2M3BA

Serine 16 phosphorylated phospholamban pentamer, hybrid solution and solid-state nmr structural ensemble
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
51
Chain Sequence
b'MEKVQYLTRSAIRRATIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cardiac phospholamban
publication title Structural Dynamics and Topology of Phosphorylated Phospholamban Homopentamer Reveal Its Role in the Regulation of Calcium Transport.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Membrane protein
total genus 18
structure length 51
sequence length 52
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2m3bA00
1ZLLA 1FJPA 2KYVA 1FJKA 2HYNA 2M3BA 2KB7P 1N7LA
chains in the Genus database with same CATH superfamily
2H88C 1CI6B 3CWBD 2C9LY 3H1HD 2QJYB 2QJKB 1GD2E 3L70E 3RK3D 2OTJP 3RL0B 5AVRB 1JY3N 1Q90D 2OYIB 4JBZA 1RHZB 3HD7C 3H1KE 1NTMK 1L4AA 5CCGC 1NTMG 3RK3B 3OW2O 5AW0B 1L4AC 1JM0A 4WY4A 1U7MA 3AECC 1X22A 3V2PA 1BE3J 2ZYAA 2R5BA 2HR3A 1NU1J 4Y28J 3M91A 4DJGA 1HGZA 1KQFB 5KJ7A 1OWAA 3L70D 2NPSB 3G3ZA 3MHVA 1SQVK 1IO4A 1SQVG 1FZEA 4H13D 1RF0A 3P8CE 3GF7A 3CCQP 3TNUA 2WMMA 3F89A 3CD6P 1IFMA 4QMAA 1CZQA 1IFPA 1SQVE 2HLOA 1HGVA 4C46A 4TLFA 4KT0J 3AE7C 3WU2E 2H8PD 2R32A 1EDJA 2M3BA 1NWQA 3FGAD 3GHGC 2YO2A 2N1TB 3E1IA 1NTMD 2XU6A 2ZYDA 3PRJA 2A45I 4N3YB 1N7SB 4R4LA 1FJPA 1LTJB 1LTGC 3M0DC 2IBZG 4EDFA 1FE6A 1S5LX 3P8CD 2L5GB 4HYTB 4H13C 3C9IA 3CPWO 4IL6X 3PH0A 5AVUB 1LWUA 3HUSC 1GK6A 4YPCA 1J1DC 1LWUC 3JSVC 1SQVD 2IBZE 4HH2A 1M8OB 3SWFA 1S1CX 2B88A 4RESB 3BRTB 3B5NB 2WT7B 1LTBC 1OVRA 2JDIH 1URQD 5APQA 2Q9IA 2W90A 2ZAEB 1SQXK 2AEFA 4HJGH 3W67A 3T97A 1WMKA 1L0NJ 2BEQD 3CMEP 3CLQA 3L73E 2QJPB 4LGDE 3VMZA 4IOIH 2IX7C 1DIPA 2SPZA 2IFNA 3L37A 1PPJG 4MN4C 3MZWB 5KLVE 1ZV8A 2OYOA 1PGJA 4O9BA 5B5EE 3C8VA 2W83C 4AYCA 4Y99C 2IBZD 2K9JB 3USSA 2WPQA 1PPJE 2J5UA 1KN7A 1MUUA 3S1KA 1A02J 1BSHA 1URQA 4EI2A 1URQC 1ZOYC 1LTTC 5AVYB 4GIFA 1N73B 1T6AA 1IFNA 4UB8H 3BCCG 1R5SA 2FYUJ 3A0BH 3L73J 1SQBJ 1XTGB 4NPFX 2QEXP 4C7NB 3TGUE 2YIUB 1EQ7A 3BATA 1G1JA 1HJ0A 1H0TA 2R3SA 4TT3H 4RJTA 1PPJD 2PGDA 1TU3F 2WSEH 2FY8A 3CX5I 2Q3EA 3B8EB 1HBWA 2IZ1A 2QSIA 1VL2A 4XA4A 2K37A 2WSFH 5AW9B 4ZMDA 5APWA 3FWNA 5KLIC 1ZMEC 2E5YA 1VPCA 2P1JA 3RGUA 3L71J 5AVWB 1SQQJ 3I56P 5CBOA 1N2DC 3L74J 4BRYB 1NOHA 1LT9C 2FBWC 2IZ0A 1JMBA 1NTKK 1T3UA 3D70A 3AEAC 3KPEA 1QVFO 2M8RA 2A45H 5GTIE 1Q82Q 5BVZA 3PHLA 2WPVB 2QVAA 1SLQA 3G4SP 1DX7A 4BXLA 1G1IA 1IC2A 1P84E 1RE3A 4H0LB 3H1LE 4BWNA 5AW7B 2E76B 1JUNA 1RE3C 1PGOA 4DCKA 4W7YA 2ZT9B 2R3CA 4YXDC 3W68A 4JYBA 1OMIA 4ASVA 4GKGA 3JCUH 4U3FG 2DW3A 3CCEP 3ITKA 2E74D 5L8RJ 4PV1D 1Q81Q 2FXPA 2WSEJ 1OVVA 2P67A 1JMMA 1T2KD 3TSIA 2Y9YA 4AUWA 3C1LA 3GW6A 3AE3C 1LGHB 1FOSF 3L35A 2LR2A 1T3JA 1P84D 2FFDC 2IYPA 3IN6A 2MKVA 2I1KA 1FU1A 1RE4A 2AEMA 3H32A 1RF1B 2RN0A 3AE4C 1AA0A 1UIIA 2B87A 5CCHD 3TK1A 1QL2A 1OZHA 3CC4P 1X8YA 2HPCA 1VF5B 1FZBA 1PGQA 1HTLC 5CHXA 3L75G 5GTHE 4WVZA 2Z4EA 3CC7P 2E74C 1ZLLA 4PV1C 2JP3A 5M1BA 3H6PA 4B86A 5AW8B 3VYIA 3HE5A 1PZQA 1J2JB 4U3FD 2E75B 1VQ7P 2KIKA 5CJ4A 4H44D 4L75A 3KDPB 1BE3G 1W2BO 1NAFA 5H2FH 2BCCE 5AW4B 5CCHC 1GL2D 2P58A 3IAOA 1KILA 1KYOE 2QM7A 1MZ9A 1IJDB 3H25A 3CXHI 3CX5H 4I2LC 2V7QH 1BE3E 1LTAC 1NU1E 1S5LH 1RY3A 1JO5A 5B66H 3KZIE 3MIWA 1E79H 3AEFC 4IL6H 1GL2B 3CCUP 1NKZB 3L75D 5DJTB 3H1KG 1OW6A 3HTKA 4L76A 1PV3A 2I8DA 1M1JA 1PP9J 3RBXA 2W6BA 2Z5IA 1KQGB 1LTIC 4PD4E 1M1JC 4H44C 3HD7A 1Q86Q 1CI6A 1OXZA 4K35A 5CCGA 2FXOA 5APVA 3CCJP 3JC22 3M9BA 2BCCJ 4WY4B 2WTYA 1KYOD 1R5LA 2NPSD 2QJYC 2QJKC 3S9OA 1FJKA 1AFOA 1BE3D 3CL3D 3K5BA 2GUSA 3RL0C 5TISH 2OGUA 3AEBC 1KQSO 3IFMA 3QWOC 2OTLP 2OYIA 2H7HA 5AVSB 3WUUA 2KUBA 1GZLA 1KQLA 5APYA 3D6YA 1FC2C 2OYIC 1RH5B 1S4XA 1K9MQ 3WU2H 3RK3C 2AXTH 4Z1MH 2YXRB 1HF9A 3U1CA 1EDIA 2Q3IA 2ZJSE 2Z5HA 4ASWA 4LC1A 2K1AA 2HFED 4OVNF 1M56D 