2M3EA

The integrin alpha l transmembrane domain in bicelles: structure and interaction with integrin beta 2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
50
structure length
50
Chain Sequence
b'SNADVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-L
publication title The Integrin Alpha L Transmembrane Domain in Bicelles: Structure and Interaction with Integrin Beta 2
rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 12
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00357 Integrin_alpha Integrin alpha cytoplasmic region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.930 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Bicelle-embedded integrin alpha(iib) transmembrane segment 2m3eA00
2M3EA 2KNCA 2K1AA 2K9JA
chains in the Genus database with same CATH superfamily
3HUSA 1KB9I 1MUUA 3P8CD 2R44A 1EXJA 3AEEC 3TGUG 3CI9A 5GTIH 2IX7C 3KZIH 2Q5UA 3WUUA 2NPSC 2Y0CA 1NKZB 2IBZG 3IAOA 1GL2B 3KDPB 2KIKA 3P8MC 3RK3D 4W7ZA 1XTGB 3BCCG 1HUCA 1L4AC 1VQ9P 1SQVD 5B5EH 1Q2NA 3CCUP 2HODB 3ITKA 1PP9E 1LT9B 3R4YA 1HJBA 2QJKC 3B8EB 5AW7B 5APUA 1AV1A 1N7SC 3TDKA 1SFCB 4OH8B 3AEAC 2AEJA 2MKVA 2WPQA 4H0LD 3CCEP 1L0LE 2A06D 5APQA 3L37A 4HH2A 3WMM0 4UB8E 2WTYA 2CPSA 2E42A 4DJGA 1FZEA 5AVUB 2K9JB 3FGAD 1L0LJ 1MFTA 1IC2A 4IOIH 3E1IA 1EDJA 1SQQK 2WPVB 1SP4A 4EI2A 1LTBC 3G4SP 3BCCE 1GD2E 3C1LA 3HUSB 4WBAA 3IF4A 1K73Q 1VQ4P 3AE8C 3BCCJ 5BU5A 1PIXA 5CBOA 1R5LA 1OW8A 1HWTC 2H7HA 2JP3A 3MTUE 3ABVC 3PHLA 3GHGC 5KLIB 1HTLC 4C7RA 1URQA 1GZLA 1ZRTD 3HD7A 1QLED 3MUDC 1LWUB 2N1TD 3T97B 3CWBE 2QG4A 4PD4E 3MGNA 3EQ2A 1GW3A 1BSNA 2JJLA 3OJAB 1KB9D 2YNYA 2V7QH 1S9KD 2HFED 3I56P 2A45I 3FWLA 2JR8A 1KYOI 3CWBJ 4R4LA 2P7JA 2QEXP 1BGYE 2QJYB 4JBZA 1AQTA 4A7PA 1LTJA 4LGDE 1CI6B 2RMZA 3L74G 4JQ0D 5TISE 1VQ5P 1ZXGA 3L73E 1JY3N 1ZMEC 1IJDB 2P1JA 3CCRP 1USEA 1EZVG 1OFCX 3V5BA 2KZIA 1RE3C 3L73J 1T2KD 4EYYQ 1DIPA 2ZJSE 4WWIA 3TNUA 2WVRA 1JUNA 1FZFA 1KILC 1M1JC 1R8EA 1M90Q 1M56D 1BE3E 3H6PA 1LTTC 4AYCA 2HPCA 2LR2A 3B5NC 5KJ7D 1RE4C 3B4SA 3GMAA 4JYBA 1ZR4A 1NGMB 3D71A 1SQBG 3H1ID 1JOCA 3WU2H 3MD0A 2OTJP 2G3AA 1XTCC 5GTIE 3HD7B 4KJMA 4PV1B 3AE5C 2YMKA 3KZIE 3L75G 3EFFK 1BSHA 2OYIA 4N78E 3S9OA 2OTLP 4IL6X 1Q7YQ 1NTZK 1NU1G 1G1JA 3L74J 2L91A 1Q82Q 3MHVA 5DJUB 4Y99B 3CXHH 1KFMA 3SWFA 1FJPA 4CPGA 5AW5B 1RF1A 1ZN5A 2VRSA 1BCCG 5B5EE 5KLVE 3C9IA 2QJPC 5E79H 1Q81Q 5KAFH 