74C 1S9KE 4PD4H 4WY4A 3MTUE 3L35A 2A45H 2OGUA 2XV5A 3H1LE 2A45I 4WVZA 5AW6B 3VYIA 1HVVA 2O1JA 4UB6E 4QMAA 2P7JA 3SWYA 2Q3EA 4GKGA 2CPBA 3AE4C 2QIWA 1SS1A 3L71J 4XE5B 2P10A 1L0NK 1BDCA 2KNCB 3C9IA 1JMMA 3I56P 2Y0DA 3SWFA 1L2PA 3HE5A 5AVSB 3MP7B 3V6IA 1EZVG 2QJPC 3FWLA 3L73E 5E79H 2HYNA 5AW3B 3SSUA 2P1JA 5CBNA 1SQBD 1IK9A 2POHA 3CCUP 2WT7B 1JB0J 2AXCA 3E1IA 3U59A 5B66H 1SQQJ 2FYUE 2KNCA 4MN4C 2QM8A 1GDTA 5TJHA 1VQ7P 5B66E 1PGPA 2KSJA 3L74D 4JPZB 1SQQG 2LXBA 4ZKPA 4ZNCA 1G1IA 1GL2C 1ZRTD 2FXMA 2GUSA 3OA7A 1LT9B 1RE3A 2K88A 1K05A 2N1TD 3H32A 4EOTA 3CMEP 3PRJA 1FDIA 1L0NG 1LTSC 1LGHB 1IK7A 1SVFA 1RH5B 2PFXA 3KZIE 3L75E 4AQRD 2R5DA 2R3CA 1NHLA 2ZAEB 1FE6A 1GL2B 5GTIE 3D70A 2NPSA 1P84E 1GL2A 1NTMJ 2WPRA 4UB8H 1NTZD 3VP8A 2YXRB 2ZYAA 3VMAA 1RF0C 2HODA 2KK7A 3TNUB 2E5TA 3SFEC 1S9KD 1OVVA 2OARA 2WQYC 5GTIH 5KLVK 2WSFJ 1RQUA 4IFDK 1DIPA 3HRNA 3L72D 1NTKJ 1Y8AA 5CMZA 2KLUA 1K04A 4Y99B 1K8AQ 5C39A 1T2KC 2P58A 3GHGC 4OGQC 4ASWA 3B5NB 3BCCE 4H13C 4OVNF 3ABVC 2JO1A 2O01N 3FXDA 4N3YB 5APYA 4DZOA 5CCHC 1LNQA 3IFMA 3L73D 2YKOA 5E79E 3CC2P 2C9NY 2M5AA 1PPJE 3USSA 2BASA 2K3RA 2QVAA 3CWBE 3CX5I 2UWJE 1M1KQ 1FZCC 2QJYC 1NVOA 3H1KJ 1FDMA 4RKUJ 2W90A 3NXSA 2ITAA 3H1JJ 1FZFA 3H1JE 1M57D 4KT0J 4L74A 3V4WA 1GD2E 5AVWB 3L75D 3Q2YA 1PZQA 1SQVJ 2PP6A 4M3LA 1HF9A 4OWFA 3ITKA 3L74G 1FBMA 3GHGB 1H0TA 1URQB 3CLQA 1QGKB 4GT1A 1L4AA 4NPDA 4GOEA 2QA4P 3M0DA 2WITA 2W27A 1FDOA 1DD3A 4D6TG 4DOJA 1VQ9P 1T2KD 2W6JH 2Q1KA 3AEBC 2QRXA 2NZ2A 4OGQD 1SQXK 1ZP0C 2ZXXA 4U3FJ 1JY3O 1YQ3C 2ZT9B 3BASA 3VTPC 2ZXEB 1SQBE 1JEKA 2NPSD 3RBZA 1FZCB 2KXPB 1NKNA 2QJKC 2YMYA 1HUCA 2Z5HA 1H8AA 1R8EA 2OYIC 3L74J 3G71P 1S1CX 1JOCA 1T8ZA 2JR8A 1NGMB 2FXPA 1EDJA 3HD7C 2W6BA 3II6A 1JY3P 1PP9G 3A0HH 1K73Q 3RK2D 3VMYA 4EYYQ 3OW2O 3H1KG 3AECC 1Q81Q 2WPVB 3CCSP 3TGUE 4WB4A 1L4AB 2LKMA 3CWBD 2IBZI 3GW6A 2LXCB 3MZWB 1URQC 3PTZA 1SQQD 2JJLA 2FYUD 2NPSB 1BCCD 1FU1A 2QSIA 1IFJA 3QWOC 4GIFA 4I7ZC 4W7ZA 1SQXG 1M7LA 1LP1A 1NTMK 4AYCA 1ZRTE 4IFFA 5AW7B 1N73C 3R4YA 3V5BA 2M8RA 1RF1C 2J5UA 4B86A 1GK4A 3L72E 3CMAP 3L4FA 1KILB 1LTIC 1NU1J 1NU1E 3CCVP 2OYIB 1FOSF 1RE4C 3HTKB 4HYTB 2QJKB 3ZDMA 4O9BA 1FS0E 1NTKG 1QLED 4H44B 2OYOA 5AVTB 4PV1B 3E1RA 1ZW0A 4BXLA 4HKZH 5AW0B 3L73J 2BEQD 1GW4A 3M9QA 2FYZA 3B5NA 3B8EB 3HE4B 2Y9ZA 4U3FE 3RGUA 1NTMG 2YKQA 5APVA 3CD6P 1M1JB 1R5SA 4K3AA
chains in the Genus database with same CATH topology
2H43A 4OH8B 5APXA 1HWTC 3T97A 2OYIA 2KB7P 3TYYA 2FFDA 3TNUA 1KILC 4I6MC 2HODB 1IO4A 1FZBA 4XA4A 1LT9C 1YTZI 2JEEA 3V2PA 2C0XA 3N7NA 4WBAA 5BU8B 1LWUB 5CCGD 1N86A 3M0AA 2I1KA 4I2LC 3IR9A 3MUDA 1ZR4A 1JY2O 3M06A 1KFNA 3WMM0 1KZUB 1LTBC 3NMDA 3N4XA 2XDJA 4WY4D 3HE5B 2YO3A 3A3YB 1L4AC 5AVRB 1OWAA 1NTZK 5CCHA 1ZV8A 2C0WA 1X79B 1NAFA 5AVQB 2YO2A 1GU5A 2QM7A 1SQVK 1W2EA 1MFZA 3HD7D 5APSA 2KYVA 2OYHC 2PAJA 1FZEA 4IFMA 1PFIA 2FYUK 5AVVB 1Z56A 3RK3D 1J2JB 2YNYA 2N1TA 5APWA 1OXZA 1HBWA 1GK6A 3L36A 1CI6B 4I1LA 1M1JA 3V2QA 5AW8B 1SFCA 2Q5UA 1N7SB 5KJ7A 3PP5A 