2N1TD 2K9YA 2P10A 3H1KD 1IZNB 1L0LJ 1AV1A 1N7SD 1U57A 2WZ7A 1AQTA 1L0NG 1NO4A 5AW1B 2J59M 1SFCD 1ZP0C 3A0HH 3L36A 2WITA 2NPSC 4M3LA 4HB1A 3GHGA 2JEEA 2FYNB 2QIWA 1VQPP 2KOGA 3N4XA 1IK9A 4DT0A 1L0NE 2PFXA 3M0DA 2KSEA 1SFCB 4R4MA 2W27A 2IDBA 1DEBA 3HUSA 2L91A 1VQ9P 3B5ND 3EFGA 5AW2B 5AW6B 2R5DA 3SWYA 1M57D 2WSCH 2N1TC 1YITP 1YJ9P 4IFDK 1VQ6P 5APSA 1AQ5A 3NXSA 1LTJA 1N7SC 1YYCA 3MD0A 1GU5A 4UB6H 5AVZB 4A7PA 1JY2P 4LLHA 1LTJC 3P7KA 3L73G 1SFCC 2AXCA 3OA7A 1FZCB 1ZXGA 1FAVA 3T97B 1ZR4A 2WQYC 1BGYJ 2IFMA 3IF4A 1L0ND 5KLVK 2YMYA 4L73A 2P2UA 5KLVG 5AVTB 2M5AB 2FYUE 1SQBE 3PTZA 1FS0E 2ZFCA 2KNCB 1USDA 2CK3H 4I1LA 4IFFA 3PP5A 2VRSA 1OW7A 2WWWA 1NYHA 3B5NC 2HG5D 3E1RA 3CXHH 2JJLA 2QJPC 3L71G 2H43A 2YKQA 3MGNA 1SQQG 2XDJA 3V2QA 3PLNA 3TGUG 3KHUA 1EXJA 2Q5UA 3SFDC 3L74G 3HRNA 3AEGC 1K05A 3L73D 5CMZA 1AJYA 4N6JA 3L71E 1SVFA 1J1EB 1LP1B 1SQQE 2M0BA 1M90Q 1X79B 3L74E 2D2CB 5KLVD 1H0TB 2E43A 1EZVE 1MFTA 2B89A 1N73A 1BCCE 4NPDA 1VQ5P 3EQ2A 1N73C 1E5WA 2Y9ZA 4I7ZB 1SQPJ 1NTZJ 5APUA 3TYYA 1SQXJ 4OGQB 3TDKA 4PJ0H 1HVVA 1KC8Q 4GDOA 2YIUC 2OYHB 1JB0J 1FDMA 1Y8AA 1KD1Q 2ZVNB 4UB8E 3L71D 1OIPA 4OH8B 3R2PA 1MFZA 1AVOA 1DD4A 4ZKPA 1HH0A 2W8ZA 2K88A 5GTIH 1RQVA 3Q2YA 1SQQD 1QEXA 3H1IJ 3P32A 3TGUD 3IR9A 3L74D 1KV4A 1OVUA 1G2CB 2KS1A 1LT9A 3VOPA 1W5CE 5BU8B 1A02F 4C7RA 4JYCA 2QE7H 3VMXA 1BCCJ 5KTBA 3HE4B 4H0LD 3ABVC 2E76D 3H1LG 3Q1MA 4ZKUA 5KAIH 2ZT9D 3BCCJ 4BRYA 3AE5C 1S9KE 5AVVB 3V2RA 5KAFH 3I5CA 2C9NY 1KB9E 3Q5RA 3V6IA 2HODB 1GW4A 1NVOA 4N78E 1GMJA 3RK2B 2Q1KA 3G9RA 1NH4A 1SP4A 3FXDA 3L4FA 3EFFK 4ZNCA 2KI7B 2FXMA 1R8EA 2MJZA 1RQUA 4H0LC 3OAKA 2E76C 4XFJA 3TF5A 2H89C 3O6QB 2XKMA 1M7LA 1YI2P 4HKZH 2ZT9C 2Y0EA 1S9KD 2FFDA 2POHA 2B9BA 2IBZI 2QRXA 2WSFJ 1VF5D 2OQQA 3H32B 1K8AQ 3AE9C 1KB9D 3AE6C 3M9QA 3H1LD 2IPPA 2JR8A 3M9HA 3I55P 1JTHA 1DD3A 5KKZB 4N78D 3CCMP 1KTMA 2GM4A 3L72J 1QX8A 1MKMA 4L74A 2XNXA 2QG4A 1NTKJ 3O8ZA 2E75D 1PP9G 3JCUE 2E42A 1PGPA 3GF3A 1L2PA 1RF1C 2R44A 1T2KC 2KZJA 2LXBA 2BCCG 1JY2O 1PP9E 4D6TJ 3VP9A 1FZAA 5AW5B 5C39A 3AE2C 2KZIA 1VF5C 3U1AA 3H1HE 1QL1A 1NU1K 3AEDC 5CCHA 1KILB 3SFEC 1NU1G 4JF7A 3MTUE 3MUDA 1JCDA 2FKWB 4WB4A 1H8AA 3MUDC 4XE5B 5CBNA 4WWIA 1K73Q 2OTKE 2XNDH 2E75C 5E79E 2ZYGA 2O1KA 2QA4P 4CPGA 3A7OA 1L4AD 3H1JJ 4KHXA 1H88A 3B4SA 1L0LK 3HTKB 2IYOA 1L0LG 3KQGA 1PP9D 2RH0A 4WY4D 4EIJA 1JY2N 2C0XA 1JEKA 3HD7B 3NTNA 1EC5A 1VDFA 3SSUA 4DOJA 1L4AB 3CWBJ 1L0LE 1VQMP 1XTCC 3KXDA 5KJ7D 3H1HJ 5H2FE 2BCCD 1VQ4P 3FXEA 1N8RQ 3GMAA 1GL2A 2YKOA 3L75J 1YHQP 5BU5A 1GL2C 1GDTA 2KK7A 2I1JA 1VQOP 3CX5E 1EXIA 2KLUA 1NU1D 1S5LE 5B66E 4AQRD 2RMZA 3A3YB 4IL6E 1HUCA 2BASA 2NZ2A 3TNUB 1PFIA 4WY4C 2LKMA 4PD4D 1NTME 2A06G 1L0LD 5CJ0A 3CCRP 2G8YA 5K5GB 1BGYG 1K04A 2YXQB 5KJ7C 1L0NK 3L70J 3UIAA 2XV5A 1YTZT 2NPSA 3GHGB 2O01H 1P84I 3CX5D 1KB9I 1RF0C 2QM8A 2A06E 3P8MC 3AEEC 4GOFA 3VMYA 2V7QJ 5TISE 1BGYE 3LIDA 3H1KJ 5APTA 3WUTA 2ITAA 4H13B 3LIEA 1WRGA 1YQ3C 3E7KA 3HUSB 1BDDA 1CSBA 3CCLP 2AXTE 3OJAB 1J1DB 1LWUB 1JCCA 2V4HA 3AE1C 1NTMJ 2N1TA 3GG2A 2FYNC 4JQ0D 2GUVA 1IK7A 1N7SA 2W6JH 1LNQA 2FYUK 1SFCA 3A0HE 3QH9A 2FYUG 1WT6A 1SQBK 1SS1A 1ZW0A 3F5HA 2A06D 1SQBG 1FDOA 1NKNA 1BGYD 5EFWB 1AVYA 5B5EH 3CMAP 1SQVJ 4W7ZA 1QVGO 1UIXA 1NHLA 2N9BA 4DZOA 1JY3P 3M0AA 2YO3A 3N7NA 1KZUB 1SQPK 2JWAA 2HYNA 1FZCA 1N86A 1YJNP 1SQPG 1QLED 3B5NA 2N9YB 4Y99B 1NTZK 2WT7A 3WMM0 3A2AA 1FZCC 1NTZG 3BVHA 1SQXG 2K3RA 2LXCB 2OARA 2WPRA 1PIXA 3V4WA 1Y9BA 1Y47A 1Z56A 2GA1A 2J58A 2M5AA 2P7JA 1NJIQ 3G71P 4I6MC 4UB6E 1YBKA 1U7JA 1SQPE 1URQB 2KNCA 1ZN5A 2O01J 1S2EA 1NTZE 2JKVA 3H1IG 1SQXE 3R4YA 2O01N 1SQQK 1EDLA 3RL0g 3BASA 1FZGA 1LTSC 1X9VA 1VQKP 1IFDA 2D2CD 3SWKA 4NPEA 1JOCA 2CPSA 1EZVG 2FYUD 1KYOI 3NFQA 1JNMA 1EDKA 2K9JA 1SQBD 3ZDMA 3II6A 2G3AA 3AE8C 3H1IE 1BCCG 3VP8A 3LW5H 1IFJA 3V4QA 4OGQD 1FOSE 3U59A 4RKUJ 1ZR2A 3CXHE 1CW5A 2WSCJ 