3U1CA 4OWFA 2J5UA 1LTJB 3NTNA 3H1KD 1JCDA 1NTMD 1AQ5A 4MN4C 1NTKE 3CMAP 1HGVA 1SQQG 1JY3P 2ZYDA 1QL1A 1K04A 3E1RA 1KQLA 2DW3A 1KYOD 1N73C 1GK4A 2YIUB 2D2CD 1NWQA 3L75E 3TNUB 1SQBJ 1GTWA 5AW2B 1AVOA 4I1LA 1ZR2A 4B86A 1FS0E 4IFFA 1S2EA 2E76B 2HPCB 4L73A 2W8ZA 3L75J 2E43A 1HBWA 1MFZA 2GA1A 1OIPA 1L4AD 2JWAA 2OARA 1ZV8A 5CBNA 3OAKA 1NU1J 2M3EA 5BVZA 3KPEA 3RBZA 5C39A 2QRXA 4JPZB 5GTHH 3SSUA 1BCCJ 2IZ1A 1P84H 2OQQA 1VF5B 1SQXD 2Y9YA 2WT7B 1SQVG 4I7ZC 3KYQA 3M0DA 2E74D 2ZXXA 2O1JA 1S72P 3AE3C 1OZHA 4RO0A 2WZ7A 2QVAA 4H13C 2H89C 1G1IA 2AEFA 2N1TA 3P8CE 2PGDA 1DX7A 3BRVB 4D6TD 2WPSA 3H25A 1VQMP 1NTMK 1Y9BA 4GOEA 2QE7H 3S1KA 1R5SA 5KKZB 3AEBC 3VOPA 2Q7CA 1AJYA 4ZMDA 3L70E 1URQD 1YQ4C 1IK9A 1LTSC 2KB7P 2BASA 3VMAA 4ASWA 3VN0A 2O3JA 1QEXA 1T6AA 1FBMA 3CCLP 3L70J 3A0HH 3LIEA 3L71D 2FYUE 2YMYA 2OYHA 2Z5HA 1JCCA 1SQVJ 1N86A 1H88A 1FZCB 1RF0A 2YXQB 5AW6B 2FYUJ 3N7NA 3VP8A 1GL2C 4BWNA 1PFIA 2HYNA 3H1LE 2Y9ZA 1L0NE 2JWDA 1J1DB 3P7KA 4RESB 5KJ7A 1X9VA 1SVFA 1SQXK 3WU2E 3W68A 4GODA 1LT9C 5DJTB 1Q90D 3USSA 3H32B 3H1LJ 5TISH 1L0NJ 4TT3H 1UIXA 3N4XA 2M8RA 1SFCC 2W83C 2OTKE 1KC8Q 3C8VA 1U7JA 3E7KA 2W6AA 3CXHE 1G2CB 2PAJA 2Q6QA 2SPZA 4L75A 1FZGA 1KILD 2JKVA 1OW7A 5AVQB 5E79E 3L72E 4DCKA 5KAFE 3MP7B 2G8YA 4ASVA 5K5GB 3HE4B 1YJNP 2QM8A 1EQ7A 1VQ7P 4RKUJ 1PGPA 3L72J 1LNQA 2B87B 1WMKA 3Q5PA 4H44B 3CX5I 3HUSC 1Z56A 3CCJP 3TF5A 1SS1A 3FWNA 2ZAEB 1X0TA 1UIIA 3FXDA 5KLVK 2R5DA 2Q3EA 3VMXA 3H1IG 3EWKA 5KLIC 3RBXA 1JY2N 1LGHB 1VQOP 1ZOYC 1LWUC 2XU6A 4U3FD 1NTKK 2KNCA 3PP5A 1PPJD 4K3AA 2Y0EA 2C9LY 2R3SA 1YTZT 4HB1A 1L4AA 5GTHE 2QIWA 1IFDA 2I8DA 1P84E 1EXIA 1OWAA 2FY8A 2QJYC 2WPRA 3CD6P 1KORA 5AW8B 2FYZA 1NO4A 3L35A 3TGUE 1K8AQ 3H1KG 2KSEA 1NTMG 2WQYC 3M9BA 1H0TA 2Q3IA 4YXDC 2IBZE 1S1CX 1JO5A 1SLQA 3TGUJ 1IFMA 2Q1KA 5APVA 2A45G 1AVYA 2N9BA 1YYCA 2R5BA 4QMAA 1WT6A 3U59A 3SFDC 1M57D 5TJHA 2E75B 3G6EP 4WY4D 3CL3D 3P32A 2FXMA 1YBKA 3TK1A 4NPDA 4TLFA 2UWJE 1NAYA 2XV5A 3A0HE 3H1HD 3RL0B 2XNXA 2YKPA 1DH3A 4OGQD 4LLHA 3Q5SA 2D2CB 3O8ZA 3HD7C 4PV1C 1NTZD 4L74A 5AVSB 2WSSH 1JY2P 1SQXG 2KNCB 1VPCA 3M91A 3MUDA 4GKGA 3CX5D 4WVZA 3CCMP 2OYOA 4PD4I 3H1KJ 3IR9A 3W67A 4Y99C 1SQPG 3Q2YA 4C7NA 4BRYA 1JY3O 1FDMA 1FZAA 1LTJC 3KQGA 4IFMA 1BDDA 3V2RA 1VQ8P 2XDJA 1FU1A 3H1JG 1J1EB 2H43A 1H0TB 4N3YB 2E74B 2KP8A 5H2FE 5APYA 2KLUA 1MKMA 1NYHA 2K1AA 1PP9D 2YIUC 3OW2O 1GMJA 3BVHA 1GU4A 3B71A 4NPEA 