2NPSC 3A5TA 3TSIA 1WRGA 1JTHA 1SLQA 2VRSA 2IPPA 2OYHB 1KILA 2J58A 5APQA 2HPCB 4W80A 1DX7A 1KQLA 1JCDA 1X8YA 3RK2C 1LTJA 1FZGA 2IFNA 1AFOA 3M9HA 4EIJA 1N7SD 1MZ9A 5CHXA 3KQGA 2H7HA 2Q9IA 3TK1A 2ZFCA 1JY3N 2WSFH 2WT7A 1JY2N 1GTWA 1FJKA 1T3UA 2WZ7A 3VOPA 1N7SC 3BATA 1G2CB 4JYCA 4RESB 3RK3B 2E43A 2HLOA 5CCGA 1M1JC 3BRTB 3MD0A 1FJPA 1J1DB 2R32A 2N1TC 1LWUC 1ZLLA 1LTGC 1IJDB 3M9BA 1EQ7A 3U1CA 1VPCA 2KOGA 3BVHA 5AVXB 3NTNA 5AVZB 3RL0C 1NOHA 2HG5D 1X9VA 1GZLA 2GUVA 2J59M 3LW5H 1XTGB 1LTTC 1XTCC 3O8ZA 3RK3C 1HJBA 1FZCA 1H89A 1J1EB 1IFMA 2XKMA 4N78E 1IFIA 3I5CA 1JO5A 3UIAA 3GHGA 4LC1A 1MUUA 1HH0A 1RY3A 1JNMA 1KFMA 1N7LA 4ZKUA 1FAVA 2IX7C 1IFNA 3RL0B 1YTZT 2HPCA 1N2DC 2P67A 3H6PA 3EFGA 3L37A 3OAKA 1ZR2A 1A02F 2XU6A 2FFDB 1N7SA 1FZAA 3OJAB 1QL1A 3VN0A 2WSEH 1LTAC 2Z5IA 2WSCH 1FOSE 2MJZA 2YKPA 2WTYA 2KP8A 5AVUB 1GL2D 1HTLC 1IFDA 1SP4A 2N1TB 4KHXA 4HH2A 1NTKK 2WPQA 5AW5B 2XZRA 1E5WA 4WY4B 3V2RA 3U1AA 1L0LK 2I1JA 2OYHA 1JTHB 3RK2B 2Z4EA 1JY2P 3P8MC 3B5NC 1J1EC 5APTA 1CZQA 3V2NA 5KJ7C 1RE4A 1CI6A 3KPEA 2A45G 5APUA 3RL0D 4N6JA 1GW3A 2O1KA 1JUNA 1DEBA 4WY4C 1SQPK 2C9LY 5CCHD 4AUWA 1LWUA 1JCCA 1MV8A 2XNXA 5AW1B 3LIDA 1AQ5A 3CL3D 2IFMA 4C7NB 3A2AA 1T3JA 3P8CE 4LLHA 2O01H 3EQ2A 1A02J 1G2CA 3BRVB 3HUSA 1N73B 5AVYB 2KLVA 3M0DC 2W6AA 3LIEA 1NU1K 1HGZA 1L4AD 1SQBK 5BVZA 3VP9A 2M3BA 4N78D 3NFQA 1RF1B 1H88A 2P2UA 5CJ4A 3V4QA 1NKZB 4JYBA 3MGNA 2H8PD 1LTJC 5CJ0A 5CCGC 1RF0A 1GU4A 1LT9A 1VDFA 3H32B 3P8CD 1SFCC 1NH4A 3HE4A 1DH3A 1QL2A 2HFED 3KDPB 1G1JA 4JF7A 5AW4B 1N73A 3HTKA 3HUSC 3CI9A 1SFCD 5KJ7D 3G3ZA 1LTJB 1URQA 1RE3C 4C7NA 5KTBA 3A7OA 1J1DC 1RF1A 2FKWB 3B5ND 2Q7CA 4C7RA 3P7KA 3KYQA 1YYCA 1ZN5A 1CSBA 1SFCB 1WT6A 2E42A 1URQD 2CPSA 3MIWA 3HUSB 5AW9B 2Q3IA 3HD7A 3M91A 4LGDE 3HD7B 4Y99C 3VMZA 4W7YA 2WWWA 2L5GB 5AW2B 3VMXA 1CW5A 3P32A 1KILD 2N9BA 2WPSA 4C46A 2R5BA 3R2PA 1IC2A 5BU5A 1HGVA 1NO4A 2GM4A 1SQQK 1NWQA 1S9KE 4WY4A 3MTUE 3L35A 2A45H 2XV5A 5AW6B 3VYIA 2A45I 1HVVA 2O1JA 3SWYA 2P7JA 4GKGA 2CPBA 4XE5B 1L0NK 3C9IA 1JMMA 3SWFA 3HE5A 5AVSB 5AW3B 2HYNA 2P1JA 2POHA 1IK9A 2WT7B 3E1IA 3U59A 2QM8A 1GDTA 2KSJA 4ZKPA 1G1IA 1GL2C 2FXMA 3OA7A 2GUSA 1LT9B 1RE3A 2N1TD 3H32A 4EOTA 1LTSC 1LGHB 1SVFA 4AQRD 2R5DA 2R3CA 1NHLA 1GL2B 2NPSA 3VP8A 1GL2A 2WPRA 1RF0C 2HODA 3TNUB 1S9KD 2OARA 5KLVK 4IFDK 3HRNA 5CMZA 4Y99B 1T2KC 3GHGC 3B5NB 4DZOA 4N3YB 5APYA 5CCHC 3IFMA 2YKOA 2C9NY 2BASA 1FZCC 1FDMA 3NXSA 1FZFA 1GD2E 3V4WA 5AVWB 2PP6A 4M3LA 1FBMA 3GHGB 1URQB 3CLQA 4GT1A 1L4AA 3M0DA 2WITA 2W27A 4DOJA 1T2KD 1SQXK 1JY3O 3BASA 3VTPC 2ZXEB 1FZCB 2NPSD 1NKNA 2YMYA 1HUCA 2Z5HA 1H8AA 2OYIC 1T8ZA 1JOCA 3HD7C 2W6BA 3II6A 1JY3P 3RK2D 3VMYA 4WB4A 1L4AB 2LKMA 1URQC 2JJLA 2NPSB 4GIFA 4W7ZA 1FU1A 2FFDC 1IFJA 1M7LA 1NTMK 4AYCA 4IFFA 5AW7B 1N73C 3V5BA 2M8RA 1RF1C 4B86A 1GK4A 1FOSF 3L4FA 1KILB 1LTIC 2OYIB 1RE4C 3HTKB 4HYTB 4O9BA 5AVTB 5AW0B 1GW4A 3M9QA 2FYZA 3B5NA 3B8EB 3HE4B 5APVA 2YKQA 1M1JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M3B A;  1ZLL A;  1FJP A;  2KB7 P;  2HYN A;  1N7L A;  1FJK A;  2KYV A; 
