2M3EA

The integrin alpha l transmembrane domain in bicelles: structure and interaction with integrin beta 2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
50
structure length
50
Chain Sequence
SNADVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-L
publication title The Integrin Alpha L Transmembrane Domain in Bicelles: Structure and Interaction with Integrin Beta 2
rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 12
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00357 Integrin_alpha Integrin alpha cytoplasmic region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.930 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Bicelle-embedded integrin alpha(iib) transmembrane segment 2m3eA00
2K1AA 2M3EA 2KNCA 2K9JA
chains in the Genus database with same CATH superfamily
2WTYA 4WY4B 1HJBA 1L4AB 2YIUC 3IF4A 1SQPJ 1FZCC 1VF5D 4LLHA 5DJUB 2FYUE 2GA1A 1SLQA 1S2EA 3L73E 2RN0A 1FOSF 1KFMA 5CBOA 1OIPA 2IBZD 1M1JC 1S72P 1KYOE 4NPEA 4ASWA 2IBZG 1FZBA 1H88A 4AQRD 1KILB 3B5NC 2YO2A 1OWAA 1VQMP 1JY3O 3RGUA 3M0AA 1GTWA 4GODA 3W67A 1NWQA 4IOIH 4UB8E 1OW6A 3CD6P 4PJ0E 4XE5B 4HKZH 2OYHC 1J1EB 1UIXA 3A0HH 1CW5A 4C7RA 1NGMB 2ZYDA 4PD4D 4ZNCA 1NTMK 2QSIA 1QVFO 2V7QJ 1KILE 4JQ0D 2W6BA 2FFDA 2QJPC 3TF5A 2M5AA 2Z5IA 1VQ7P 2A06D 3KPEA 3CMAP 1K8AQ 2JO1A 3EFFK 3MGNA 2KNCB 1IFJA 2A06G 1T2KC 3PJSK 5CCHD 3D71A 1SQQK 2A45G 2BCCE 2K3RA 2FFDB 2P7JA 3PP5A 4OVNF 2E42A 1OMIA 3RK2D 5APTA 2W6AA 1L0NJ 3B5NA 2Y0DA 3OA7A 1MFZA 3CX5E 1KN7A 3V4QA 1NTZK 4BRYA 1L0ND 1LGHB 4O9BA 4HB1A 1L0NG 1BCCJ 5AVXB 3PRJA 1SQXJ 1X22A 2Q3EA 3CCRP 3B5NB 3NTNA 1WT6A 3P7KA 2KIKA 1PV3A 3S1KA 4BRYB 2ZYAA 4HJGH 1SQXD 3AE5C 3HD7C 1NU1D 5KAIE 3OJAB 4OGQB 1SQXG 3H1KD 1HJ0A 1P84H 1GDTA 1NU1G 1GW4A 3AEFC 1W5CE 3H1KG 4C7NA 1NKNA 2E75C 1M90Q 2OYHA 3L74E 2QVAA 1SQVK 1SVFA 3MHVA 1VQPP 3GHGC 2N1TC 3H1LE 4XA4A 4C7NB 3MP7B 2FYUJ 3RL0B 3L73J 1JEKA 1JMMA 3L70E 1T8ZA 2B88A 5AW2B 2WVRA 2XDJA 3L72E 1FJPA 4JYBA 3L73D 2E74B 5GTHH 3L73G 2Z4EA 3CCJP 5APSA 1LT9A 1ZR2A 1AVOA 4LGDE 3PHLA 1J2JB 2I1KA 2YKQA 2Q7CA 3TNUA 3R2PA 3CMEP 4L73A 5TISE 3WMM0 1URQC 2L5GB 1KD1Q 1KZUB 2WITA 1LT9B 5APYA 2KXPB 1NAFA 3LIDA 3AE4C 1FU1A 1LTJC 3I56P 3HE5A 2R32A 1M8OB 2Q3IA 1HGVA 3AE7C 1PL5A 4WY4D 4AYCA 3N7NA 1N73A 4N6JA 1R5SA 1MUUA 4XFJA 3KDPB 3HE5B 3GMAA 2Q5UA 4N78E 2YO3A 1JUNA 1Q82Q 1N73B 5B5EE 1S5LX 3GHGA 2HPCA 4MN4C 3WUUA 2XKMA 2E75B 1RF1C 3FGAD 2BCCJ 3WU2E 3AE8C 3NXSA 1PGPA 1T6AA 1ZP0C 1DD4A 1CSBA 1X0TA 4IL6X 1N7SC 4H44C 5AVVB 2WPRA 4PV1C 2HODA 5KLVE 1QGKB 2ZYGA 3H1JJ 1KQSO 4LC1A 3AEEC 1JCCA 3VMYA 2N9BA 3GF7A 1URQA 1GL2A 5AW3B 5AVTB 3H1JD 1FAVA 2HODB 2KUBA 2QA4P 1RY3A 1HBWA 3H1JG 3NMDA 3SWYA 3C8VA 4H13D 4N3YB 2BASA 3MZWB 1JY3N 1GL2B 2OYIC 