2IYPA 4O9BA 1HGZA 3D6YA 2BCCG 2E76C 2QA4P 3L71G 1KILA 1FOSF 1M1JA 3QWOC 1SQPE 5CCHD 1TU3F 1Y8AA 2W6BA 3B5NA 1L0LD 1KMIZ 4XFJA 1RE4A 2CPBA 2H88C 1URQB 3L74E 5APXA 2GM4A 1SQPJ 2AXTH 5L8RJ 1SFCD 2KI7B 2N9YB 1VF5C 3HRNA 4HKZH 3H1JE 3II6A 1QL2A 1HVVA 3LIDA 1EZVE 3BCCD 3Q1MA 2E5YA 3V6IA 4U7JA 3JC22 3K5BA 1LTIC 3H1JJ 4BRYB 2Y0DA 4HJGH 4ZNCA 2P10A 3RK2B 2BCCE 2FFDA 3WUVA 2FKWB 5CMZA 1T3JA 3SWYA 1KZUB 1X8YA 1PL5A 1IK7A 3FXEA 2P58A 1SQBE 1JNMA 2BCCJ 4XE5B 5KKZC 1KB9H 3CWBD 3L71J 1HJ0A 1M8OB 1VDFA 2ZVOB 2IPPA 4DZOA 4PD4D 3G71P 1T3UA 2PFXA 2NPSD 4KHXA 2M0BA 3EFGA 1Q86Q 1NU1E 2LKMA 1N73A 1JTHA 2B9BA 1YI2P 1BGYD 2ZT9B 2LXBA 1NJIQ 4XA4A 5AW3B 1BCCE 5APSA 1YJ9P 1FZCC 1KQFB 1S4XA 2WWWA 3PTZA 3JCUH 2K9YA 3L73D 2XNDH 1L0LK 4IFDK 1N7SD 2I1JA 5AW4B 3HE5A 2OYIB 2GUSA 3M9QA 1J1DC 2OGUA 1X79B 1SQQE 4WY4A 1PPJG 2P2UA 1KV4A 3FX0A 2M5AA 1KQSO 1RF1B 1BE3D 1LTGC 1VL2A 1WRGA 1SQQJ 3M9HA 3CPWO 1CW5A 3RK3B 3F89A 2RKLA 3VTPC 2A06G 2FFDB 3AE6C 3GLMA 1PGQA 2ZXEB 2NZ2A 2JEEA 5AW1B 1NKNA 2R32A 5KAIH 1PV3A 2KS1A 2JDIH 1N2DC 3GF7A 3NXSA 4N78D 3IFMA 2W6JH 3RK3E 3NFQA 2WITA 1YITP 4IL6H 1OVUA 4H0LB 3ZDMA 1SQVE 3GG2A 3AEDC 1VQLP 4H44C 3M0AA 2QSIA 1ZP0C 2QM7A 5EFWB 5KLVD 3TSIA 4PV1D 4YXWH 4EDFA 5CJ0A 4M3LA 3V2NA 2V4HA 5CCGC 4GOFA 4PJ0E 1GK6A 1RF0C 2LXCB 3V4QA 1NTKD 3BRTB 1T2KC 2A45H 5AVZB 4HYTB 2A06E 1KYOH 1N7LA 2CK3H 3HE5B 1NTZG 4L76A 1S5LX 3AE9C 4WY4B 5KJ7C 3L75D 2B89A 2FXOA 2AXTE 5CCHA 3NMDA 1OX3A 2M5AB 2RH0A 1NH4A 3VMZA 2HODA 3R2PA 1LT9A 2MJZA 4OGQB 2PRRA 5H2FH 1YTZI 1SFCA 2N1TB 5KTBA 4I6MC 3A2AA 1RHZB 4W7YA 1M7LA 4R4MA 3CXHI 1NOHA 3SWKA 3B5ND 2C0WA 3AEFC 2E76D 1ZRTE 5AW9B 1PP9G 3CC7P 2B88A 4ZKPA 1X22A 2WSEJ 2W90A 1KB9E 1S9KE 1JY2O 2E75C 3VMYA 2OYHB 1NTZJ 3KXDA 1VF5D 4NPFX 1H89A 1IZNB 1L0LG 1NAFA 1QGKB 2H8PD 3RL0C 3I55P 2NPSA 3AE2C 1A02F 2D2CC 1DD3A 3AE7C 1W2EA 3CLQA 1SQBK 2XKMA 3G3ZA 3L70D 4JF7A 3JCUE 2GUVA 1LWUA 5CJ4A 3T97A 1IO4A 2FYNB 2K3RA 3CC4P 2FYUD 4OVNF 4YPCA 1N7SA 4RJTA 1NU1K 1P84I 2RN0A 1DEBA 1EDKA 1PP9J 4Y28J 2WSFH 3MZWB 1PGJA 1J1EC 3H1IE 1CI6A 1MZ9A 1K05A 2E74C 3H1LD 1L0ND 4UB6H 1FAVA 1L2PA 3CWBG 3UIAA 1JMBA 1GW4A 5BU8B 2IBZI 2IZ0A 3H1IJ 1S5LH 1IFJA 1JM0A 3AEGC 1JEKA 5KAIE 1FE6A 2Z4EA 3CCVP 1PZQA 4GDOA 1BGYG 1K9MQ 3BATA 3CCQP 4IL6E 3CXHD 1OVRA 2HG5D 2KYVA 4DT0A 2POHA 1KQGB 1URQC 3L73G 1CZQA 2Q9IA 2NPSB 3L72D 1D7MA 3H1KE 1NTME 3GHGA 4JYCA 3CMEP 2O01H 1RQUA 1AFOA 3G9RA 