3VMAA 1FBMA 1KORA 1GK4A 3B71A 1SQPD 4PD4I 1NTZD 4YXWH 4GODA 1SQXD 1LP1A 5TJHA 1VQNP 5KLIB 4C7NA 1J1EC 5KLVJ 3BCCE 4EYYQ 2AEJA 1S3JA 3KYQA 2KXPB 1FZFA 2D2CC 3VN0A 2WPSA 1USEA 2O1JA 2W6AA 1YJWP 3D71A 2YNYA 5AVXB 2YMKA 3H1ID 3A0BE 1N7LA 4RO0A 4WBAA 3CCVP 3CC2P 1YTZI 2KS1B 1LT9B 4I7ZC 3Q5SA 1EZVD 1H89A 4OGQC 2OYHA 3CXHD 1P84H 4KJMA 1KB9H 1KFNA 1GW3A 2JWDA 1BCCD 3V2NA 2OYHC 1GU4A 3WUVA 1OW8A 2UWJE 3GLMA 3TGUJ 3CCSP 2FYZA 1OFCX 3BCCD 1GTWA 4PJ0E 1G2CA 2WVRA 2PP6A 3L72G 3RK2D 1BDCA 1NTKG 2ZVOB 2KSJA 2BEZF 4GOEA 3HE4A 3D6ZA 3BRVB 3PJSK 1PL5A 4EOTA 3LW5J 3L72E 2XZRA 2A45G 1NTKE 1YQ4C 1OX3A 4GT1A 1ZRTE 3M06A 1Q7YQ 4D6TG 1M1KQ 1FDIA 1W2EA 3G6EP 4JPZB 1KFMA 1DEEG 2Y0CA 3RBZA 2Q7CA 2KYVA 2O3JA 5KAIE 3S4RA 2FFDB 2HODA 5DJUB 4IFMA 1KILE 4D6TE 5GTHH 2YKPA 3RK2C 4OWFA 5KAFE 1JTHB 2Y0DA 2B87B 3VTPC 1T8ZA 1D7MA 2KB7P 3FWLA 1YIJP 3H1JG 2HPCB 3L72D 1KMIZ 3O6QA 1LJ2A 1NGMB 1NTKD 4U3FE 1IFIA 1ZRTD 1X0TA 4U7JA 5APXA 2E74B 3Q3DA 4PV1B 2M3EA 1S72P 2NRGA 3H1LJ 2WSSH 1RE4C 1VQLP 3CI9A 3H1JE 1RF1A 3CWBG 3HE5B 1NAYA 1KILD 2PRRA 3H1HG 3A5TA 1KYOH 3FX0A 1HJBA 1DH3A 4YTPC 2Q6QA 4D6TD 5KKZC 2JO1A 2ZXEB 5E79H 1LT1A 4W80A 2PAJA 1QGKB 3CWBE 3KZIH 1Q2NA 3L75E 2C0WA 3RK3E 3NMDA 1JY3O 1HWTC 4U3FJ 2ZXXA 5AVQB 5AW3B 4PD4H 3Q5PA 1MV8A 2CPBA 2RKLA 3HD7D 3MP7B 4K3AA 3H1JD 5CCGD 1EZVI 3EWKA 2KLVA 3V5BA 1KILC 1M1JB 3L70G 3RL0D 4H44B 1BSNA 2KP8A 1VQ8P 2E5TA
chains in the Genus database with same CATH topology
4GKGA 1CI6B 2N1TA 1N73A 2GUVA 2C9LY 1N7SA 3EQ2A 1N73C 1E5WA 2P67A 1GD2E 1JMMA 1T2KD 3TSIA 3RK3D 2FYUK 1SFCA 4AUWA 1LGHB 3RL0B 1WT6A 1FOSF 1SQBK 5AVRB 1JY3N 5APUA 3TYYA 3L35A 1HVVA 1T3JA 1NKNA 2FFDC 2OYHB 1FDMA 2I1KA 1FU1A 1RE4A 2OYIB 3H32A 3HD7C 4W7ZA 4OH8B 1NTMK 3R2PA 2N9BA 1NHLA 1L4AA 1RF1B 4DZOA 5CCGC 1MFZA 4ZKPA 3RK3B 1HH0A 1JY3P 5AW0B 5CCHD 3TK1A 1L4AC 3M0AA 3P32A 1QL2A 2YO3A 3N7NA 1X8YA 1KZUB 1SQPK 3IR9A 2HPCA 2HYNA 4WY4A 1FZCA 1N86A 1FZBA 1G2CB 3B5NA 4Y99B 2WT7A 1NTZK 1HTLC 3V2PA 5CHXA 3WMM0 3A2AA 1LT9A 2R5BA 1FZCC 3BVHA 3VOPA 5BU8B 1A02F 4C7RA 2OARA 4JYCA 3M91A 2WPRA 3VMXA 2Z4EA 1HGZA 1ZLLA 3V4WA 2J58A 1Z56A 5KTBA 5KJ7A 1OWAA 2NPSB 3G3ZA 1SQVK 2P7JA 3HE4B 3H6PA 4B86A 1IO4A 5AW8B 4I6MC 3VYIA 1FZEA 1URQB 4ZKUA 3HE5A 1ZN5A 1J2JB 1RF0A 3P8CE 3TNUA 1SQQK 5CJ4A 3BASA 1FZGA 1S9KE 1LTSC 5AVVB 1X9VA 1IFMA 1IFDA 1CZQA 3V2RA 3KDPB 3I5CA 2C9NY 1JOCA 2CPSA 1NAFA 2HLOA 3NFQA 1JNMA 1HGVA 4C46A 3II6A 5AW4B 5CCHC 1GL2D 1KILA 2HODB 2H8PD 1GW4A 2R32A 3VP8A 4N78E 3LW5H 2M3BA 2QM7A 1MZ9A 1IJDB 3RK2B 1IFJA 3V4QA 1NWQA 1NH4A 4I2LC 1SP4A 2YO2A 3GHGC 3L4FA 2N1TB 1LTAC 3E1IA 2XU6A 1FOSE 3U59A 1ZR2A 2A45I 4N3YB 1N7SB 1RY3A 1JO5A 1CW5A 2FXMA 1FJPA 1LTJB 3MIWA 1FBMA 2MJZA 1LTGC 3M0DC 1GK4A 1GL2B 3OAKA 1NKZB 3P8CD 3HTKA 2L5GB 2XKMA 1M7LA 4HYTB 3C9IA 4C7NA 1M1JA 5AVUB 1J1EC 1S9KD 2W6BA 2FFDA 1LWUA 2POHA 3HUSC 1GK6A 2Z5IA 1LTIC 3KYQA 1M1JC 3H32B 1J1DC 1LWUC 1FZFA 3HD7A 3M9QA 3VN0A 2WPSA 1CI6A 2O1JA 2IPPA 2W6AA 1OXZA 3M9HA 5CCGA 2YNYA 4HH2A 5APVA 5AVXB 1JTHA 3SWFA 1N7LA 4RESB 3M9BA 4WBAA 4WY4B 2WTYA 4N78D 3BRTB 2NPSD 3B5NB 2WT7B 2GM4A 1LTBC 1YTZI 1LT9B 1FJKA 1AFOA 1URQD 2XNXA 5APQA 3CL3D 2GUSA 3O8ZA 2Q9IA 3RL0C 1H89A 1SQXK 2OYHA 3T97A 3IFMA 1KFNA 1GW3A 3V2NA 2OYHC 1GU4A 3CLQA 2OYIA 2E42A 2H7HA 4LGDE 5AVSB 3VMZA 2IX7C 1KQLA 1GZLA 5APYA 2OYIC 2IFNA 3L37A 1RF1C 1T2KC 3RK3C 2FYZA 3U1CA 1JY2O 1GTWA 1G2CA 2Q3IA 2PP6A 3VP9A 1FZAA 5AW5B 1ZV8A 2Z5HA 4LC1A 3RK2D 2HFED 4O9BA 4AYCA 4Y99C 2N1TD 2KSJA 2WPQA 3U1AA 1QL1A 1NU1K 1N7SD 5CCHA 1KILB 2WZ7A 1MUUA 3HE4A 1NO4A 4JF7A 1A02J 3BRVB 5AW1B 3MTUE 3MUDA 2J59M 1SFCD 3L36A 1URQA 2WITA 2NPSC 1JCDA 4EOTA 2FKWB 4M3LA 4WB4A 1H8AA 4XE5B 3GHGA 1URQC 2XZRA 2A45G 2JEEA 1LTTC 4GT1A 5AVYB 3M06A 2KOGA 4GIFA 1N73B 3N4XA 2O1KA 1IK9A 1IFNA 1W2EA 1KFMA 3M0DA 3A7OA 1L4AD 4KHXA 1H88A 1L0LK 1XTGB 3HTKB 1SFCB 2W27A 