2FXOA 2H88C 1ZV8A 2V4HA 3L74J 3CI9A 2IFNA 3CC7P 1OW7A 2P58A 2FYNC 3H1IE 4U3FE 2AXTE 2NPSB 1KV4A 3JSVC 1LT1A 3H1LJ 1R5LA 3L74D 3A5TA 1LTIC 1SFCD 3L70J 3L74G 3CXHE 1L4AC 3L72J 4D6TD 4U7JA 1Y9BA 3IR9A 1QL1A 3H1HE 3L70D 4D6TG 3G6EP 1ZXGA 3K5BA 1Z56A 3L72D 2WQYC 1JB0J 1YQ3C 2WSFJ 3L72G 2XNDH 4Y99B 4GOEA 4UB6E 5GTIE 3B5ND 2W27A 3M9HA 1E79H 3G9RA 1KILC 3SFDC 2RKLA 1N7SA 1KYOI 1HGZA 2K37A 1KORA 2PAJA 4PD4H 4ZKUA 3CCQP 1HWTC 1MKMA 1NH4A 3PLNA 1L0NK 1FDOA 3HTKB 1VQ8P 3RK3C 1N7LA 3D70A 1K04A 3EQ2A 3CWBE 3IAOA 1GZLA 2V7QH 1L0LJ 5AVUB 3M91A 3OAKA 2HFED 4RKUJ 5AW7B 5CBNA 1SQXK 1FOSE 1NU1K 1S9KE 1NTKE 1XTCC 1L0LD 1J1EC 1Q81Q 1L0LG 1HUCA 1A02J 4W7YA 2ITAA 1SQBE 2JR8A 2HYNA 2E5TA 1YBKA 4N78D 1JY2P 2WPVB 1DH3A 5EFWB 1PFIA 1NKZB 4DOJA 1JTHB 4ZMDA 2D2CB 1L4AA 2O1JA 3MD0A 2YMYA 4H0LB 1FS0E 1N2DC 2RH0A 4I7ZC 2B89A 1T2KD 1LTGC 2H8PD 1G1JA 3GG2A 1VQ5P 4NPFX 1JOCA 5AW4B 4CPGA 2FFDC 2J59M 4B86A 5BVZA 2AXCA 5KLVJ 1K9MQ 2MJZA 3USSA 3FXDA 4GIFA 1KILA 2K88A 2WWWA 2W90A 3FXEA 2C0WA 1IZNB 1SQPD 1EDLA 3U59A 3AE9C 5B66H 3CX5I 1SQPG 4JF7A 4R4LA 1K05A 2ZVOB 1OVUA 4RJTA 5APQA 4EDFA 3NFQA 2QM8A 1VPCA 4W80A 4K35A 5CJ0A 1BDDA 3HD7D 4IFDK 2E43A 1YTZT 1FE6A 3CPWO 3M0DC 3H1IJ 1JMBA 4U3FJ 4OGQC 1ZOYC 1KQLA 3RK3B 3HRNA 1KYOH 1LWUA 1L2PA 2O01N 3H1ID 5AW9B 1ZRTE 4U3FD 1OXZA 3H32B 1VQ9P 5APUA 3H1IG 4Z1MH 4U3FG 5BU5A 2N1TD 3L4FA 3Q5PA 1PP9E 3H1HJ 4JPZB 1LWUB 3RL0C 2K9YA 2IYPA 2DW3A 2E5YA 3VN0A 3AE3C 2QIWA 2E74C 4UB8H 1DEEG 2KNCA 1EDJA 2VRSA 4HYTB 5BU8B 3KZIH 1NO4A 3BRTB 3TGUE 4I7ZB 2UWJE 3L71J 1YJWP 3AECC 1URQD 5KTBA 2IZ0A 1K73Q 5H2FE 4DZOA 3RK3E 1LT9C 2Y0EA 3CWBJ 2AEMA 2YKPA 4DJGA 1WMKA 3L71D 1H0TA 1GU5A 3BCCE 2KI7B 3V2RA 3L71G 2O01J 2ZAEB 2JKVA 1NTKJ 3L36A 1H0TB 1USEA 2CK3H 3M0DA 3E7KA 3F89A 2ZJSE 3KYQA 1DIPA 3B8EB 1SQBJ 1SQQE 1W2EA 2OQQA 1BCCD 4AUWA 4EYYQ 3CX5H 2KLUA 1BCCG 1N73C 3M06A 3A2AA 5AW8B 1VDFA 2P10A 1NTZE 4YXWH 1JO5A 3L37A 1RQUA 3AEBC 1ZLLA 4RO0A 1RHZB 3MUDC 3EFGA 2I1JA 1RH5B 2B87A 1N7SD 5KAIH 4EOTA 4H44D 1DX7A 3CCUP 4PV1D 2AEJA 2P1JA 3L75E 2FYUD 1Q2NA 3G71P 2WSCJ 3S4RA 1HTLC 3A0BE 2B87B 2FYUG 1IFDA 1GMJA 1AQ5A 2B9BA 2FKWB 1T3JA 2KLVA 2ZT9B 3AE2C 1SQVE 5C39A 1KYOD 3V5BA 3E1RA 2AEFA 1BDCA 5CCGA 2YKOA 2E76B 2KK7A 1D7MA 4I2LC 3CCMP 1GL2C 3RBZA 1VQ6P 4L75A 2RMZA 1L0LK 4IFMA 1QLED 2NPSC 1IC2A 2WSFH 1PP9J 2KZJA 3H6PA 1LJ2A 2PP6A 1KC8Q 4I1LA 3SSUA 4C46A 1KB9I 5TISH 5K5GB 3P8CE 4JBZA 1L4AD 2WPSA 3HE4B 4WVZA 1QX8A 1IFMA 3HUSB 1VF5B 3CXHI 4KJMA 3Q1MA 3WUTA 4GDOA 3VP8A 1KQFB 4GKGA 2HR3A 1LTTC 1BGYE 2Y0CA 1AFOA 1AQTA 3KHUA 4Y99C 3MUDA 3UIAA 1KILD 5TJHA 1FZAA 2JWDA 3ABVC 4HH2A 3C9IA 1EXIA 3BCCJ 1YHQP 1SQPK 3KXDA 4EIJA 1S4XA 2BCCD 3RK3D 5B5EH 5KLIB 1AA0A 2Q9IA 2BCCG 3SFEC 1Y8AA 3GW6A 2MKVA 2A45I 1T3UA 3ITKA 3CX5D 