2IFNA 4KT0J 2WMMA 2WSCJ 4N6JA 4I2LC 3GW6A 4H13D 5APWA 1T8ZA 1L4AB 1NTMJ 3LW5J 5CHXA 3RGUA 2PP6A 3AECC 1KYOE 3A0BH 4AQRD 2K37A 1LT1A 1BE3G 1FOSE 1SQVK 2AXCA 2QJKB 1FC2C 2K88A 1N7SB 1KTMA 4YTPC 2FYUK 3RK2C 3JSVC 3Q3DA 1OW6A 3A3YB 4D6TG 2I1KA 2IYOA 2KXPB 4H44D 1FDIA 2Z5IA 2O01N 1VQNP 2YKQA 1BGYJ 1VQ6P 2NRGA 2C0XA 1L0NK 3QH9A 1SQXE 1RE3A 5CCGD 4PJ0H 1GL2D 5B66H 1P84D 2P67A 2E5TA 2AEMA 2ZYAA 2ZT9C 5KLVG 3VP9A 1YJWP 1SQXJ 2M3BA 1KFNA 3TGUD 1M1KQ 1EDLA 1VQPP 4ZKUA 1NTKG 2IBZD 1BE3J 3GHGB 2J59M 4D6TE 2OYIC 3HTKA 3PRJA 3V4WA 5AVVB 5AVTB 1J2JB 2L5GB 1RH5B 3A5TA 1QVGO 3V2QA 4DOJA 5AVRB 4D6TJ 2WT7A 4C7NB 1EZVI 3PH0A 5AW0B 1GDTA 2YO3A 1RF1C 1AA0A 3BASA 5AVWB 1W2BO 1Y47A 3RK3C 2ZFCA 2WSEH 3L71E 2ITAA 2FFDC 2HLOA 2KUBA 3OA7A 2KOGA 2E75D 5KLVJ 3CX5H 4GIFA 2J58A 1BDCA 1W5CE 2KZJA 2FXPA 3AE4C 2ZYGA 3D70A 4H0LC 4WB4A 1HF9A 3RL0D 4UB6E 1NTKJ 2C9NY 2W27A 2WSFJ 1KILB 1M1JB 4K35A 5APTA 1OVVA 1FJKA 1S5LE 3B5NB 1ZLLA 1PGOA 1LTAC 1IFIA 4GT1A 1FZCA 4U3FG 2IDBA 1E79H 1KILE 3HTKB 1RY3A 1JB0J 3L70G 4C46A 3M0DC 1QX8A 4WY4C 2YXRB 4W80A 1FZBA 2BEQD 1H8AA 3V2PA 3AE1C 2YO2A 3RL0g 1USDA 2FYUG 3H32A 1KN7A 1HH0A 4OGQC 1SQPD 3M06A 1IFPA 4UB8H 2N1TC 1LJ2A 3A7OA 2QJPB 3O6QA 3S4RA 2O01J 3A0BE 5AVXB 3L74D 2KLVA 2JO1A 1OMIA 1G2CA 1GU5A 3PJSK 1DEEG 3H1LG 1L0NG 1LP1A 3H1JD 1EZVD 2V7QJ 1YQ3C 2HR3A 1S3JA 3HE4A 4U3FE 2WSCH 1N73B 1PPJE 1JTHB 4BXLA 3HD7D 2B87A 3LW5H 4U3FJ 2OYHC 1NHLA 4Z1MH 1JMMA 2R3CA 2BCCD 2IFMA 4EOTA 5B66E 1FDOA 3H1HG 3D6ZA 3F5HA 1SQBD 4PD4H 3CCSP 5CCGA 3L72G 1N8RQ 1GL2A 3KHUA 1YIJP 2O1KA 3MIWA 4LC1A 1U7MA 3GF3A 3L36A 3RK2D 4EIJA 4I7ZB 5CCHC 1NU1D 2YKOA 1VQKP 2FYNC 2KK7A 1QVFO 2KSJA 1EDIA 3VYIA 3L4FA 1E5WA 1ZW0A 1YHQP 1BCCD 1KD1Q 1SQPK 3O6QB 2BEZF 1CSBA 3PLNA 4H13B 1RQVA 3SFEC 3IN6A 1EC5A 1OXZA 3H1HE 2KS1B 5M1BA 2ZT9D 3TYYA 3WUTA 2ZVNB 1LP1B 2K9JA 5AVYB 1IFNA 1A02J 1U57A 3I5CA 1SQQD 1NTZE 1MV8A 2FBWC 4AUWA 3U1AA 3H1HJ 2XZRA 1NVOA 3CC2P 3CX5E 1DD4A 3Q5RA
chains in the Genus database with same CATH topology
2M3EA 2KNCA 2K1AA 2K9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M3E A;  2KNC A;  2K1A A;  2K9J A; 
#chains in the Genus database with same CATH topology