2Q7CA 2KYVA 4C7NB 3KQGA 2FFDB 1EQ7A 2HODA 4WY4D 1DEBA 3BATA 4IFMA 3HUSA 4EIJA 1JY2N 2C0XA 3B5ND 1G1JA 3HD7B 3EFGA 5AW2B 5AW6B 2YKPA 2R5DA 3RK2C 3SWYA 3NTNA 1VDFA 2WSCH 1JTHB 4DOJA 2N1TC 1L4AB 4IFDK 1XTCC 5APSA 5KJ7D 1AQ5A 2WSEH 3NXSA 1LTJA 1T8ZA 3VTPC 2KB7P 1N7SC 1YYCA 3MD0A 1GU5A 1GL2A 5AVZB 2YKOA 1JY2P 4LLHA 1LTJC 3P7KA 2HPCB 3B8EB 1SFCC 3OA7A 1FZCB 1HBWA 5BU5A 1GL2C 1GDTA 1IFIA 1FAVA 4XA4A 2I1JA 2WSFH 5APXA 1ZR4A 5AW9B 5APWA 2IFMA 5KLVK 2YMYA 1RE4C 2P2UA 1VPCA 4AQRD 2P1JA 5AVTB 3CI9A 3A3YB 5AVWB 1RF1A 2ZFCA 1HUCA 3HE5B 2BASA 4I1LA 1KILD 3A5TA 4IFFA 3TNUB 1PFIA 1HJBA 1DH3A 1N2DC 2VRSA 3PP5A 4WY4C 2WWWA 2LKMA 1NOHA 2ZXEB 3B5NC 1LT9C 2HG5D 4W80A 1NTKK 1T3UA 2PAJA 5CJ0A 2JJLA 3KPEA 5KJ7C 1L0NK 3UIAA 2XV5A 2M8RA 1YTZT 2A45H 2NPSA 2C0WA 2H43A 3GHGB 2YKQA 3NMDA 1JY3O 2O01H 5BVZA 1HWTC 1RF0C 3MGNA 2XDJA 3V2QA 2QM8A 1SLQA 1DX7A 3P8MC 5AVQB 5AW3B 3VMYA 1G1IA 1MV8A 1IC2A 2CPBA 2Q5UA 1RE3A 3HRNA 3HD7D 3LIDA 5AW7B 5APTA 1JUNA 1RE3C 5CMZA 5CCGD 4N6JA 4W7YA 3LIEA 1SVFA 1WRGA 1J1EB 3HUSB 2R3CA 1CSBA 2KLVA 3V5BA 3OJAB 1KILC 1M1JB 3RL0D 1J1DB 1LWUB 1X79B 2KP8A 4JYBA 2E43A 1JCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLL A;  1FJP A;  2KYV A;  1FJK A;  2HYN A;  2M3B A;  2KB7 P;  1N7L A; 
#chains in the Genus database with same CATH topology
 2H88 C;  1CI6 B;  3CWB D;  2C9L Y;  3H1H D;  2QJY B;  2QJK B;  1GD2 E;  3L70 E;  3RK3 D;  2OTJ P;  3RL0 B;  5AVR B;  1JY3 N;  1Q90 D;  2OYI B;  4JBZ A;  1RHZ B;  3HD7 C;  3H1K E;  1NTM K;  1L4A A;  5CCG C;  1NTM G;  3RK3 B;  3OW2 O;  5AW0 B;  1L4A C;  1JM0 A;  4WY4 A;  1U7M A;  3AEC C;  1X22 A;  3V2P A;  1BE3 J;  2ZYA A;  2R5B A;  2HR3 A;  1NU1 J;  4Y28 J;  3M91 A;  4DJG A;  1HGZ A;  1KQF B;  5KJ7 A;  1OWA A;  3L70 D;  2NPS B;  3G3Z A;  3MHV A;  1SQV K;  1IO4 A;  1SQV G;  1FZE A;  4H13 D;  1RF0 A;  3P8C E;  3GF7 A;  3CCQ P;  3TNU A;  2WMM A;  3F89 A;  3CD6 P;  1IFM A;  4QMA A;  1CZQ A;  1IFP A;  1SQV E;  2HLO A;  1HGV A;  4C46 A;  4TLF A;  4KT0 J;  3AE7 C;  3WU2 E;  2H8P D;  2R32 A;  1EDJ A;  2M3B A;  1NWQ A;  3FGA D;  3GHG C;  2YO2 A;  2N1T B;  3E1I A;  1NTM D;  2XU6 A;  2ZYD A;  3PRJ A;  2A45 I;  4N3Y B;  1N7S B;  4R4L A;  1FJP A;  1LTJ B;  1LTG C;  3M0D C;  2IBZ G;  4EDF A;  1FE6 A;  1S5L X;  3P8C D;  2L5G B;  4HYT B;  4H13 C;  3C9I A;  3CPW O;  4IL6 X;  3PH0 A;  5AVU B;  1LWU A;  3HUS C;  1GK6 A;  4YPC A;  1J1D C;  1LWU C;  3JSV C;  1SQV D;  2IBZ E;  4HH2 A;  1M8O B;  3SWF A;  1S1C X;  2B88 A;  4RES B;  3BRT B;  3B5N B;  2WT7 B;  1LTB C;  1OVR A;  2JDI H;  1URQ D;  5APQ A;  2Q9I A;  2W90 A;  2ZAE B;  1SQX K;  2AEF A;  4HJG H;  3W67 A;  3T97 A;  1WMK A;  1L0N J;  2BEQ D;  3CME P;  3CLQ A;  3L73 E;  2QJP B;  4LGD E;  3VMZ A;  4IOI H;  2IX7 C;  1DIP A;  2SPZ A;  2IFN A;  3L37 A;  1PPJ G;  4MN4 C;  3MZW B;  5KLV E;  1ZV8 A;  2OYO A;  1PGJ A;  4O9B A;  5B5E E;  3C8V A;  2W83 C;  4AYC A;  4Y99 C;  2IBZ D;  2K9J B;  3USS A;  2WPQ A;  1PPJ E;  2J5U A;  1KN7 A;  1MUU A;  3S1K A;  1A02 J;  1BSH A;  1URQ A;  4EI2 A;  1URQ C;  1ZOY C;  1LTT C;  5AVY B;  4GIF A;  1N73 B;  1T6A A;  1IFN A;  4UB8 H;  3BCC G;  1R5S A;  2FYU J;  3A0B H;  3L73 J;  1SQB J;  1XTG B;  4NPF X;  2QEX P;  4C7N B;  3TGU E;  2YIU B;  1EQ7 A;  3BAT A;  1G1J A;  1HJ0 A;  1H0T A;  2R3S A;  4TT3 H;  4RJT A;  1PPJ D;  2PGD A;  1TU3 F;  2WSE H;  2FY8 A;  3CX5 I;  2Q3E A;  3B8E B;  1HBW A;  2IZ1 A;  2QSI A;  1VL2 A;  4XA4 A;  2K37 A;  2WSF H;  5AW9 B;  4ZMD A;  5APW A;  3FWN A;  5KLI C;  1ZME C;  2E5Y A;  1VPC A;  2P1J A;  3RGU A;  3L71 J;  5AVW B;  1SQQ J;  3I56 P;  5CBO A;  1N2D C;  3L74 J;  4BRY B;  1NOH A;  1LT9 C;  2FBW C;  2IZ0 A;  1JMB A;  1NTK K;  1T3U A;  3D70 A;  3AEA C;  3KPE A;  1QVF O;  2M8R A;  2A45 H;  5GTI E;  1Q82 Q;  5BVZ A;  3PHL A;  2WPV B;  2QVA A;  1SLQ A;  3G4S P;  1DX7 A;  4BXL A;  1G1I A;  1IC2 A;  1P84 E;  1RE3 A;  4H0L B;  3H1L E;  4BWN A;  5AW7 B;  2E76 B;  1JUN A;  1RE3 C;  1PGO A;  4DCK A;  4W7Y A;  2ZT9 B;  2R3C A;  4YXD C;  3W68 A;  4JYB A;  1OMI A;  4ASV A;  4GKG A;  3JCU H;  4U3F G;  2DW3 A;  3CCE P;  3ITK A;  2E74 D;  5L8R J;  4PV1 D;  1Q81 Q;  2FXP A;  2WSE J;  1OVV A;  2P67 A;  1JMM A;  1T2K D;  3TSI A;  2Y9Y A;  4AUW A;  3C1L A;  3GW6 A;  3AE3 C;  1LGH B;  1FOS F;  3L35 A;  2LR2 A;  1T3J A;  1P84 D;  2FFD C;  2IYP A;  3IN6 A;  2MKV A;  2I1K A;  1FU1 A;  1RE4 A;  2AEM A;  3H32 A;  1RF1 B;  2RN0 A;  3AE4 C;  1AA0 A;  1UII A;  2B87 A;  5CCH D;  3TK1 A;  1QL2 A;  1OZH A;  3CC4 P;  1X8Y A;  2HPC A;  1VF5 B;  1FZB A;  1PGQ A;  1HTL C;  5CHX A;  3L75 G;  5GTH E;  4WVZ A;  2Z4E A;  3CC7 P;  2E74 C;  1ZLL A;  4PV1 C;  2JP3 A;  5M1B A;  3H6P A;  4B86 A;  5AW8 B;  3VYI A;  3HE5 A;  1PZQ A;  1J2J B;  4U3F D;  2E75 B;  1VQ7 P;  2KIK A;  5CJ4 A;  4H44 D;  4L75 A;  3KDP B;  1BE3 G;  1W2B O;  1NAF A;  5H2F H;  2BCC E;  5AW4 B;  5CCH C;  1GL2 D;  2P58 A;  3IAO A;  1KIL A;  1KYO E;  2QM7 A;  1MZ9 A;  1IJD B;  3H25 A;  3CXH I;  3CX5 H;  4I2L C;  2V7Q H;  1BE3 E;  1LTA C;  1NU1 E;  1S5L H;  1RY3 A;  1JO5 A;  5B66 H;  3KZI E;  3MIW A;  1E79 H;  3AEF C;  4IL6 H;  1GL2 B;  3CCU P;  1NKZ B;  3L75 D;  5DJT B;  3H1K G;  1OW6 A;  3HTK A;  4L76 A;  1PV3 A;  2I8D A;  1M1J A;  1PP9 J;  3RBX A;  2W6B A;  2Z5I A;  1KQG B;  1LTI C;  4PD4 E;  1M1J C;  4H44 C;  3HD7 A;  1Q86 Q;  1CI6 A;  1OXZ A;  4K35 A;  5CCG A;  2FXO A;  5APV A;  3CCJ P;  3JC2 2;  3M9B A;  2BCC J;  4WY4 B;  2WTY A;  1KYO D;  1R5L A;  2NPS D;  2QJY C;  2QJK C;  3S9O A;  1FJK A;  1AFO A;  1BE3 D;  3CL3 D;  3K5B A;  2GUS A;  3RL0 C;  5TIS H;  2OGU A;  3AEB C;  1KQS O;  3IFM A;  3QWO C;  2OTL P;  2OYI A;  2H7H A;  5AVS B;  3WUU A;  2KUB A;  1GZL A;  1KQL A;  5APY A;  3D6Y A;  1FC2 C;  2OYI C;  1RH5 B;  1S4X A;  1K9M Q;  3WU2 H;  3RK3 C;  2AXT H;  4Z1M H;  2YXR B;  1HF9 A;  3U1C A;  1EDI A;  2Q3I A;  2ZJS E;  2Z5H A;  4ASW A;  4LC1 A;  2K1A A;  2HFE D;  4OVN F;  1M56 D;  2N1T D;  2K9Y A;  2P10 A;  3H1K D;  1IZN B;  1L0L J;  1AV1 A;  1N7S D;  1U57 A;  2WZ7 A;  1AQT A;  1L0N G;  1NO4 A;  5AW1 B;  2J59 M;  1SFC D;  1ZP0 C;  3A0H H;  3L36 A;  2WIT A;  2NPS C;  4M3L A;  4HB1 A;  3GHG A;  2JEE A;  2FYN B;  2QIW A;  1VQP P;  2KOG A;  3N4X A;  1IK9 A;  4DT0 A;  1L0N E;  2PFX A;  3M0D A;  2KSE A;  1SFC B;  4R4M A;  2W27 A;  2IDB A;  1DEB A;  3HUS A;  2L91 A;  1VQ9 P;  3B5N D;  3EFG A;  5AW2 B;  5AW6 B;  2R5D A;  3SWY A;  1M57 D;  2WSC H;  2N1T C;  1YIT P;  1YJ9 P;  4IFD K;  1VQ6 P;  5APS A;  1AQ5 A;  3NXS A;  1LTJ A;  1N7S C;  1YYC A;  3MD0 A;  1GU5 A;  4UB6 H;  5AVZ B;  4A7P A;  1JY2 P;  4LLH A;  1LTJ C;  3P7K A;  3L73 G;  1SFC C;  2AXC A;  3OA7 A;  1FZC B;  1ZXG A;  1FAV A;  3T97 B;  1ZR4 A;  2WQY C;  1BGY J;  2IFM A;  3IF4 A;  1L0N D;  5KLV K;  2YMY A;  4L73 A;  2P2U A;  5KLV G;  5AVT B;  2M5A B;  2FYU E;  1SQB E;  3PTZ A;  1FS0 E;  2ZFC A;  2KNC B;  1USD A;  2CK3 H;  4I1L A;  4IFF A;  3PP5 A;  2VRS A;  1OW7 A;  2WWW A;  1NYH A;  3B5N C;  2HG5 D;  3E1R A;  3CXH H;  2JJL A;  2QJP C;  3L71 G;  2H43 A;  2YKQ A;  3MGN A;  1SQQ G;  2XDJ A;  3V2Q A;  3PLN A;  3TGU G;  3KHU A;  1EXJ A;  2Q5U A;  3SFD C;  3L74 G;  3HRN A;  3AEG C;  1K05 A;  3L73 D;  5CMZ A;  1AJY A;  4N6J A;  3L71 E;  1SVF A;  1J1E B;  1LP1 B;  1SQQ E;  2M0B A;  1M90 Q;  1X79 B;  3L74 E;  2D2C B;  5KLV D;  1H0T B;  2E43 A;  1EZV E;  1MFT A;  2B89 A;  1N73 A;  1BCC E;  4NPD A;  1VQ5 P;  3EQ2 A;  1N73 C;  1E5W A;  2Y9Z A;  4I7Z B;  1SQP J;  1NTZ J;  5APU A;  3TYY A;  1SQX J;  4OGQ B;  3TDK A;  4PJ0 H;  1HVV A;  1KC8 Q;  4GDO A;  2YIU C;  2OYH B;  1JB0 J;  1FDM A;  1Y8A A;  1KD1 Q;  2ZVN B;  4UB8 E;  3L71 D;  1OIP A;  4OH8 B;  