2H7HA 1SQQJ 1QEXA 5KAFE 4Y28J 1IFPA 1W2BO 1RQVA 3VTPC 2NPSA 1OVRA 2QEXP 3V2QA 5CCHA 1NTZJ 1EQ7A 3IN6A 1YTZI 2JEEA 1A02F 3AEDC 3LW5J 3M9QA 2D2CC 4H0LC 3T97A 4TLFA 1KB9E 2HLOA 2WZ7A 2J58A 1M7LA 2JP3A 5AW0B 5KKZC 3G3ZA 5KJ7C 3RK2B 3H1LD 1U7JA 1GU4A 2FYZA 3L75J 1YYCA 3T97B 1KQGB 3H1LG 2YXRB 2AXTH 3L70G 1J1DB 1SQVJ 1YJNP 1SP4A 2R5BA 1UIIA 3CLQA 2ZXXA 1M56D 5E79E 3CXHH 3HTKA 1M57D 1S5LE 1LP1A 3JCUE 1TU3F 3R4YA 2R3SA 1EZVI 2Y9ZA 1HVVA 1LTBC 1HF9A 1DEBA 1NYHA 4OGQD 3V2NA 3V2PA 2A06E 2KP8A 1LP1B 2IX7C 2SPZA 4UB6H 1BE3E 4IL6E 1RE3C 4QMAA 3W68A 2IFMA 1G2CB 3O6QA 1CZQA 3RL0D 1WRGA 3GF3A 1LWUC 2LXBA 3AEGC 1MFTA 1EDKA 4L76A 2C9NY 5CMZA 1BGYJ 1NOHA 1JTHA 2KZIA 2M0BA 5CHXA 3L35A 1L0NE 2IDBA 3O6QB 1AV1A 2E74D 2W8ZA 3CCLP 1JY3P 2O01H 4YPCA 4ASVA 5KJ7A 2FBWC 1NU1E 1X8YA 1AJYA 1Q90D 3H1KE 2FYUK 5KKZB 4L74A 2POHA 3TSIA 2QG4A 2C9LY 4RESB 1Q7YQ 3C1LA 2QM7A 2K1AA 1H8AA 2ZFCA 2KOGA 5KLVD 2QRXA 1SFCC 1MZ9A 2KB7P 3U1AA 5KLVG 2FXMA 2YNYA 2ZXEB 1EZVE 2OGUA 1ZMEC 3RBXA 1IFNA 2R44A 3MTUE 1RE3A 2OTKE 4R4MA 3H32A 3H25A 3FWLA 1FZGA 2PGDA 1P84I 1MV8A 2XV5A 2E75D 2JWAA 2WSCH 2XU6A 1GD2E 2IPPA 2FY8A 3AE6C 3Q3DA 4BXLA 1KB9D 1PZQA 1IK7A 1JY2O 3O8ZA 3A0HE 2CPSA 1H89A 4A7PA 4OWFA 3TDKA 3CXHD 2K9JA 2WSEJ 3H1HD 3F5HA 3RL0g 2LKMA 3B71A 5M1BA 3H1HG 3KZIE 1JCDA 1RF0C 1AVYA 3PH0A 4PJ0H 2ZT9C 2K9JB 4H13B 3WUVA 3I55P 2QJKB 2WMMA 2E76C 3G4SP 1IO4A 1GL2D 1SFCA 4YTPC 2J5UA 1VQLP 2IYOA 1BE3J 3QWOC 5CCGC 1NTME 1FZCA 2NPSD 1SFCB 3CWBD 1OZHA 1BE3D 1N86A 2JJLA 3CWBG 1BE3G 1M1JA 2M5AB 2YIUB 2NZ2A 4DT0A 1FZCB 5H2FH 4IFFA 1S9KD 1NTKD 3HUSC 1VF5C 3CCEP 1NTKG 3VP9A 1QVGO 1P84E 1M1JB 4BWNA 2PRRA 3TK1A 1SQBD 2QJYC 3H1JE 3I5CA 3U1CA 3BATA 2CPBA 5APXA 1SQBG 3AEAC 1NU1J 1FJKA 1ZN5A 2IZ1A 2QE7H 2YMKA 4OH8B 3H1KJ 1FBMA 2W83C 1PGJA 1GW3A 1ZW0A 1U57A 4GT1A 3FX0A 4GOFA 2BEQD 1XTGB 2JDIH 4KHXA 3FWNA 1RF0A 2KS1A 5KLIC 5GTHE 5L8RJ 3AE1C 1BSNA 3CC4P 4ZKPA 5AVYB 3VMZA 2FXPA 5AW6B 4D6TE 4KT0J 5CJ4A 3LW5H 3S9OA 2OYHB 2KS1B 2N9YB 4K3AA 1QL2A 5AVWB 2XZRA 1KFNA 1EZVD 4WBAA 2OTLP 2LR2A 1EZVG 2HG5D 4JYCA 2IBZI 1LTAC 2Q6QA 3MIWA 3A0BH 3ZDMA 2QJPB 3OW2O 2O1KA 3GLMA 5AW5B 2KSJA 2D2CD 3HE4A 3Q5RA 4H0LD 2ZVNB 3HUSA 2XNXA 3D6ZA 5APWA 3QH9A 1ZRTD 4WWIA 3V6IA 2WT7A 5CCHC 5KJ7D 1EC5A 1PIXA 3RK2C 3TNUB 5DJTB 1IFIA 1PP9D 1EXJA 2BEZF 1JM0A 1IJDB 1PP9G 1PPJE 2WT7B 3EWKA 4DCKA 2I8DA 1YJ9P 2WPQA 2QJYB 1J1DC 1S3JA 3HD7A 1L0LE 1PGOA 3TGUJ 5AVRB 1Y47A 1G1IA 2O3JA 1VQNP 2NRGA 3HD7B 3JC22 2OTJP 3TGUD 5KLVK 1LNQA 4PD4I 3KQGA 2N1TA 3TGUG 1NTMJ 1X79B 2P67A 3VMXA 3SWKA 1LTSC 2OYOA 3CCVP 3BCCD 1FDIA 1OW8A 4TT3H 1NTMD 3GHGB 3VOPA 2N1TB 2HPCB 1JNMA 3BCCG 2OARA 1NTMG 3WU2H 1YI2P 1USDA 3Q2YA 2H89C 2P2UA 4EI2A 3P8MC 3PTZA 1VL2A 1FC2C 1HH0A 2Z5HA 1OFCX 2GM4A 1SQPE 2IBZE 