 3HUS A;  1KB9 I;  1MUU A;  3P8C D;  2R44 A;  1EXJ A;  3AEE C;  3TGU G;  3CI9 A;  5GTI H;  2IX7 C;  3KZI H;  2Q5U A;  3WUU A;  2NPS C;  2Y0C A;  1NKZ B;  2IBZ G;  3IAO A;  1GL2 B;  3KDP B;  2KIK A;  3P8M C;  3RK3 D;  4W7Z A;  1XTG B;  3BCC G;  1HUC A;  1L4A C;  1VQ9 P;  1SQV D;  5B5E H;  1Q2N A;  3CCU P;  2HOD B;  3ITK A;  1PP9 E;  1LT9 B;  3R4Y A;  1HJB A;  2QJK C;  3B8E B;  5AW7 B;  5APU A;  1AV1 A;  1N7S C;  3TDK A;  1SFC B;  4OH8 B;  3AEA C;  2AEJ A;  2MKV A;  2WPQ A;  4H0L D;  3CCE P;  1L0L E;  2A06 D;  5APQ A;  3L37 A;  4HH2 A;  3WMM 0;  4UB8 E;  2WTY A;  2CPS A;  2E42 A;  4DJG A;  1FZE A;  5AVU B;  2K9J B;  3FGA D;  1L0L J;  1MFT A;  1IC2 A;  4IOI H;  3E1I A;  1EDJ A;  1SQQ K;  2WPV B;  1SP4 A;  4EI2 A;  1LTB C;  3G4S P;  3BCC E;  1GD2 E;  3C1L A;  3HUS B;  4WBA A;  3IF4 A;  1K73 Q;  1VQ4 P;  3AE8 C;  3BCC J;  5BU5 A;  1PIX A;  5CBO A;  1R5L A;  1OW8 A;  1HWT C;  2H7H A;  2JP3 A;  3MTU E;  3ABV C;  3PHL A;  3GHG C;  5KLI B;  1HTL C;  4C7R A;  1URQ A;  1GZL A;  1ZRT D;  3HD7 A;  1QLE D;  3MUD C;  1LWU B;  2N1T D;  3T97 B;  3CWB E;  2QG4 A;  4PD4 E;  3MGN A;  3EQ2 A;  1GW3 A;  1BSN A;  2JJL A;  3OJA B;  1KB9 D;  2YNY A;  2V7Q H;  1S9K D;  2HFE D;  3I56 P;  2A45 I;  3FWL A;  2JR8 A;  1KYO I;  3CWB J;  4R4L A;  2P7J A;  2QEX P;  1BGY E;  2QJY B;  4JBZ A;  1AQT A;  4A7P A;  1LTJ A;  4LGD E;  1CI6 B;  2RMZ A;  3L74 G;  4JQ0 D;  5TIS E;  1VQ5 P;  1ZXG A;  3L73 E;  1JY3 N;  1ZME C;  1IJD B;  2P1J A;  3CCR P;  1USE A;  1EZV G;  1OFC X;  3V5B A;  2KZI A;  1RE3 C;  3L73 J;  1T2K D;  4EYY Q;  1DIP A;  2ZJS E;  4WWI A;  3TNU A;  2WVR A;  1JUN A;  1FZF A;  1KIL C;  1M1J C;  1R8E A;  1M90 Q;  1M56 D;  1BE3 E;  3H6P A;  1LTT C;  4AYC A;  2HPC A;  2LR2 A;  3B5N C;  5KJ7 D;  1RE4 C;  3B4S A;  3GMA A;  4JYB A;  1ZR4 A;  1NGM B;  3D71 A;  1SQB G;  3H1I D;  1JOC A;  3WU2 H;  3MD0 A;  2OTJ P;  2G3A A;  1XTC C;  5GTI E;  3HD7 B;  4KJM A;  4PV1 B;  3AE5 C;  2YMK A;  3KZI E;  3L75 G;  3EFF K;  1BSH A;  2OYI A;  4N78 E;  3S9O A;  2OTL P;  4IL6 X;  1Q7Y Q;  1NTZ K;  1NU1 G;  1G1J A;  3L74 J;  2L91 A;  1Q82 Q;  3MHV A;  5DJU B;  4Y99 B;  3CXH H;  1KFM A;  3SWF A;  1FJP A;  4CPG A;  5AW5 B;  1RF1 A;  1ZN5 A;  2VRS A;  1BCC G;  5B5E E;  5KLV E;  3C9I A;  2QJP C;  5E79 H;  1Q81 Q;  5KAF H;  3U1C A;  4OWF A;  2J5U A;  1LTJ B;  3NTN A;  3H1K D;  1JCD A;  1NTM D;  1AQ5 A;  4MN4 C;  1NTK E;  3CMA P;  1HGV A;  1SQQ G;  1JY3 P;  2ZYD A;  1QL1 A;  1K04 A;  3E1R A;  1KQL A;  2DW3 A;  1KYO D;  1N73 C;  1GK4 A;  2YIU B;  2D2C D;  1NWQ A;  3L75 E;  3TNU B;  1SQB J;  1GTW