3R2P A;  1MFZ A;  1AVO A;  1DD4 A;  4ZKP A;  1HH0 A;  2W8Z A;  2K88 A;  5GTI H;  1RQV A;  3Q2Y A;  1SQQ D;  1QEX A;  3H1I J;  3P32 A;  3TGU D;  3IR9 A;  3L74 D;  1KV4 A;  1OVU A;  1G2C B;  2KS1 A;  1LT9 A;  3VOP A;  1W5C E;  5BU8 B;  1A02 F;  4C7R A;  4JYC A;  2QE7 H;  3VMX A;  1BCC J;  5KTB A;  3HE4 B;  4H0L D;  3ABV C;  2E76 D;  3H1L G;  3Q1M A;  4ZKU A;  5KAI H;  2ZT9 D;  3BCC J;  4BRY A;  3AE5 C;  1S9K E;  5AVV B;  3V2R A;  5KAF H;  3I5C A;  2C9N Y;  1KB9 E;  3Q5R A;  3V6I A;  2HOD B;  1GW4 A;  1NVO A;  4N78 E;  1GMJ A;  3RK2 B;  2Q1K A;  3G9R A;  1NH4 A;  1SP4 A;  3FXD A;  3L4F A;  3EFF K;  4ZNC A;  2KI7 B;  2FXM A;  1R8E A;  2MJZ A;  1RQU A;  4H0L C;  3OAK A;  2E76 C;  4XFJ A;  3TF5 A;  2H89 C;  3O6Q B;  2XKM A;  1M7L A;  1YI2 P;  4HKZ H;  2ZT9 C;  2Y0E A;  1S9K D;  2FFD A;  2POH A;  2B9B A;  2IBZ I;  2QRX A;  2WSF J;  1VF5 D;  2OQQ A;  3H32 B;  1K8A Q;  3AE9 C;  1KB9 D;  3AE6 C;  3M9Q A;  3H1L D;  2IPP A;  2JR8 A;  3M9H A;  3I55 P;  1JTH A;  1DD3 A;  5KKZ B;  4N78 D;  3CCM P;  1KTM A;  2GM4 A;  3L72 J;  1QX8 A;  1MKM A;  4L74 A;  2XNX A;  2QG4 A;  1NTK J;  3O8Z A;  2E75 D;  1PP9 G;  3JCU E;  2E42 A;  1PGP A;  3GF3 A;  1L2P A;  1RF1 C;  2R44 A;  1T2K C;  2KZJ A;  2LXB A;  2BCC G;  1JY2 O;  1PP9 E;  4D6T J;  3VP9 A;  1FZA A;  5AW5 B;  5C39 A;  3AE2 C;  2KZI A;  1VF5 C;  3U1A A;  3H1H E;  1QL1 A;  1NU1 K;  3AED C;  5CCH A;  1KIL B;  3SFE C;  1NU1 G;  4JF7 A;  3MTU E;  3MUD A;  1JCD A;  2FKW B;  4WB4 A;  1H8A A;  3MUD C;  4XE5 B;  5CBN A;  4WWI A;  1K73 Q;  2OTK E;  2XND H;  2E75 C;  5E79 E;  2ZYG A;  2O1K A;  2QA4 P;  4CPG A;  3A7O A;  1L4A D;  3H1J J;  4KHX A;  1H88 A;  3B4S A;  1L0L K;  3HTK B;  2IYO A;  1L0L G;  3KQG A;  1PP9 D;  2RH0 A;  4WY4 D;  4EIJ A;  1JY2 N;  2C0X A;  1JEK A;  3HD7 B;  3NTN A;  1EC5 A;  1VDF A;  3SSU A;  4DOJ A;  1L4A B;  3CWB J;  1L0L E;  1VQM P;  1XTC C;  3KXD A;  5KJ7 D;  3H1H J;  5H2F E;  2BCC D;  1VQ4 P;  3FXE A;  1N8R Q;  3GMA A;  1GL2 A;  2YKO A;  3L75 J;  1YHQ P;  5BU5 A;  1GL2 C;  1GDT A;  2KK7 A;  2I1J A;  1VQO P;  3CX5 E;  1EXI A;  2KLU A;  1NU1 D;  1S5L E;  5B66 E;  4AQR D;  2RMZ A;  3A3Y B;  4IL6 E;  1HUC A;  2BAS A;  2NZ2 A;  3TNU B;  1PFI A;  4WY4 C;  2LKM A;  4PD4 D;  1NTM E;  2A06 G;  1L0L D;  5CJ0 A;  3CCR P;  2G8Y A;  5K5G B;  1BGY G;  1K04 A;  2YXQ B;  5KJ7 C;  1L0N K;  3L70 J;  3UIA A;  2XV5 A;  1YTZ T;  2NPS A;  3GHG B;  2O01 H;  1P84 I;  3CX5 D;  1KB9 I;  1RF0 C;  2QM8 A;  2A06 E;  3P8M C;  3AEE C;  4GOF A;  3VMY A;  2V7Q J;  5TIS E;  1BGY E;  3LID A;  3H1K J;  5APT A;  3WUT A;  2ITA A;  4H13 B;  3LIE A;  1WRG A;  1YQ3 C;  3E7K A;  3HUS B;  1BDD A;  1CSB A;  3CCL P;  2AXT E;  3OJA B;  1J1D B;  1LWU B;  1JCC A;  2V4H A;  3AE1 C;  1NTM J;  2N1T A;  3GG2 A;  2FYN C;  4JQ0 D;  2GUV A;  1IK7 A;  1N7S A;  2W6J H;  1LNQ A;  2FYU K;  1SFC A;  3A0H E;  3QH9 A;  2FYU G;  1WT6 A;  1SQB K;  1SS1 A;  1ZW0 A;  3F5H A;  2A06 D;  1SQB G;  1FDO A;  1NKN A;  1BGY D;  5EFW B;  1AVY A;  5B5E H;  3CMA P;  1SQV J;  4W7Z A;  1QVG O;  1UIX A;  1NHL A;  2N9B A;  4DZO A;  1JY3 P;  3M0A A;  2YO3 A;  3N7N A;  1KZU B;  1SQP K;  2JWA A;  2HYN A;  1FZC A;  1N86 A;  1YJN P;  1SQP G;  1QLE D;  3B5N A;  2N9Y B;  4Y99 B;  1NTZ K;  2WT7 A;  3WMM 0;  3A2A A;  1FZC C;  1NTZ G;  3BVH A;  1SQX G;  2K3R A;  2LXC B;  2OAR A;  2WPR A;  1PIX A;  3V4W A;  1Y9B A;  1Y47 A;  1Z56 A;  2GA1 A;  2J58 A;  2M5A A;  2P7J A;  1NJI Q;  3G71 P;  4I6M C;  4UB6 E;  1YBK A;  1U7J A;  1SQP E;  1URQ B;  2KNC A;  1ZN5 A;  2O01 J;  1S2E A;  1NTZ E;  2JKV A;  3H1I G;  1SQX E;  3R4Y A;  2O01 N;  1SQQ K;  1EDL A;  3RL0 g;  3BAS A;  1FZG A;  1LTS C;  1X9V A;  1VQK P;  1IFD A;  2D2C D;  3SWK A;  4NPE A;  1JOC A;  2CPS A;  1EZV G;  2FYU D;  1KYO I;  3NFQ A;  1JNM A;  1EDK A;  2K9J