1FDMA 3TYYA 1EDIA 1SQQD 2KYVA 1YQ4C 2H43A 3P32A 1SQQG 5AVSB 3BRVB 1KMIZ 1P84D 4M3LA 1VQKP 1CI6A 1NAYA 3BASA 1NVOA 1LTJA 5KAFH 2G3AA 1GK4A 2R3CA 1RE4C 2C0XA 1NTZD 1JY2N 1URQB 1NHLA 1NTZG 1CI6B 2GUVA 2PFXA 1VQ4P 1LTJB 3CCSP 4YXDC 2M3BA 4D6TJ 1Q86Q 3SWFA 1VQOP 2R5DA 1OVVA 5AW1B 1IK9A 1KB9H 3L75D 2W6JH 4WY4C 2Y9YA 3L75G 3CC2P 3CL3D 3D6YA 2M8RA 3II6A 1SQVD 4WB4A 1RF1A 4PD4E 1SQVG 3IFMA 1U7MA 1PGQA 2WSSH 3VYIA 1OX3A 3LIEA 2G8YA 3E1IA 1G2CA 2WSEH 1RF1B 2M3EA 4I6MC 3V4WA 1S1CX 1NTKK 5GTIH 5E79H 1DD3A 3M9BA 5AVQB 1S5LH 3JCUH 3L71E 2LXCB 1SQBK 2L91A 3B4SA 1N7SB 2Q1KA 2YXQB 4H44B 3P8CD 4PV1B 4NPDA 3A7OA 2A45H 1X9VA 1E5WA 2GUSA 1PPJD 1RE4A 1KTMA 3N4XA 4IL6H 5AVZB 1PPJG 2OYIA 1BGYD 1R8EA 2ZT9D 1SS1A 1BGYG 3BVHA 1BCCE 1SQXE 2KSEA 4H13C 2E76D 1BSHA 5APVA 2QJKC 3Q5SA 2OYIB 1YIJP 1FZFA 1GK6A 1N8RQ 3A3YB 1YITP 2FYNB 3VMAA 4W7ZA 4WY4A 1M1KQ 5CCGD 1ZR4A 1FZEA 1NJIQ 5B66E
chains in the Genus database with same CATH topology
2K1AA 2M3EA 2KNCA 2K9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1A A;  2M3E A;  2KNC A;  2K9J A; 
#chains in the Genus database with same CATH topology
 2WTY A;  4WY4 B;  1HJB A;  1L4A B;  2YIU C;  3IF4 A;  1SQP J;  1FZC C;  1VF5 D;  4LLH A;  5DJU B;  2FYU E;  2GA1 A;  1SLQ A;  1S2E A;  3L73 E;  2RN0 A;  1FOS F;  1KFM A;  5CBO A;  1OIP A;  2IBZ D;  1M1J C;  1S72 P;  1KYO E;  4NPE A;  4ASW A;  2IBZ G;  1FZB A;  1H88 A;  4AQR D;  1KIL B;  3B5N C;  2YO2 A;  1OWA A;  1VQM P;  1JY3 O;  3RGU A;  3M0A A;  1GTW A;  4GOD A;  3W67 A;  1NWQ A;  4IOI H;  4UB8 E;  1OW6 A;  3CD6 P;  4PJ0 E;  4XE5 B;  4HKZ H;  2OYH C;  1J1E B;  1UIX A;  3A0H H;  1CW5 A;  4C7R A;  1NGM B;  2ZYD A;  4PD4 D;  4ZNC A;  1NTM K;  2QSI A;  1QVF O;  2V7Q J;  1KIL E;  4JQ0 D;  2W6B A;  2FFD A;  2QJP C;  3TF5 A;  2M5A A;  2Z5I A;  1VQ7 P;  2A06 D;  3KPE A;  3CMA P;  1K8A Q;  2JO1 A;  3EFF K;  3MGN A;  2KNC B;  1IFJ A;  2A06 G;  1T2K C;  3PJS K;  5CCH D;  3D71 A;  1SQQ K;  2A45 G;  2BCC E;  2K3R A;  2FFD B;  2P7J A;  3PP5 A;  4OVN F;  2E42 A;  1OMI A;  3RK2 D;  5APT A;  2W6A A;  1L0N J;  3B5N A;  2Y0D A;  3OA7 A;  1MFZ A;  3CX5 E;  1KN7 A;  3V4Q A;  1NTZ K;  4BRY A;  1L0N D;  1LGH B;  4O9B A;  4HB1 A;  1L0N G;  1BCC J;  5AVX B;  3PRJ A;  1SQX J;  1X22 A;  2Q3E A;  3CCR P;  3B5N B;  3NTN A;  1WT6 A;  3P7K A;  2KIK A;  1PV3 A;  3S1K A;  4BRY B;  2ZYA A;  4HJG H;  1SQX D;  3AE5 C;  3HD7 C;  1NU1 D;  5KAI E;  3OJA B;  4OGQ B;  1SQX G;  3H1K D;  1HJ0 A;  1P84 H;  1GDT A;  1NU1 G;  1GW4 A;  3AEF C;  1W5C E;  3H1K G;  4C7N A;  1NKN A;  2E75 C;  1M90 Q;  2OYH A;  3L74 E;  2QVA A;  1SQV K;  1SVF A;  3MHV A;  1VQP P;  3GHG C;  2N1T C;  3H1L E;  4XA4 A;  4C7N B;  3MP7 B;  2FYU J;  3RL0 B;  3L73 J;  1JEK A;  