#chains in the Genus database with same CATH topology
 2H43 A;  4OH8 B;  4GOD A;  1OFC X;  1OX3 A;  2IBZ D;  5APX A;  3RBX A;  2PGD A;  3T97 A;  2OYI A;  1HWT C;  1L0N J;  3GF3 A;  2Y0E A;  2KB7 P;  4H0L D;  3TYY A;  1OW8 A;  5KKZ B;  1PPJ G;  2FFD A;  3TNU A;  1KIL C;  1X0T A;  2HOD B;  2L91 A;  1AVO A;  1FZB A;  4I6M C;  1MKM A;  1LT9 C;  4XA4 A;  5DJT B;  4L76 A;  1S5L X;  1Y47 A;  1YTZ I;  2N9Y B;  5CBO A;  5H2F H;  5KKZ C;  3H25 A;  2JEE A;  3V2P A;  2C0X A;  3N7N A;  1KYO H;  4WBA A;  3W68 A;  5BU8 B;  4WWI A;  1KQF B;  1LWU B;  5CCG D;  1NTZ G;  1NTZ E;  2V7Q H;  1N86 A;  3M0A A;  3CX5 H;  4H0L B;  2I1K A;  2V7Q J;  3LW5 J;  2K1A A;  4I2L C;  3FX0 A;  4U3F D;  3IR9 A;  2GA1 A;  3MUD A;  2K9Y A;  1ZR4 A;  1W2B O;  2WSS H;  3L71 E;  3L71 G;  1BCC E;  4D6T E;  2IBZ E;  3B71 A;  1JY2 O;  3M06 A;  1KFN A;  1KTM A;  3WMM 0;  1EC5 A;  4Y28 J;  3WU2 E;  1KV4 A;  1KZU B;  1LTB C;  2AEM A;  1VF5 D;  5GTH H;  3NMD A;  3H1L D;  3N4X A;  2XDJ A;  4WY4 D;  3HE5 B;  2YO3 A;  4L73 A;  2IYP A;  2G3A A;  3A3Y B;  1SQX D;  1L4A C;  5AVR B;  1OWA A;  3WUV A;  1NTZ K;  5CCH A;  2KIK A;  1VQ8 P;  1ZV8 A;  1BGY J;  1L0L E;  1L0L G;  1RQV A;  2K9J B;  2C0W A;  3Q5R A;  1SQQ E;  1X79 B;  2FYU J;  1NAF A;  5AVQ B;  1PGO A;  2YO2 A;  1GU5 A;  1L0L D;  5KLI B;  2QM7 A;  1PP9 D;  1Q2N A;  1Q90 D;  1SQV K;  1W2E A;  1MFZ A;  2B89 A;  3GF7 A;  3IF4 A;  5L8R J;  3CCJ P;  3L70 J;  1VQ4 P;  3HD7 D;  4TLF A;  4NPF X;  5APS A;  2KYV A;  3H1H J;  3D6Z A;  5KLI C;  2OYH C;  3F89 A;  2E76 C;  4Z1M H;  2H89 C;  4PD4 I;  2PAJ A;  1FZE A;  2K37 A;  4IFM A;  1N73 A;  1PFI A;  2BEZ F;  2FYU K;  2O01 J;  3WUT A;  5AVV B;  1Z56 A;  1KMI Z;  3D6Y A;  1NTK E;  3AED C;  4HJG H;  3RK3 D;  1J2J B;  3CCL P;  2W83 C;  2N1T A;  2YNY A;  1SQP G;  2JWD A;  5APW A;  1OXZ A;  2A06 G;  1HBW A;  1GK6 A;  3L36 A;  4EI2 A;  1CI6 B;  1SQP D;  4I1L A;  1M1J A;  5KLV G;  2QEX P;  3V2Q A;  3L72 G;  4IL6 X;  1PGQ A;  3FWN A;  1W5C E;  2R3S A;  4ZMD A;  1JM0 A;  1JMB A;  3CWB G;  5AW8 B;  1WMK A;  1SFC A;  2Q5U A;  1N7S B;  5KJ7 A;  3PP5 A;  1OW6 A;  2NPS C;  4BWN A;  3A5T A;  1PL5 A;  1R5L A;  3BCC D;  1VQM P;  4R4L A;  5M1B A;  3CX5 D;  3TSI A;  2BCC D;  1WRG A;  1JTH A;  1SLQ A;  2VRS A;  2IPP A;  2OYH B;  1KIL A;  2J58 A;  5APQ A;  1X22 A;  3RK3 E;  1E79 H;  2HPC B;  2FY8 A;  2BCC E;  2JDI H;  4W80 A;  3G6E P;  1D7M A;  1JCD A;  1KQL A;  1DX7 A;  1X8Y A;  3RK2 C;  3H1L G;  2A06 E;  1LTJ A;  3W67 A;  1YHQ P;  2IFN A;  3C8V A;  1FZG A;  1AFO A;  3M9H A;  4EIJ A;  3T97 B;  1N7S D;  3I55 P;  1MZ9 A;  2KS1 B;  5CHX A;  1VQO P;  1AV1 A;  3KQG A;  1M56 D;  2YMK A;  2Q9I A;  2B87 B;  2ZFC A;  3TK1 A;  3AEG C;  3Q1M A;  1JY3 N;  2WSF H;  2H7H A;  2WT7 A;  2JWA A;  1JY2 N;  1GTW A;  1SQB G;  3H1I J;  3S4R A;  4BRY A;  3JSV C;  2WMM A;  1BCC G;  1S72 P;  2NRG A;  4HB1 A;  1FJK A;  1SQX E;  1KB9 D;  