A;  1SQB D;  3ZDM A;  3II6 A;  2G3A A;  3AE8 C;  3H1I E;  1BCC G;  3VP8 A;  3LW5 H;  1IFJ A;  3V4Q A;  4OGQ D;  1FOS E;  3U59 A;  4RKU J;  1ZR2 A;  3CXH E;  1CW5 A;  2WSC J;  3VMA A;  1FBM A;  1KOR A;  1GK4 A;  3B71 A;  1SQP D;  4PD4 I;  1NTZ D;  4YXW H;  4GOD A;  1SQX D;  1LP1 A;  5TJH A;  1VQN P;  5KLI B;  4C7N A;  1J1E C;  5KLV J;  3BCC E;  4EYY Q;  2AEJ A;  1S3J A;  3KYQ A;  2KXP B;  1FZF A;  2D2C C;  3VN0 A;  2WPS A;  1USE A;  2O1J A;  2W6A A;  1YJW P;  3D71 A;  2YNY A;  5AVX B;  2YMK A;  3H1I D;  3A0B E;  1N7L A;  4RO0 A;  4WBA A;  3CCV P;  3CC2 P;  1YTZ I;  2KS1 B;  1LT9 B;  4I7Z C;  3Q5S A;  1EZV D;  1H89 A;  4OGQ C;  2OYH A;  3CXH D;  1P84 H;  4KJM A;  1KB9 H;  1KFN A;  1GW3 A;  2JWD A;  1BCC D;  3V2N A;  2OYH C;  1GU4 A;  3WUV A;  1OW8 A;  2UWJ E;  3GLM A;  3TGU J;  3CCS P;  2FYZ A;  1OFC X;  3BCC D;  1GTW A;  4PJ0 E;  1G2C A;  2WVR A;  2PP6 A;  3L72 G;  3RK2 D;  1BDC A;  1NTK G;  2ZVO B;  2KSJ A;  2BEZ F;  4GOE A;  3HE4 A;  3D6Z A;  3BRV B;  3PJS K;  1PL5 A;  4EOT A;  3LW5 J;  3L72 E;  2XZR A;  2A45 G;  1NTK E;  1YQ4 C;  1OX3 A;  4GT1 A;  1ZRT E;  3M06 A;  1Q7Y Q;  4D6T G;  1M1K Q;  1FDI A;  1W2E A;  3G6E P;  4JPZ B;  1KFM A;  1DEE G;  2Y0C A;  3RBZ A;  2Q7C A;  2KYV A;  2O3J A;  5KAI E;  3S4R A;  2FFD B;  2HOD A;  5DJU B;  4IFM A;  1KIL E;  4D6T E;  5GTH H;  2YKP A;  3RK2 C;  4OWF A;  5KAF E;  1JTH B;  2Y0D A;  2B87 B;  3VTP C;  1T8Z A;  1D7M A;  2KB7 P;  3FWL A;  1YIJ P;  3H1J G;  2HPC B;  3L72 D;  1KMI Z;  3O6Q A;  1LJ2 A;  1NGM B;  1NTK D;  4U3F E;  1IFI A;  1ZRT D;  1X0T A;  4U7J A;  5APX A;  2E74 B;  3Q3D A;  4PV1 B;  2M3E A;  1S72 P;  2NRG A;  3H1L J;  2WSS H;  1RE4 C;  1VQL P;  3CI9 A;  3H1J E;  1RF1 A;  3CWB G;  3HE5 B;  1NAY A;  1KIL D;  2PRR A;  3H1H G;  3A5T A;  1KYO H;  3FX0 A;  1HJB A;  1DH3 A;  4YTP C;  2Q6Q A;  4D6T D;  5KKZ C;  2JO1 A;  2ZXE B;  5E79 H;  1LT1 A;  4W80 A;  2PAJ A;  1QGK B;  3CWB E;  3KZI H;  1Q2N A;  3L75 E;  2C0W A;  3RK3 E;  3NMD A;  1JY3 O;  1HWT C;  4U3F J;  2ZXX A;  5AVQ B;  5AW3 B;  4PD4 H;  3Q5P A;  1MV8 A;  2CPB A;  2RKL A;  3HD7 D;  3MP7 B;  4K3A A;  3H1J D;  5CCG D;  1EZV I;  3EWK A;  2KLV A;  3V5B A;  1KIL C;  1M1J B;  3L70 G;  3RL0 D;  4H44 B;  1BSN A;  2KP8 A;  1VQ8 P;  2E5T A; 
#chains in the Genus database with same CATH homology
 4GKG A;  1CI6 B;  2N1T A;  1N73 A;  2GUV A;  2C9L Y;  1N7S A;  3EQ2 A;  1N73 C;  1E5W A;  2P67 A;  1GD2 E;  1JMM A;  1T2K D;  3TSI A;  3RK3 D;  2FYU K;  1SFC A;  4AUW A;  1LGH B;  3RL0 B;  1WT6 A;  1FOS F;  1SQB K;  5AVR B;  1JY3 N;  5APU A;  3TYY A;  3L35 A;  1HVV A;  1T3J A;  1NKN A;  2FFD C;  2OYH B;  1FDM A;  2I1K A;  1FU1 A;  1RE4 A;  2OYI B;  3H32 A;  3HD7 C;  4W7Z A;  4OH8 B;  1NTM K;  3R2P A;  2N9B A;  1NHL A;  1L4A A;  1RF1 B;  4DZO A;  5CCG C;  1MFZ A;  4ZKP A;  3RK3 B;  1HH0 A;  1JY3 P;  5AW0 B;  5CCH D;  3TK1 A;  1L4A C;  3M0A A;  3P32 A;  1QL2 A;  2YO3 A;  3N7N A;  1X8Y A;  1KZU B;  1SQP K;  3IR9 A;  2HPC A;  2HYN A;  4WY4 A;  1FZC A;  1N86 A;  1FZB A;  1G2C B;  3B5N A;  4Y99 B;  2WT7 A;  1NTZ K;  1HTL C;  3V2P A;  5CHX A;  3WMM 0;  3A2A A;  1LT9 A;  2R5B A;  1FZC C;  3BVH A;  3VOP A;  5BU8 B;  1A02 F;  4C7R A;  2OAR A;  4JYC A;  3M91 A;  2WPR A;  3VMX A;  2Z4E A;  1HGZ A;  1ZLL A;  3V4W A;  2J58 A;  1Z56 A;  5KTB A;  5KJ7 A;  1OWA A;  2NPS B;  3G3Z A;  1SQV K;  2P7J A;  3HE4 B;  3H6P A;  4B86 A;  1IO4 A;  5AW8 B;  4I6M C;  3VYI A;  1FZE A;  1URQ B;  4ZKU A;  3HE5 A;  1ZN5 A;  1J2J B;  1RF0 A;  3P8C E;  3TNU A;  1SQQ K;  5CJ4 A;  3BAS A;  1FZG A;  1S9K E;  1LTS C;  5AVV B;  1X9V A;  1IFM A;  1IFD A;  1CZQ A;  3V2R A;  3KDP B;  3I5C A;  2C9N Y;  1JOC A;  2CPS A;  1NAF A;  2HLO A;  3NFQ A;  1JNM A;  1HGV A;  4C46 A;  3II6 A;  5AW4 B;  5CCH C;  1GL2 D;  1KIL A;  2HOD B;  