1JMM A;  3L70 E;  1T8Z A;  2B88 A;  5AW2 B;  2WVR A;  2XDJ A;  3L72 E;  1FJP A;  4JYB A;  3L73 D;  2E74 B;  5GTH H;  3L73 G;  2Z4E A;  3CCJ P;  5APS A;  1LT9 A;  1ZR2 A;  1AVO A;  4LGD E;  3PHL A;  1J2J B;  2I1K A;  2YKQ A;  2Q7C A;  3TNU A;  3R2P A;  3CME P;  4L73 A;  5TIS E;  3WMM 0;  1URQ C;  2L5G B;  1KD1 Q;  1KZU B;  2WIT A;  1LT9 B;  5APY A;  2KXP B;  1NAF A;  3LID A;  3AE4 C;  1FU1 A;  1LTJ C;  3I56 P;  3HE5 A;  2R32 A;  1M8O B;  2Q3I A;  1HGV A;  3AE7 C;  1PL5 A;  4WY4 D;  4AYC A;  3N7N A;  1N73 A;  4N6J A;  1R5S A;  1MUU A;  4XFJ A;  3KDP B;  3HE5 B;  3GMA A;  2Q5U A;  4N78 E;  2YO3 A;  1JUN A;  1Q82 Q;  1N73 B;  5B5E E;  1S5L X;  3GHG A;  2HPC A;  4MN4 C;  3WUU A;  2XKM A;  2E75 B;  1RF1 C;  3FGA D;  2BCC J;  3WU2 E;  3AE8 C;  3NXS A;  1PGP A;  1T6A A;  1ZP0 C;  1DD4 A;  1CSB A;  1X0T A;  4IL6 X;  1N7S C;  4H44 C;  5AVV B;  2WPR A;  4PV1 C;  2HOD A;  5KLV E;  1QGK B;  2ZYG A;  3H1J J;  1KQS O;  4LC1 A;  3AEE C;  1JCC A;  3VMY A;  2N9B A;  3GF7 A;  1URQ A;  1GL2 A;  5AW3 B;  5AVT B;  3H1J D;  1FAV A;  2HOD B;  2KUB A;  2QA4 P;  1RY3 A;  1HBW A;  3H1J G;  3NMD A;  3SWY A;  3C8V A;  4H13 D;  4N3Y B;  2BAS A;  3MZW B;  1JY3 N;  1GL2 B;  2OYI C;  2FXO A;  2H88 C;  1ZV8 A;  2V4H A;  3L74 J;  3CI9 A;  2IFN A;  3CC7 P;  1OW7 A;  2P58 A;  2FYN C;  3H1I E;  4U3F E;  2AXT E;  2NPS B;  1KV4 A;  3JSV C;  1LT1 A;  3H1L J;  1R5L A;  3L74 D;  3A5T A;  1LTI C;  1SFC D;  3L70 J;  3L74 G;  3CXH E;  1L4A C;  3L72 J;  4D6T D;  4U7J A;  1Y9B A;  3IR9 A;  1QL1 A;  3H1H E;  3L70 D;  4D6T G;  3G6E P;  1ZXG A;  3K5B A;  1Z56 A;  3L72 D;  2WQY C;  1JB0 J;  1YQ3 C;  2WSF J;  3L72 G;  2XND H;  4Y99 B;  4GOE A;  4UB6 E;  5GTI E;  3B5N D;  2W27 A;  3M9H A;  1E79 H;  3G9R A;  1KIL C;  3SFD C;  2RKL A;  1N7S A;  1KYO I;  1HGZ A;  2K37 A;  1KOR A;  2PAJ A;  4PD4 H;  4ZKU A;  3CCQ P;  1HWT C;  1MKM A;  1NH4 A;  3PLN A;  1L0N K;  1FDO A;  3HTK B;  1VQ8 P;  3RK3 C;  1N7L A;  3D70 A;  1K04 A;  3EQ2 A;  3CWB E;  3IAO A;  1GZL A;  2V7Q H;  1L0L J;  5AVU B;  3M91 A;  3OAK A;  2HFE D;  4RKU J;  5AW7 B;  5CBN A;  1SQX K;  1FOS E;  1NU1 K;  1S9K E;  1NTK E;  1XTC C;  1L0L D;  1J1E C;  1Q81 Q;  1L0L G;  1HUC A;  1A02 J;  4W7Y A;  2ITA A;  1SQB E;  2JR8 A;  2HYN A;  2E5T A;  1YBK A;  4N78 D;  1JY2 P;  2WPV B;  1DH3 A;  5EFW B;  1PFI A;  1NKZ B;  4DOJ A;  1JTH B;  4ZMD A;  2D2C B;  1L4A A;  2O1J A;  3MD0 A;  2YMY A;  4H0L B;  1FS0 E;  1N2D C;  2RH0 A;  4I7Z C;  2B89 A;  1T2K D;  1LTG C;  2H8P D;  1G1J A;  3GG2 A;  1VQ5 P;  4NPF X;  1JOC A;  5AW4 B;  4CPG A;  2FFD C;  2J59 M;  4B86 A;  5BVZ A;  2AXC A;  5KLV J;  1K9M Q;  2MJZ A;  3USS A;  3FXD A;  4GIF A;  1KIL A;  2K88 A;  2WWW A;  2W90 A;  3FXE