A;  5AW2 B;  1AVO A;  4I1L A;  1ZR2 A;  4B86 A;  1FS0 E;  4IFF A;  1S2E A;  2E76 B;  2HPC B;  4L73 A;  2W8Z A;  3L75 J;  2E43 A;  1HBW A;  1MFZ A;  2GA1 A;  1OIP A;  1L4A D;  2JWA A;  2OAR A;  1ZV8 A;  5CBN A;  3OAK A;  1NU1 J;  2M3E A;  5BVZ A;  3KPE A;  3RBZ A;  5C39 A;  2QRX A;  4JPZ B;  5GTH H;  3SSU A;  1BCC J;  2IZ1 A;  1P84 H;  2OQQ A;  1VF5 B;  1SQX D;  2Y9Y A;  2WT7 B;  1SQV G;  4I7Z C;  3KYQ A;  3M0D A;  2E74 D;  2ZXX A;  2O1J A;  1S72 P;  3AE3 C;  1OZH A;  4RO0 A;  2WZ7 A;  2QVA A;  4H13 C;  2H89 C;  1G1I A;  2AEF A;  2N1T A;  3P8C E;  2PGD A;  1DX7 A;  3BRV B;  4D6T D;  2WPS A;  3H25 A;  1VQM P;  1NTM K;  1Y9B A;  4GOE A;  2QE7 H;  3S1K A;  1R5S A;  5KKZ B;  3AEB C;  3VOP A;  2Q7C A;  1AJY A;  4ZMD A;  3L70 E;  1URQ D;  1YQ4 C;  1IK9 A;  1LTS C;  2KB7 P;  2BAS A;  3VMA A;  4ASW A;  3VN0 A;  2O3J A;  1QEX A;  1T6A A;  1FBM A;  3CCL P;  3L70 J;  3A0H H;  3LIE A;  3L71 D;  2FYU E;  2YMY A;  2OYH A;  2Z5H A;  1JCC A;  1SQV J;  1N86 A;  1H88 A;  1FZC B;  1RF0 A;  2YXQ B;  5AW6 B;  2FYU J;  3N7N A;  3VP8 A;  1GL2 C;  4BWN A;  1PFI A;  2HYN A;  3H1L E;  2Y9Z A;  1L0N E;  2JWD A;  1J1D B;  3P7K A;  4RES B;  5KJ7 A;  1X9V A;  1SVF A;  1SQX K;  3WU2 E;  3W68 A;  4GOD A;  1LT9 C;  5DJT B;  1Q90 D;  3USS A;  3H32 B;  3H1L J;  5TIS H;  1L0N J;  4TT3 H;  1UIX A;  3N4X A;  2M8R A;  1SFC C;  2W83 C;  2OTK E;  1KC8 Q;  3C8V A;  1U7J A;  3E7K A;  2W6A A;  3CXH E;  1G2C B;  2PAJ A;  2Q6Q A;  2SPZ A;  4L75 A;  1FZG A;  1KIL D;  2JKV A;  1OW7 A;  5AVQ B;  5E79 E;  3L72 E;  4DCK A;  5KAF E;  3MP7 B;  2G8Y A;  4ASV A;  5K5G B;  3HE4 B;  1YJN P;  2QM8 A;  1EQ7 A;  1VQ7 P;  4RKU J;  1PGP A;  3L72 J;  1LNQ A;  2B87 B;  1WMK A;  3Q5P A;  4H44 B;  3CX5 I;  3HUS C;  1Z56 A;  3CCJ P;  3TF5 A;  1SS1 A;  3FWN A;  2ZAE B;  1X0T A;  1UII A;  3FXD A;  5KLV K;  2R5D A;  2Q3E A;  3VMX A;  3H1I G;  3EWK A;  5KLI C;  3RBX A;  1JY2 N;  1LGH B;  1VQO P;  1ZOY C;  1LWU C;  2XU6 A;  4U3F D;  1NTK K;  2KNC A;  3PP5 A;  1PPJ D;  4K3A A;  2Y0E A;  2C9L Y;  2R3S A;  1YTZ T;  4HB1 A;  1L4A A;  5GTH E;  2QIW A;  1IFD A;  2I8D A;  1P84 E;  1EXI A;  1OWA A;  2FY8 A;  2QJY C;  2WPR A;  3CD6 P;  1KOR A;  5AW8 B;  2FYZ A;  1NO4 A;  3L35 A;  3TGU E;  1K8A Q;  3H1K G;  2KSE A;  1NTM G;  2WQY C;  3M9B A;  1H0T A;  2Q3I A;  4YXD C;  2IBZ E;  1S1C X;  1JO5 A;  1SLQ A;  3TGU J;  1IFM