2H8P D;  1GW4 A;  2R32 A;  3VP8 A;  4N78 E;  3LW5 H;  2M3B A;  2QM7 A;  1MZ9 A;  1IJD B;  3RK2 B;  1IFJ A;  3V4Q A;  1NWQ A;  1NH4 A;  4I2L C;  1SP4 A;  2YO2 A;  3GHG C;  3L4F A;  2N1T B;  1LTA C;  3E1I A;  2XU6 A;  1FOS E;  3U59 A;  1ZR2 A;  2A45 I;  4N3Y B;  1N7S B;  1RY3 A;  1JO5 A;  1CW5 A;  2FXM A;  1FJP A;  1LTJ B;  3MIW A;  1FBM A;  2MJZ A;  1LTG C;  3M0D C;  1GK4 A;  1GL2 B;  3OAK A;  1NKZ B;  3P8C D;  3HTK A;  2L5G B;  2XKM A;  1M7L A;  4HYT B;  3C9I A;  4C7N A;  1M1J A;  5AVU B;  1J1E C;  1S9K D;  2W6B A;  2FFD A;  1LWU A;  2POH A;  3HUS C;  1GK6 A;  2Z5I A;  1LTI C;  3KYQ A;  1M1J C;  3H32 B;  1J1D C;  1LWU C;  1FZF A;  3HD7 A;  3M9Q A;  3VN0 A;  2WPS A;  1CI6 A;  2O1J A;  2IPP A;  2W6A A;  1OXZ A;  3M9H A;  5CCG A;  2YNY A;  4HH2 A;  5APV A;  5AVX B;  1JTH A;  3SWF A;  1N7L A;  4RES B;  3M9B A;  4WBA A;  4WY4 B;  2WTY A;  4N78 D;  3BRT B;  2NPS D;  3B5N B;  2WT7 B;  2GM4 A;  1LTB C;  1YTZ I;  1LT9 B;  1FJK A;  1AFO A;  1URQ D;  2XNX A;  5APQ A;  3CL3 D;  2GUS A;  3O8Z A;  2Q9I A;  3RL0 C;  1H89 A;  1SQX K;  2OYH A;  3T97 A;  3IFM A;  1KFN A;  1GW3 A;  3V2N A;  2OYH C;  1GU4 A;  3CLQ A;  2OYI A;  2E42 A;  2H7H A;  4LGD E;  5AVS B;  3VMZ A;  2IX7 C;  1KQL A;  1GZL A;  5APY A;  2OYI C;  2IFN A;  3L37 A;  1RF1 C;  1T2K C;  3RK3 C;  2FYZ A;  3U1C A;  1JY2 O;  1GTW A;  1G2C A;  2Q3I A;  2PP6 A;  3VP9 A;  1FZA A;  5AW5 B;  1ZV8 A;  2Z5H A;  4LC1 A;  3RK2 D;  2HFE D;  4O9B A;  4AYC A;  4Y99 C;  2N1T D;  2KSJ A;  2WPQ A;  3U1A A;  1QL1 A;  1NU1 K;  1N7S D;  5CCH A;  1KIL B;  2WZ7 A;  1MUU A;  3HE4 A;  1NO4 A;  4JF7 A;  1A02 J;  3BRV B;  5AW1 B;  3MTU E;  3MUD A;  2J59 M;  1SFC D;  3L36 A;  1URQ A;  2WIT A;  2NPS C;  1JCD A;  4EOT A;  2FKW B;  4M3L A;  4WB4 A;  1H8A A;  4XE5 B;  3GHG A;  1URQ C;  2XZR A;  2A45 G;  2JEE A;  1LTT C;  4GT1 A;  5AVY B;  3M06 A;  2KOG A;  4GIF A;  1N73 B;  3N4X A;  2O1K A;  1IK9 A;  1IFN A;  1W2E A;  1KFM A;  3M0D A;  3A7O A;  1L4A D;  4KHX A;  1H88 A;  1L0L K;  1XTG B;  3HTK B;  1SFC B;  2W27 A;  2Q7C A;  2KYV A;  4C7N B;  3KQG A;  2FFD B;  1EQ7 A;  2HOD A;  4WY4 D;  1DEB A;  3BAT A;  4IFM A;  3HUS A;  4EIJ A;  1JY2 N;  2C0X A;  3B5N D;  1G1J A;  3HD7 B;  3EFG A;  5AW2 B;  5AW6 B;  2YKP A;  2R5D A;  3RK2 C;  3SWY A;  3NTN A;  1VDF A;  2WSC H;  1JTH B;  4DOJ A;  2N1T C;  1L4A B;  4IFD K;  1XTC C;  5APS A;  5KJ7 D;  1AQ5 A;  2WSE H;  3NXS A;  1LTJ A;  1T8Z A;  3VTP C;  2KB7 P;  1N7S C;  1YYC A;  3MD0 A;  1GU5 A;  1GL2 A;  5AVZ B;  2YKO A;  1JY2 P;  4LLH A;  1LTJ C;  3P7K A;  2HPC B;  3B8E B;  1SFC C;  3OA7 A;  1FZC B;  1HBW A;  5BU5 A;  1GL2 C;  1GDT A;  1IFI A;  1FAV A;  4XA4 A;  2I1J A;  2WSF H;  5APX A;  1ZR4 A;  5AW9 B;  5APW A;  2IFM A;  5KLV K;  2YMY A;  1RE4 C;  2P2U A;  1VPC A;  4AQR D;  2P1J A;  5AVT B;  3CI9 A;  3A3Y B;  5AVW B;  1RF1 A;  2ZFC A;  1HUC A;  3HE5 B;  2BAS A;  4I1L A;  1KIL D;  3A5T A;  4IFF A;  3TNU B;  1PFI A;  1HJB A;  1DH3 A;  1N2D C;  2VRS A;  3PP5 A;  4WY4 C;  2WWW A;  2LKM A;  1NOH A;  2ZXE B;  3B5N C;  1LT9 C;  2HG5 D;  4W80 A;  1NTK K;  1T3U A;  2PAJ A;  5CJ0 A;  2JJL A;  3KPE A;  5KJ7 C;  1L0N K;  3UIA A;  2XV5 A;  2M8R A;  1YTZ T;  2A45 H;  2NPS A;  2C0W A;  2H43 A;  3GHG B;  2YKQ A;  3NMD A;  1JY3 O;  2O01 H;  5BVZ A;  1HWT C;  1RF0 C;  3MGN A;  2XDJ A;  3V2Q A;  2QM8 A;  1SLQ A;  1DX7 A;  3P8M C;  5AVQ B;  5AW3 B;  3VMY A;  1G1I A;  1MV8 A;  1IC2 A;  2CPB A;  2Q5U A;  1RE3 A;  3HRN A;  3HD7 D;  3LID A;  5AW7 B;  5APT A;  1JUN A;  1RE3 C;  5CMZ A;  5CCG D;  4N6J A;  4W7Y A;  3LIE A;  1SVF A;  1WRG A;  1J1E B;  3HUS B;  2R3C A;  1CSB A;  2KLV A;  3V5B A;  3OJA B;  1KIL C;  1M1J B;  3RL0 D;  1J1D B;  1LWU B;  1X79 B;  2KP8 A;  4JYB A;  2E43 A;  1JCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...