1T3U A;  2WZ7 A;  3VOP A;  1N7S C;  1QVF O;  2HR3 A;  3BAT A;  2FFD C;  1G2C B;  4JYC A;  4PJ0 E;  4RES B;  3RK3 B;  3AEA C;  2CK3 H;  2E43 A;  2RN0 A;  2HLO A;  5CCG A;  1M1J C;  4IL6 E;  5TIS H;  3BRT B;  3MD0 A;  1FJP A;  1J1D B;  1PP9 E;  1BE3 G;  2R32 A;  3L70 D;  2N1T C;  5TIS E;  1YI2 P;  3CX5 E;  1LWU C;  1ZLL A;  1LTG C;  1VQL P;  1IJD B;  2AEJ A;  3KZI H;  3M9B A;  1EQ7 A;  4H0L C;  3U1C A;  1EDL A;  1H0T B;  5EFW B;  1VPC A;  3O6Q B;  2E75 B;  2KOG A;  1EZV D;  2Q6Q A;  5AVX B;  3RL0 g;  1UIX A;  3NTN A;  5KAF H;  3BVH A;  4H13 B;  5AVZ B;  1AQT A;  1NOH A;  2HG5 D;  1X9V A;  1GZL A;  5KAF E;  3RL0 C;  1U57 A;  2GUV A;  2J59 M;  3LW5 H;  3KXD A;  4RJT A;  1XTG B;  3CC4 P;  4JBZ A;  1KB9 I;  1LTT C;  1OMI A;  2E75 C;  3S1K A;  5KAI H;  1XTC C;  1SQP E;  3O8Z A;  2G8Y A;  3RK3 C;  4D6T D;  1HJB A;  1FZC A;  1EXI A;  2A06 D;  2AXT H;  3Q5P A;  3GG2 A;  1H89 A;  1VQN P;  2BCC G;  1KD1 Q;  1J1E B;  2ZVN B;  4GOF A;  1BE3 J;  1IFM A;  1NTK D;  1VQ5 P;  3A0H E;  1LJ2 A;  1BDD A;  5KLV E;  1QVG O;  4BRY B;  3AE2 C;  1MFT A;  3TGU J;  4TT3 H;  3G9R A;  2XKM A;  1AVY A;  4IL6 H;  1IFI A;  3I5C A;  1VF5 C;  4N78 E;  4PJ0 H;  3UIA A;  3VMZ A;  2KZI A;  3GHG A;  4LC1 A;  4EDF A;  1MUU A;  3L75 J;  1HH0 A;  1SQV D;  1RY3 A;  1KB9 E;  1JNM A;  1KFM A;  1N7L A;  1YIT P;  4ZKU A;  3O6Q A;  1FAV A;  2IX7 C;  5H2F E;  3CCR P;  2KI7 B;  1KYO D;  3BCC G;  1IFN A;  3PLN A;  1DEE G;  1YTZ T;  3H1I G;  3PJS K;  1N2D C;  3RL0 B;  4YXD C;  2HPC A;  2Y9Y A;  2P67 A;  2M3E A;  3H6P A;  1LT1 A;  1OIP A;  2M5A B;  3EFG A;  3L37 A;  2QJP B;  2E74 B;  3OAK A;  2B9B A;  1ZR2 A;  1A02 F;  2XU6 A;  2FFD B;  1N7S A;  3TDK A;  1FZA A;  2OTK E;  3H1L J;  3JCU H;  1KQG B;  3OJA B;  1S5L H;  3S9O A;  1QL1 A;  3G4S P;  3VN0 A;  2WSE H;  4UB6 H;  1LTA C;  2AEF A;  2WSE J;  2Z5I A;  2WSC H;  1FOS E;  2MJZ A;  2YKP A;  2WTY A;  2KP8 A;  3GLM A;  1DD4 A;  1HJ0 A;  1GL2 D;  1HTL C;  5AVU B;  1BGY D;  1IFD A;  2JKV A;  2XND H;  1SP4 A;  1UII A;  3AE5 C;  3L71 D;  4H44 C;  2N1T B;  4KHX A;  3SWK A;  3Q3D A;  1KC8 Q;  1OVR A;  2ZYG A;  3CWB J;  4HH2 A;  3EFF K;  1M90 Q;  4H13 D;  1BE3 E;  4YTP C;  1Q86 Q;  5KLV J;  2IBZ G;  4L75 A;  3KHU A;  1NTK K;  3A0B E;  2D2C D;  2Y0C A;  5DJU B;  1SQV E;  2DW3 A;  2WPQ A;  2W8Z A;  1YJ9 P;  5KLV D;  5AW5 B;  3Q5S A;  1VQP P;  1EZV E;  2XZR A;  3F5H A;  1KN7 A;  1E5W A;  1TU3 F;  1ZME C;  1LP1 B;  4WY4 B;  3V2R A;  3U1A A;  1L0L K;  2I1J A;  2OYH A;  2YIU C;  1JTH B;  3AE7 C;  4JQ0 D;  3RK2 B;  3L70 E;  5GTH E;  3D71 A;  1K9M Q;  2Z4E A;  4PD4 D;  3WU2 H;  2KZJ A;  1JY2 P;  3P8M C;  1OVU A;  3B5N C;  4K35 A;  1EDI A;  2K9J A;  5B5E H;  5K5G B;  1J1E C;  1P84 H;  2QG4 A;  4UB8 E;  5APT A;  1S5L E;  3JCU E;  3C1L A;  4DT0 A;  1VL2 A;  4RO0 A;  1CZQ A;  1T6A A;  3V2N A;  1ZOY C;  5KJ7 C;  2YXQ B;  1RE4 A;  1S4X A;  3IAO A;  3PH0 A;  1CI6 A;  3KPE A;  2A45 G;  2FYU G;  4OGQ B;  5APU A;  