A;  2Q1K A;  5APV A;  2A45 G;  1AVY A;  2N9B A;  1YYC A;  2R5B A;  4QMA A;  1WT6 A;  3U59 A;  3SFD C;  1M57 D;  5TJH A;  2E75 B;  3G6E P;  4WY4 D;  3CL3 D;  3P32 A;  2FXM A;  1YBK A;  3TK1 A;  4NPD A;  4TLF A;  2UWJ E;  1NAY A;  2XV5 A;  3A0H E;  3H1H D;  3RL0 B;  2XNX A;  2YKP A;  1DH3 A;  4OGQ D;  4LLH A;  3Q5S A;  2D2C B;  3O8Z A;  3HD7 C;  4PV1 C;  1NTZ D;  4L74 A;  5AVS B;  2WSS H;  1JY2 P;  1SQX G;  2KNC B;  1VPC A;  3M91 A;  3MUD A;  4GKG A;  3CX5 D;  4WVZ A;  3CCM P;  2OYO A;  4PD4 I;  3H1K J;  3IR9 A;  3W67 A;  4Y99 C;  1SQP G;  3Q2Y A;  4C7N A;  4BRY A;  1JY3 O;  1FDM A;  1FZA A;  1LTJ C;  3KQG A;  4IFM A;  1BDD A;  3V2R A;  1VQ8 P;  2XDJ A;  1FU1 A;  3H1J G;  1J1E B;  2H43 A;  1H0T B;  4N3Y B;  2E74 B;  2KP8 A;  5H2F E;  5APY A;  2KLU A;  1MKM A;  1NYH A;  2K1A A;  1PP9 D;  2YIU C;  3OW2 O;  1GMJ A;  3BVH A;  1GU4 A;  3B71 A;  4NPE A;  2IYP A;  4O9B A;  1HGZ A;  3D6Y A;  2BCC G;  2E76 C;  2QA4 P;  3L71 G;  1KIL A;  1FOS F;  1M1J A;  3QWO C;  1SQP E;  5CCH D;  1TU3 F;  1Y8A A;  2W6B A;  3B5N A;  1L0L D;  1KMI Z;  4XFJ A;  1RE4 A;  2CPB A;  2H88 C;  1URQ B;  3L74 E;  5APX A;  2GM4 A;  1SQP J;  2AXT H;  5L8R J;  1SFC D;  2KI7 B;  2N9Y B;  1VF5 C;  3HRN A;  4HKZ H;  3H1J E;  3II6 A;  1QL2 A;  1HVV A;  3LID A;  1EZV E;  3BCC D;  3Q1M A;  2E5Y A;  3V6I A;  4U7J A;  3JC2 2;  3K5B A;  1LTI C;  3H1J J;  4BRY B;  2Y0D A;  4HJG H;  4ZNC A;  2P10 A;  3RK2 B;  2BCC E;  2FFD A;  3WUV A;  2FKW B;  5CMZ A;  1T3J A;  3SWY A;  1KZU B;  1X8Y A;  1PL5 A;  1IK7 A;  3FXE A;  2P58 A;  1SQB E;  1JNM A;  2BCC J;  4XE5 B;  5KKZ C;  1KB9 H;  3CWB D;  3L71 J;  1HJ0 A;  1M8O B;  1VDF A;  2ZVO B;  2IPP A;  4DZO A;  4PD4 D;  3G71 P;  1T3U A;  2PFX A;  2NPS D;  4KHX A;  2M0B A;  3EFG A;  1Q86 Q;  1NU1 E;  2LKM A;  1N73 A;  1JTH A;  2B9B A;  1YI2 P;  1BGY D;  2ZT9 B;  2LXB A;  1NJI Q;  4XA4 A;  5AW3 B;  1BCC E;  5APS A;  1YJ9 P;  1FZC C;  1KQF B;  1S4X A;  2WWW A;  3PTZ A;  3JCU H;  2K9Y A;  3L73 D;  2XND H;  1L0L K;  4IFD K;  1N7S D;  2I1J A;  5AW4 B;  3HE5 A;  2OYI B;  2GUS A;  3M9Q A;  1J1D C;  2OGU A;  1X79 B;  1SQQ E;  4WY4 A;  1PPJ G;  2P2U A;  1KV4 A;  3FX0 A;  2M5A A;  1KQS O;  1RF1 B;  1BE3 D;  1LTG C;  1VL2 A;  1WRG A;  1SQQ J;  3M9H A;  3CPW O;  1CW5 A;  3RK3 B;  3F89 A;  2RKL A;  3VTP C;  2A06 G;  2FFD B;  3AE6 C;  3GLM A;  1PGQ A;  2ZXE B;  2NZ2 