A;  2C0W A;  1IZN B;  1SQP D;  1EDL A;  3U59 A;  3AE9 C;  5B66 H;  3CX5 I;  1SQP G;  4JF7 A;  4R4L A;  1K05 A;  2ZVO B;  1OVU A;  4RJT A;  5APQ A;  4EDF A;  3NFQ A;  2QM8 A;  1VPC A;  4W80 A;  4K35 A;  5CJ0 A;  1BDD A;  3HD7 D;  4IFD K;  2E43 A;  1YTZ T;  1FE6 A;  3CPW O;  3M0D C;  3H1I J;  1JMB A;  4U3F J;  4OGQ C;  1ZOY C;  1KQL A;  3RK3 B;  3HRN A;  1KYO H;  1LWU A;  1L2P A;  2O01 N;  3H1I D;  5AW9 B;  1ZRT E;  4U3F D;  1OXZ A;  3H32 B;  1VQ9 P;  5APU A;  3H1I G;  4Z1M H;  4U3F G;  5BU5 A;  2N1T D;  3L4F A;  3Q5P A;  1PP9 E;  3H1H J;  4JPZ B;  1LWU B;  3RL0 C;  2K9Y A;  2IYP A;  2DW3 A;  2E5Y A;  3VN0 A;  3AE3 C;  2QIW A;  2E74 C;  4UB8 H;  1DEE G;  2KNC A;  1EDJ A;  2VRS A;  4HYT B;  5BU8 B;  3KZI H;  1NO4 A;  3BRT B;  3TGU E;  4I7Z B;  2UWJ E;  3L71 J;  1YJW P;  3AEC C;  1URQ D;  5KTB A;  2IZ0 A;  1K73 Q;  5H2F E;  4DZO A;  3RK3 E;  1LT9 C;  2Y0E A;  3CWB J;  2AEM A;  2YKP A;  4DJG A;  1WMK A;  3L71 D;  1H0T A;  1GU5 A;  3BCC E;  2KI7 B;  3V2R A;  3L71 G;  2O01 J;  2ZAE B;  2JKV A;  1NTK J;  3L36 A;  1H0T B;  1USE A;  2CK3 H;  3M0D A;  3E7K A;  3F89 A;  2ZJS E;  3KYQ A;  1DIP A;  3B8E B;  1SQB J;  1SQQ E;  1W2E A;  2OQQ A;  1BCC D;  4AUW A;  4EYY Q;  3CX5 H;  2KLU A;  1BCC G;  1N73 C;  3M06 A;  3A2A A;  5AW8 B;  1VDF A;  2P10 A;  1NTZ E;  4YXW H;  1JO5 A;  3L37 A;  1RQU A;  3AEB C;  1ZLL A;  4RO0 A;  1RHZ B;  3MUD C;  3EFG A;  2I1J A;  1RH5 B;  2B87 A;  1N7S D;  5KAI H;  4EOT A;  4H44 D;  1DX7 A;  3CCU P;  4PV1 D;  2AEJ A;  2P1J A;  3L75 E;  2FYU D;  1Q2N A;  3G71 P;  2WSC J;  3S4R A;  1HTL C;  3A0B E;  2B87 B;  2FYU G;  1IFD A;  1GMJ A;  1AQ5 A;  2B9B A;  2FKW B;  1T3J A;  2KLV A;  2ZT9 B;  3AE2 C;  1SQV E;  5C39 A;  1KYO D;  3V5B A;  3E1R A;  2AEF A;  1BDC A;  5CCG A;  2YKO A;  2E76 B;  2KK7 A;  1D7M A;  4I2L C;  3CCM P;  1GL2 C;  3RBZ A;  1VQ6 P;  4L75 A;  2RMZ A;  1L0L K;  4IFM A;  1QLE D;  2NPS C;  1IC2 A;  2WSF H;  1PP9 J;  2KZJ A;  3H6P A;  1LJ2 A;  2PP6 A;  1KC8 Q;  4I1L A;  3SSU A;  4C46 A;  1KB9 I;  5TIS H;  5K5G B;  3P8C E;  4JBZ A;  1L4A D;  2WPS A;  3HE4 B;  4WVZ A;  1QX8 A;  1IFM A;  3HUS B;  1VF5 B;  3CXH I;  4KJM A;  3Q1M A;  3WUT A;  4GDO A;  3VP8 A;  1KQF B;  4GKG A;  2HR3 A;  1LTT C;  1BGY E;  2Y0C A;  1AFO A;  1AQT A;  3KHU A;  4Y99 C;  3MUD A;  3UIA A;  1KIL D;  5TJH A;  1FZA A;  2JWD A;  3ABV C;  4HH2 A;  3C9I A;  1EXI A;  3BCC J;  1YHQ P;  1SQP K;  3KXD A;  4EIJ A;  1S4X A;  2BCC D;  3RK3 D;  5B5E H;  5KLI B;  1AA0 A;  2Q9I A;  2BCC G;  3SFE C;  1Y8A A;  3GW6 A;  2MKV A;  2A45 I;  1T3U A;  3ITK A;  3CX5 D;  2H7H A;  1SQQ J;  1QEX A;  5KAF E;  4Y28 J;  1IFP A;  1W2B O;  1RQV A;  3VTP C;  2NPS A;  1OVR A;  2QEX P;  3V2Q A;  5CCH A;  1NTZ J;  1EQ7 A;  3IN6 A;  1YTZ I;  2JEE A;  1A02 F;  3AED C;  3LW5 J;  3M9Q A;  2D2C C;  4H0L C;  3T97 A;  4TLF A;  1KB9 E;  2HLO A;  2WZ7 A;  2J58 A;  1M7L A;  2JP3 A;  5AW0 B;  5KKZ C;  3G3Z A;  5KJ7 C;  3RK2 B;  3H1L D;  1U7J A;  1GU4 A;  2FYZ A;  3L75 J;  1YYC A;  3T97 B;  1KQG B;  3H1L G;  2YXR B;  2AXT H;  3L70 G;  1J1D B;  1SQV J;  1YJN P;  1SP4 A;  2R5B A;  1UII A;  3CLQ A;  2ZXX A;  1M56 D;  5E79 E;  3CXH H;  3HTK A;  1M57 D;  1S5L E;  1LP1 A;  3JCU E;  1TU3 F;  3R4Y A;  2R3S A;  1EZV I;  2Y9Z A;  1HVV A;  1LTB C;  1HF9 A;  1DEB A;  1NYH A;  4OGQ D;  3V2N A;  3V2P A;  2A06 E;  2KP8 A;  1LP1 B;  2IX7 C;  2SPZ A;  4UB6 H;  1BE3 E;  4IL6 E;  1RE3 C;  4QMA A;  3W68 A;  2IFM A;  1G2C B;  3O6Q A;  1CZQ A;  3RL0 D;  1WRG A;  3GF3 A;  1LWU C;  2LXB A;  3AEG C;  1MFT A;  1EDK A;  4L76 A;  2C9N Y;  5CMZ A;  1BGY J;  1NOH A;  1JTH A;  2KZI A;  2M0B A;  5CHX A;  3L35 A;  1L0N E;  2IDB A;  3O6Q B;  1AV1 A;  2E74 D;  2W8Z A;  3CCL P;  1JY3 P;  2O01 H;  4YPC A;  4ASV A;  5KJ7 A;  2FBW C;  1NU1 E;  1X8Y A;  1AJY A;  1Q90 D;  3H1K E;  2FYU K;  5KKZ B;  4L74 A;  2POH A;  3TSI A;  2QG4 A;  2C9L Y;  4RES B;  1Q7Y Q;  3C1L A;  2QM7 A;  2K1A A;  1H8A A;  2ZFC A;  2KOG A;  5KLV D;  2QRX A;  1SFC C;  1MZ9 A;  2KB7 P;  3U1A A;  5KLV G;  2FXM A;  2YNY A;  2ZXE B;  1EZV E;  2OGU A;  1ZME C;  3RBX A;  1IFN A;  2R44 A;  3MTU E;  1RE3 A;  2OTK E;  4R4M A;  3H32 A;  3H25 A;  3FWL A;  1FZG A;  2PGD A;  1P84 I;  1MV8 A;  2XV5 A;  2E75 D;  2JWA A;  2WSC H;  2XU6 A;  1GD2 E;  2IPP A;  2FY8 A;  3AE6 C;  3Q3D A;  4BXL A;  1KB9 D;  1PZQ A;  1IK7 A;  1JY2 O;  3O8Z A;  3A0H E;  2CPS A;  1H89 A;  4A7P A;  4OWF A;  3TDK A;  3CXH D;  2K9J A;  2WSE J;  3H1H D;  3F5H A;  3RL0 g;  2LKM A;  3B71 A;  5M1B A;  3H1H G;  3KZI E;  1JCD A;  1RF0 C;  1AVY A;  3PH0 A;  4PJ0 H;  2ZT9 C;  2K9J B;  4H13 B;  3WUV A;  3I55 P;  2QJK B;  2WMM A;  2E76 C;  3G4S P;  1IO4 A;  1GL2 D;  1SFC A;  4YTP C;  2J5U A;  1VQL P;  2IYO A;  1BE3 J;  3QWO C;  5CCG C;  1NTM E;  1FZC A;  2NPS D;  1SFC B;  3CWB D;  1OZH A;  1BE3 D;  1N86 A;  2JJL A;  3CWB G;  1BE3 G;  1M1J A;  2M5A B;  2YIU B;  2NZ2 A;  4DT0 A;  1FZC B;  5H2F H;  4IFF A;  1S9K D;  1NTK D;  3HUS C;  1VF5 C;  3CCE P;  1NTK G;  3VP9 A;  1QVG O;  1P84 E;  1M1J B;  4BWN A;  2PRR A;  3TK1 A;  1SQB D;  2QJY C;  3H1J E;  3I5C A;  3U1C A;  3BAT A;  2CPB A;  5APX A;  1SQB G;  3AEA C;  1NU1 J;  1FJK A;  1ZN5 A;  2IZ1 A;  2QE7 H;  2YMK A;  4OH8 B;  3H1K J;  1FBM A;  2W83 C;  1PGJ A;  1GW3 A;  1ZW0 A;  1U57 A;  4GT1 A;  3FX0 A;  4GOF A;  2BEQ D;  1XTG B;  2JDI H;  4KHX A;  3FWN A;  1RF0 A;  2KS1 A;  5KLI C;  5GTH E;  5L8R J;  3AE1 C;  1BSN A;  3CC4 P;  4ZKP A;  5AVY B;  3VMZ A;  