4N6J A;  3RL0 D;  1GW3 A;  1L0L J;  2O1K A;  3BCC J;  1JUN A;  4IOI H;  1DEB A;  4WY4 C;  1KB9 H;  1SQP K;  2FXO A;  2FYN C;  5CCH D;  2C9L Y;  4AUW A;  1L0N E;  3L75 G;  2IZ1 A;  1YBK A;  1BE3 D;  2KUB A;  3CC7 P;  1LWU A;  4ASV A;  1NJI Q;  1IO4 A;  1JCC A;  3TGU G;  3H1H E;  2ZJS E;  1VF5 B;  3MUD C;  1U7M A;  1MV8 A;  1QEX A;  2KSE A;  1U7J A;  1YJW P;  1PGJ A;  4YXW H;  2OTL P;  1NTM E;  3SFD C;  2XNX A;  5AW1 B;  2OTJ P;  3LID A;  1AQ5 A;  3WUU A;  1P84 I;  2BCC J;  2AXT E;  3CL3 D;  2IFM A;  1N8R Q;  1NTM D;  2IYO A;  3A2A A;  4C7N B;  1NTZ J;  1T3J A;  5KAI E;  1YIJ P;  1IFP A;  1KYO E;  3P8C E;  4LLH A;  2O01 H;  1FC2 C;  4XFJ A;  3EQ2 A;  1A02 J;  1G2C A;  4GDO A;  3BRV B;  4R4M A;  2WSC J;  1PPJ D;  3HUS A;  1N73 B;  1L0N D;  2JP3 A;  5AVY B;  2KLV A;  2RMZ A;  1KIL E;  3PHL A;  3M0D C;  4DCK A;  2R44 A;  2W6A A;  3GMA A;  2SPZ A;  3LIE A;  1NU1 K;  1M8O B;  1HGZ A;  2IDB A;  1L4A D;  1SQB K;  4YPC A;  3CCQ P;  2B87 A;  4KJM A;  4A7P A;  5BVZ A;  3AE3 C;  3VP9 A;  2KS1 A;  2M3B A;  2ZVO B;  1IZN B;  4N78 D;  3NFQ A;  4CPG A;  1RF1 B;  3JC2 2;  1H88 A;  2P2U A;  3L73 G;  2MKV A;  5CJ4 A;  3V4Q A;  1P84 D;  2H88 C;  1NKZ B;  4JYB A;  3MGN A;  4PD4 E;  1VQK P;  1S2E A;  1LTJ C;  2H8P D;  3H1I D;  4PV1 C;  5CJ0 A;  1RF0 A;  2D2C B;  5CCG C;  1Q82 Q;  1GU4 A;  2ZT9 C;  3TF5 A;  1NU1 G;  1EZV I;  1GMJ A;  1BCC J;  1USE A;  1BSH A;  1LT9 A;  1SQB J;  1VDF A;  3H32 B;  1S3J A;  1Y9B A;  4NPE A;  1SQX J;  2E75 D;  2YIU B;  3P8C D;  2RKL A;  1SFC C;  1PV3 A;  1NH4 A;  3HE4 A;  3TGU D;  1DH3 A;  4DJG A;  1OW7 A;  1USD A;  3EWK A;  3CXH E;  1PP9 J;  3QH9 A;  1OZH A;  1QL2 A;  2HFE D;  1EDK A;  1G1J A;  3KDP B;  4JF7 A;  2OQQ A;  5AW4 B;  3CPW O;  2LR2 A;  1RHZ B;  3CXH D;  3HTK A;  3HUS C;  1ZXG A;  4I7Z B;  3H1H D;  1PIX A;  1SFC D;  3CI9 A;  5KJ7 D;  4U7J A;  3G3Z A;  3H1K E;  1LTJ B;  1NU1 D;  1URQ A;  1RE3 C;  4C7N A;  3AEF C;  1EXJ A;  2FYN B;  3A0B H;  5KTB A;  3A7O A;  1YQ4 C;  1J1D C;  2IZ0 A;  1KYO I;  2ZT9 D;  2FKW B;  3AE8 C;  3B5N D;  3L72 J;  4U3F G;  1RF1 A;  2QE7 H;  2Q7C A;  2E76 D;  2FBW C;  4C7R A;  3IN6 A;  3P7K A;  4D6T J;  3CCM P;  3KYQ A;  2QJY B;  3AEE C;  1YYC A;  1SQP J;  1CSB A;  1ZN5 A;  1SFC B;  3B4S A;  1WT6 A;  2E42 A;  1URQ D;  2CPS A;  1BSN A;  3K5B A;  5B5E E;  1SQV G;  1YJN P;  3AE6 C;  2M0B A;  2PRR A;  3H1I E;  3HUS B;  3MIW A;  5AW9 B;  1AJY A;  3H1J G;  3FXE A;  2Q3I A;  2WVR A;  1KQS O;  3E7K A;  3HD7 A;  3CXH H;  3H1H G;  3HD7 B;  3M91 A;  3CXH I;  4LGD E;  2V4H A;  4Y99 C;  3H1J D;  3L70 G;  1AA0 A;  3L74 E;  3MHV A;  2WWW A;  4H44 D;  2L5G B;  4W7Y A;  1QX8 A;  5AW2 B;  3VMX A;  4PV1 D;  1Q7Y Q;  1CW5 A;  2E74 D;  1VQ6 P;  2E5Y A;  2O3J A;  2ZYD A;  3P32 A;  1JO5 A;  1NAY A;  3AE1 C;  2I8D A;  3FGA D;  1KIL D;  1KOR A;  2N9B A;  3CCE P;  1BGY G;  1BGY E;  2E76 B;  2WPS A;  4C46 A;  2B88 A;  2D2C C;  2R5B A;  2RH0 A;  3R2P A;  1NYH A;  3AE9 C;  3H1K D;  1IC2 A;  5BU5 A;  1HGV A;  1NO4 A;  2GM4 A;  1SQQ K;  1NWQ A;  2E74 C;  1S9K E;  4PD4 H;  4WY4 A;  3MTU E;  3L35 A;  2A45 H;  2OGU A;  2XV5 A;  3H1L E;  2A45 I;  4WVZ A;  5AW6 B;  3VYI A;  1HVV A;  2O1J A;  4UB6 E;  4QMA A;  2P7J A;  3SWY A;  2Q3E A;  4GKG A;  2CPB A;  3AE4 C;  2QIW A;  1SS1 A;  3L71 J;  4XE5 B;  2P10 A;  1L0N K;  1BDC A;  2KNC B;  3C9I A;  1JMM A;  3I56 P;  2Y0D A;  3SWF A;  1L2P A;  3HE5 A;  5AVS B;  3MP7 B;  3V6I A;  1EZV G;  2QJP C;  3FWL A;  3L73 E;  5E79 H;  2HYN A;  5AW3 B;  3SSU A;  2P1J A;  5CBN A;  1SQB D;  1IK9 A;  2POH A;  3CCU P;  2WT7 B;  1JB0 J;  2AXC A;  3E1I A;  3U59 A;  5B66 H;  1SQQ J;  2FYU E;  2KNC A;  4MN4 C;  2QM8 A;  1GDT A;  5TJH A;  1VQ7 P;  5B66 E;  1PGP A;  2KSJ A;  3L74 D;  4JPZ B;  1SQQ G;  2LXB A;  4ZKP A;  4ZNC A;  1G1I A;  1GL2 C;  1ZRT D;  2FXM A;  2GUS A;  3OA7 A;  1LT9 B;  1RE3 A;  2K88 A;  1K05 A;  2N1T D;  3H32 A;  4EOT A;  3CME P;  3PRJ A;  1FDI A;  1L0N G;  1LTS C;  1LGH B;  1IK7 A;  1SVF A;  1RH5 B;  2PFX A;  3KZI E;  3L75 E;  4AQR D;  2R5D A;  2R3C A;  1NHL A;  2ZAE B;  1FE6 A;  1GL2 B;  5GTI E;  3D70 A;  2NPS A;  1P84 E;  1GL2 A;  1NTM J;  2WPR A;  4UB8 H;  1NTZ D;  3VP8 A;  2YXR B;  2ZYA A;  3VMA A;  1RF0 C;  2HOD A;  2KK7 A;  3TNU B;  2E5T A;  3SFE C;  1S9K D;  1OVV A;  2OAR A;  2WQY C;  5GTI H;  5KLV K;  2WSF J;  1RQU A;  4IFD K;  1DIP A;  3HRN A;  3L72 D;  1NTK J;  1Y8A A;  5CMZ A;  2KLU A;  1K04 A;  4Y99 B;  1K8A Q;  5C39 A;  1T2K C;  2P58 A;  3GHG C;  4OGQ C;  4ASW A;  3B5N B;  3BCC E;  4H13 C;  4OVN F;  3ABV C;  2JO1 A;  2O01 N;  3FXD A;  4N3Y B;  5APY A;  4DZO A;  5CCH C;  1LNQ A;  3IFM A;  3L73 D;  2YKO A;  5E79 E;  3CC2 P;  2C9N Y;  2M5A A;  1PPJ E;  3USS A;  2BAS A;  2K3R A;  2QVA A;  3CWB E;  3CX5 I;  2UWJ E;  1M1K Q;  1FZC C;  2QJY C;  1NVO A;  3H1K J;  1FDM A;  4RKU J;  2W90 A;  3NXS A;  2ITA A;  3H1J J;  1FZF A;  3H1J E;  1M57 D;  4KT0 J;  4L74 A;  3V4W A;  1GD2 E;  5AVW B;  3L75 D;  3Q2Y A;  1PZQ A;  1SQV J;  2PP6 A;  4M3L A;  1HF9 A;  4OWF A;  3ITK A;  3L74 G;  1FBM A;  3GHG B;  1H0T A;  1URQ B;  3CLQ A;  1QGK B;  4GT1 A;  1L4A A;  4NPD A;  4GOE A;  2QA4 P;  3M0D A;  2WIT A;  2W27 A;  1FDO A;  1DD3 A;  4D6T G;  4DOJ A;  1VQ9 P;  1T2K D;  2W6J H;  2Q1K A;  3AEB C;  2QRX A;  2NZ2 A;  4OGQ D;  1SQX K;  1ZP0 C;  2ZXX A;  4U3F J;  1JY3 O;  1YQ3 C;  2ZT9 B;  3BAS A;  3VTP C;  2ZXE B;  1SQB E;  1JEK A;  2NPS D;  3RBZ A;  1FZC B;  2KXP B;  1NKN A;  2QJK C;  2YMY A;  1HUC A;  2Z5H A;  1H8A A;  1R8E A;  2OYI C;  3L74 J;  3G71 P;  1S1C X;  1JOC A;  1T8Z A;  2JR8 A;  1NGM B;  2FXP A;  1EDJ A;  3HD7 C;  2W6B A;  3II6 A;  1JY3 P;  1PP9 G;  3A0H H;  1K73 Q;  3RK2 D;  3VMY A;  4EYY Q;  3OW2 O;  3H1K G;  3AEC C;  1Q81 Q;  2WPV B;  3CCS P;  3TGU E;  4WB4 A;  1L4A B;  2LKM A;  3CWB D;  2IBZ I;  3GW6 A;  2LXC B;  3MZW B;  1URQ C;  3PTZ A;  1SQQ D;  2JJL A;  2FYU D;  2NPS B;  1BCC D;  1FU1 A;  2QSI A;  1IFJ A;  3QWO C;  4GIF