2FXP A;  5AW6 B;  4D6T E;  4KT0 J;  5CJ4 A;  3LW5 H;  3S9O A;  2OYH B;  2KS1 B;  2N9Y B;  4K3A A;  1QL2 A;  5AVW B;  2XZR A;  1KFN A;  1EZV D;  4WBA A;  2OTL P;  2LR2 A;  1EZV G;  2HG5 D;  4JYC A;  2IBZ I;  1LTA C;  2Q6Q A;  3MIW A;  3A0B H;  3ZDM A;  2QJP B;  3OW2 O;  2O1K A;  3GLM A;  5AW5 B;  2KSJ A;  2D2C D;  3HE4 A;  3Q5R A;  4H0L D;  2ZVN B;  3HUS A;  2XNX A;  3D6Z A;  5APW A;  3QH9 A;  1ZRT D;  4WWI A;  3V6I A;  2WT7 A;  5CCH C;  5KJ7 D;  1EC5 A;  1PIX A;  3RK2 C;  3TNU B;  5DJT B;  1IFI A;  1PP9 D;  1EXJ A;  2BEZ F;  1JM0 A;  1IJD B;  1PP9 G;  1PPJ E;  2WT7 B;  3EWK A;  4DCK A;  2I8D A;  1YJ9 P;  2WPQ A;  2QJY B;  1J1D C;  1S3J A;  3HD7 A;  1L0L E;  1PGO A;  3TGU J;  5AVR B;  1Y47 A;  1G1I A;  2O3J A;  1VQN P;  2NRG A;  3HD7 B;  3JC2 2;  2OTJ P;  3TGU D;  5KLV K;  1LNQ A;  4PD4 I;  3KQG A;  2N1T A;  3TGU G;  1NTM J;  1X79 B;  2P67 A;  3VMX A;  3SWK A;  1LTS C;  2OYO A;  3CCV P;  3BCC D;  1FDI A;  1OW8 A;  4TT3 H;  1NTM D;  3GHG B;  3VOP A;  2N1T B;  2HPC B;  1JNM A;  3BCC G;  2OAR A;  1NTM G;  3WU2 H;  1YI2 P;  1USD A;  3Q2Y A;  2H89 C;  2P2U A;  4EI2 A;  3P8M C;  3PTZ A;  1VL2 A;  1FC2 C;  1HH0 A;  2Z5H A;  1OFC X;  2GM4 A;  1SQP E;  2IBZ E;  1FDM A;  3TYY A;  1EDI A;  1SQQ D;  2KYV A;  1YQ4 C;  2H43 A;  3P32 A;  1SQQ G;  5AVS B;  3BRV B;  1KMI Z;  1P84 D;  4M3L A;  1VQK P;  1CI6 A;  1NAY A;  3BAS A;  1NVO A;  1LTJ A;  5KAF H;  2G3A A;  1GK4 A;  2R3C A;  1RE4 C;  2C0X A;  1NTZ D;  1JY2 N;  1URQ B;  1NHL A;  1NTZ G;  1CI6 B;  2GUV A;  2PFX A;  1VQ4 P;  1LTJ B;  3CCS P;  4YXD C;  2M3B A;  4D6T J;  1Q86 Q;  3SWF A;  1VQO P;  2R5D A;  1OVV A;  5AW1 B;  1IK9 A;  1KB9 H;  3L75 D;  2W6J H;  4WY4 C;  2Y9Y A;  3L75 G;  3CC2 P;  3CL3 D;  3D6Y A;  2M8R A;  3II6 A;  1SQV D;  4WB4 A;  1RF1 A;  4PD4 E;  1SQV G;  3IFM A;  1U7M A;  1PGQ A;  2WSS H;  3VYI A;  1OX3 A;  3LIE A;  2G8Y A;  3E1I A;  1G2C A;  2WSE H;  1RF1 B;  2M3E A;  4I6M C;  3V4W A;  1S1C X;  1NTK K;  5GTI H;  5E79 H;  1DD3 A;  3M9B A;  5AVQ B;  1S5L H;  3JCU H;  3L71 E;  2LXC B;  1SQB K;  2L91 A;  3B4S A;  1N7S B;  2Q1K A;  2YXQ B;  4H44 B;  3P8C D;  4PV1 B;  4NPD A;  3A7O A;  2A45 H;  1X9V A;  1E5W A;  2GUS A;  1PPJ D;  1RE4 A;  1KTM A;  3N4X A;  4IL6 H;  5AVZ B;  1PPJ G;  2OYI A;  1BGY D;  1R8E A;  2ZT9 D;  1SS1 A;  1BGY G;  3BVH A;  1BCC E;  1SQX E;  2KSE A;  4H13 C;  2E76 D;  1BSH A;  5APV A;  2QJK C;  3Q5S A;  2OYI B;  1YIJ P;  1FZF A;  1GK6 A;  1N8R Q;  3A3Y B;  1YIT P;  2FYN B;  3VMA A;  4W7Z A;  4WY4 A;  1M1K Q;  5CCG D;  1ZR4 A;  1FZE A;  1NJI Q;  5B66 E; 
#chains in the Genus database with same CATH homology
 2K1A A;  2M3E A;  2KNC A;  2K9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...