A;  4I7Z C;  4W7Z A;  1SQX G;  1M7L A;  1LP1 A;  1NTM K;  4AYC A;  1ZRT E;  4IFF A;  5AW7 B;  1N73 C;  3R4Y A;  3V5B A;  2M8R A;  1RF1 C;  2J5U A;  4B86 A;  1GK4 A;  3L72 E;  3CMA P;  3L4F A;  1KIL B;  1LTI C;  1NU1 J;  1NU1 E;  3CCV P;  2OYI B;  1FOS F;  1RE4 C;  3HTK B;  4HYT B;  2QJK B;  3ZDM A;  4O9B A;  1FS0 E;  1NTK G;  1QLE D;  4H44 B;  2OYO A;  5AVT B;  4PV1 B;  3E1R A;  1ZW0 A;  4BXL A;  4HKZ H;  5AW0 B;  3L73 J;  2BEQ D;  1GW4 A;  3M9Q A;  2FYZ A;  3B5N A;  3B8E B;  3HE4 B;  2Y9Z A;  4U3F E;  3RGU A;  1NTM G;  2YKQ A;  5APV A;  3CD6 P;  1M1J B;  1R5S A;  4K3A A; 
#chains in the Genus database with same CATH homology
 2H43 A;  4OH8 B;  5APX A;  1HWT C;  3T97 A;  2OYI A;  2KB7 P;  3TYY A;  2FFD A;  3TNU A;  1KIL C;  4I6M C;  2HOD B;  1IO4 A;  1FZB A;  4XA4 A;  1LT9 C;  1YTZ I;  2JEE A;  3V2P A;  2C0X A;  3N7N A;  4WBA A;  5BU8 B;  1LWU B;  5CCG D;  1N86 A;  3M0A A;  2I1K A;  4I2L C;  3IR9 A;  3MUD A;  1ZR4 A;  1JY2 O;  3M06 A;  1KFN A;  3WMM 0;  1KZU B;  1LTB C;  3NMD A;  3N4X A;  2XDJ A;  4WY4 D;  3HE5 B;  2YO3 A;  3A3Y B;  1L4A C;  5AVR B;  1OWA A;  1NTZ K;  5CCH A;  1ZV8 A;  2C0W A;  1X79 B;  1NAF A;  5AVQ B;  2YO2 A;  1GU5 A;  2QM7 A;  1SQV K;  1W2E A;  1MFZ A;  3HD7 D;  5APS A;  2KYV A;  2OYH C;  2PAJ A;  1FZE A;  4IFM A;  1PFI A;  2FYU K;  5AVV B;  1Z56 A;  3RK3 D;  1J2J B;  2YNY A;  2N1T A;  5APW A;  1OXZ A;  1HBW A;  1GK6 A;  3L36 A;  1CI6 B;  4I1L A;  1M1J A;  3V2Q A;  5AW8 B;  1SFC A;  2Q5U A;  1N7S B;  5KJ7 A;  3PP5 A;  2NPS C;  3A5T A;  3TSI A;  1WRG A;  1JTH A;  1SLQ A;  2VRS A;  2IPP A;  2OYH B;  1KIL A;  2J58 A;  5APQ A;  2HPC B;  4W80 A;  1DX7 A;  1KQL A;  1JCD A;  1X8Y A;  3RK2 C;  1LTJ A;  1FZG A;  2IFN A;  1AFO A;  3M9H A;  4EIJ A;  1N7S D;  1MZ9 A;  5CHX A;  3KQG A;  2H7H A;  2Q9I A;  3TK1 A;  2ZFC A;  1JY3 N;  2WSF H;  2WT7 A;  1JY2 N;  1GTW A;  1FJK A;  1T3U A;  2WZ7 A;  3VOP A;  1N7S C;  3BAT A;  1G2C B;  4JYC A;  4RES B;  3RK3 B;  2E43 A;  2HLO A;  5CCG A;  1M1J C;  3BRT B;  3MD0 A;  1FJP A;  1J1D B;  2R32 A;  2N1T C;  1LWU C;  1ZLL A;  1LTG C;  1IJD B;  3M9B A;  1EQ7 A;  3U1C A;  1VPC A;  2KOG A;  3BVH A;  5AVX B;  3NTN A;  5AVZ B;  3RL0 C;  1NOH A;  2HG5 D;  1X9V A;  1GZL A;  2GUV A;  2J59 M;  3LW5 H;  1XTG B;  1LTT C;  1XTC C;  3O8Z A;  3RK3 C;  1HJB A;  1FZC A;  1H89 A;  1J1E B;  1IFM A;  2XKM A;  4N78 E;  1IFI A;  3I5C A;  1JO5 A;  3UIA A;  3GHG A;  4LC1 A;  1MUU A;  1HH0 A;  1RY3 A;  1JNM A;  1KFM A;  1N7L A;  4ZKU A;  1FAV A;  2IX7 C;  1IFN A;  3RL0 B;  1YTZ T;  2HPC A;  1N2D C;  2P67 A;  3H6P A;  3EFG A;  3L37 A;  3OAK A;  1ZR2 A;  1A02 F;  2XU6 A;  2FFD B;  1N7S A;  1FZA A;  3OJA B;  1QL1 A;  3VN0 A;  2WSE H;  1LTA C;  2Z5I A;  2WSC H;  1FOS E;  2MJZ A;  2YKP A;  2WTY A;  2KP8 A;  5AVU B;  1GL2 D;  1HTL C;  1IFD A;  1SP4 A;  2N1T B;  4KHX A;  4HH2 A;  1NTK K;  2WPQ A;  5AW5 B;  2XZR A;  1E5W A;  4WY4 B;  3V2R A;  3U1A A;  1L0L K;  2I1J A;  2OYH A;  1JTH B;  3RK2 B;  2Z4E A;  1JY2 P;  3P8M C;  3B5N C;  1J1E C;  5APT A;  1CZQ A;  3V2N A;  5KJ7 C;  1RE4 A;  1CI6 A;  3KPE A;  2A45 G;  5APU A;  3RL0 D;  4N6J A;  1GW3 A;  2O1K A;  1JUN A;  1DEB A;  4WY4 C;  1SQP K;  2C9L Y;  5CCH D;  4AUW A;  1LWU A;  1JCC A;  1MV8 A;  2XNX A;  5AW1 B;  3LID A;  1AQ5 A;  3CL3 D;  2IFM A;  4C7N B;  3A2A A;  1T3J A;  3P8C E;  4LLH A;  2O01 H;  3EQ2 A;  1A02 J;  1G2C A;  3BRV B;  3HUS A;  1N73 B;  5AVY B;  2KLV A;  3M0D C;  2W6A A;  3LIE A;  1NU1 K;  1HGZ A;  1L4A D;  1SQB K;  5BVZ A;  3VP9 A;  2M3B A;  4N78 D;  3NFQ A;  1RF1 B;  1H88 A;  2P2U A;  5CJ4 A;  3V4Q A;  1NKZ B;  4JYB A;  3MGN A;  2H8P D;  1LTJ C;  5CJ0 A;  5CCG C;  1RF0 A;  1GU4 A;  1LT9 A;  1VDF A;  3H32 B;  3P8C D;  1SFC C;  1NH4 A;  3HE4 A;  1DH3 A;  1QL2 A;  2HFE D;  3KDP B;  1G1J A;  4JF7 A;  5AW4 B;  1N73 A;  3HTK A;  3HUS C;  3CI9 A;  1SFC D;  5KJ7 D;  3G3Z A;  1LTJ B;  1URQ A;  1RE3 C;  4C7N A;  5KTB A;  3A7O A;  1J1D C;  1RF1 A;  2FKW B;  3B5N D;  2Q7C A;  4C7R A;  3P7K A;  3KYQ A;  1YYC A;  1ZN5 A;  1CSB A;  1SFC B;  1WT6 A;  2E42 A;  1URQ D;  2CPS A;  3MIW A;  3HUS B;  5AW9 B;  2Q3I A;  3HD7 A;  3M91 A;  4LGD E;  3HD7 B;  4Y99 C;  3VMZ A;  4W7Y A;  2WWW A;  2L5G B;  5AW2 B;  3VMX A;  1CW5 A;  3P32 A;  1KIL D;  2N9B A;  2WPS A;  4C46 A;  2R5B A;  3R2P A;  1IC2 A;  5BU5 A;  1HGV A;  1NO4 A;  2GM4 A;  1SQQ K;  1NWQ A;  1S9K E;  4WY4 A;  3MTU E;  3L35 A;  2A45 H;  2XV5 A;  5AW6 B;  3VYI A;  2A45 I;  1HVV A;  2O1J A;  3SWY A;  2P7J A;  4GKG A;  2CPB A;  4XE5 B;  1L0N K;  3C9I A;  1JMM A;  3SWF A;  3HE5 A;  5AVS B;  5AW3 B;  2HYN A;  2P1J A;  2POH A;  1IK9 A;  2WT7 B;  3E1I A;  3U59 A;  2QM8 A;  1GDT A;  2KSJ A;  4ZKP A;  1G1I A;  1GL2 C;  2FXM A;  3OA7 A;  2GUS A;  1LT9 B;  1RE3 A;  2N1T D;  3H32 A;  4EOT A;  1LTS C;  1LGH B;  1SVF A;  4AQR D;  2R5D A;  2R3C A;  1NHL A;  1GL2 B;  2NPS A;  3VP8 A;  1GL2 A;  2WPR A;  1RF0 C;  2HOD A;  3TNU B;  1S9K D;  2OAR A;  5KLV K;  4IFD K;  3HRN A;  5CMZ A;  4Y99 B;  1T2K C;  3GHG C;  3B5N B;  4DZO A;  4N3Y B;  5APY A;  5CCH C;  3IFM A;  2YKO A;  2C9N Y;  2BAS A;  1FZC C;  1FDM A;  3NXS A;  1FZF A;  1GD2 E;  3V4W A;  5AVW B;  2PP6 A;  4M3L A;  1FBM A;  3GHG B;  1URQ B;  3CLQ A;  4GT1 A;  1L4A A;  3M0D A;  2WIT A;  2W27 A;  4DOJ A;  1T2K D;  1SQX K;  1JY3 O;  3BAS A;  3VTP C;  2ZXE B;  1FZC B;  2NPS D;  1NKN A;  2YMY A;  1HUC A;  2Z5H A;  1H8A A;  2OYI C;  1T8Z A;  1JOC A;  3HD7 C;  2W6B A;  3II6 A;  1JY3 P;  3RK2 D;  3VMY A;  4WB4 A;  1L4A B;  2LKM A;  1URQ C;  2JJL A;  2NPS B;  4GIF A;  4W7Z A;  1FU1 A;  2FFD C;  1IFJ A;  1M7L A;  1NTM K;  4AYC A;  4IFF A;  5AW7 B;  1N73 C;  3V5B A;  2M8R A;  1RF1 C;  4B86 A;  1GK4 A;  1FOS F;  3L4F A;  1KIL B;  1LTI C;  2OYI B;  1RE4 C;  3HTK B;  4HYT B;  4O9B A;  5AVT B;  5AW0 B;  1GW4 A;  3M9Q A;  2FYZ A;  3B5N A;  3B8E B;  3HE4 B;  5APV A;  2YKQ A;  1M1J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...