A;  2JEE A;  5AW1 B;  1NKN A;  2R32 A;  5KAI H;  1PV3 A;  2KS1 A;  2JDI H;  1N2D C;  3GF7 A;  3NXS A;  4N78 D;  3IFM A;  2W6J H;  3RK3 E;  3NFQ A;  2WIT A;  1YIT P;  4IL6 H;  1OVU A;  4H0L B;  3ZDM A;  1SQV E;  3GG2 A;  3AED C;  1VQL P;  4H44 C;  3M0A A;  2QSI A;  1ZP0 C;  2QM7 A;  5EFW B;  5KLV D;  3TSI A;  4PV1 D;  4YXW H;  4EDF A;  5CJ0 A;  4M3L A;  3V2N A;  2V4H A;  5CCG C;  4GOF A;  4PJ0 E;  1GK6 A;  1RF0 C;  2LXC B;  3V4Q A;  1NTK D;  3BRT B;  1T2K C;  2A45 H;  5AVZ B;  4HYT B;  2A06 E;  1KYO H;  1N7L A;  2CK3 H;  3HE5 B;  1NTZ G;  4L76 A;  1S5L X;  3AE9 C;  4WY4 B;  5KJ7 C;  3L75 D;  2B89 A;  2FXO A;  2AXT E;  5CCH A;  3NMD A;  1OX3 A;  2M5A B;  2RH0 A;  1NH4 A;  3VMZ A;  2HOD A;  3R2P A;  1LT9 A;  2MJZ A;  4OGQ B;  2PRR A;  5H2F H;  1YTZ I;  1SFC A;  2N1T B;  5KTB A;  4I6M C;  3A2A A;  1RHZ B;  4W7Y A;  1M7L A;  4R4M A;  3CXH I;  1NOH A;  3SWK A;  3B5N D;  2C0W A;  3AEF C;  2E76 D;  1ZRT E;  5AW9 B;  1PP9 G;  3CC7 P;  2B88 A;  4ZKP A;  1X22 A;  2WSE J;  2W90 A;  1KB9 E;  1S9K E;  1JY2 O;  2E75 C;  3VMY A;  2OYH B;  1NTZ J;  3KXD A;  1VF5 D;  4NPF X;  1H89 A;  1IZN B;  1L0L G;  1NAF A;  1QGK B;  2H8P D;  3RL0 C;  3I55 P;  2NPS A;  3AE2 C;  1A02 F;  2D2C C;  1DD3 A;  3AE7 C;  1W2E A;  3CLQ A;  1SQB K;  2XKM A;  3G3Z A;  3L70 D;  4JF7 A;  3JCU E;  2GUV A;  1LWU A;  5CJ4 A;  3T97 A;  1IO4 A;  2FYN B;  2K3R A;  3CC4 P;  2FYU D;  4OVN F;  4YPC A;  1N7S A;  4RJT A;  1NU1 K;  1P84 I;  2RN0 A;  1DEB A;  1EDK A;  1PP9 J;  4Y28 J;  2WSF H;  3MZW B;  1PGJ A;  1J1E C;  3H1I E;  1CI6 A;  1MZ9 A;  1K05 A;  2E74 C;  3H1L D;  1L0N D;  4UB6 H;  1FAV A;  1L2P A;  3CWB G;  3UIA A;  1JMB A;  1GW4 A;  5BU8 B;  2IBZ I;  2IZ0 A;  3H1I J;  1S5L H;  1IFJ A;  1JM0 A;  3AEG C;  1JEK A;  5KAI E;  1FE6 A;  2Z4E A;  3CCV P;  1PZQ A;  4GDO A;  1BGY G;  1K9M Q;  3BAT A;  3CCQ P;  4IL6 E;  3CXH D;  1OVR A;  2HG5 D;  2KYV A;  4DT0 A;  2POH A;  1KQG B;  1URQ C;  3L73 G;  1CZQ A;  2Q9I A;  2NPS B;  3L72 D;  1D7M A;  3H1K E;  1NTM E;  3GHG A;  4JYC A;  3CME P;  2O01 H;  1RQU A;  1AFO A;  3G9R A;  2IFN A;  4KT0 J;  2WMM A;  2WSC J;  4N6J A;  4I2L C;  3GW6 A;  4H13 D;  5APW A;  1T8Z A;  1L4A B;  1NTM J;  3LW5 J;  5CHX A;  3RGU A;  2PP6 A;  3AEC C;  1KYO E;  3A0B H;  4AQR D;  2K37 A;  1LT1 A;  1BE3 G;  1FOS E;  1SQV K;  2AXC A;  2QJK B;  1FC2 C;  2K88 A;  1N7S B;  1KTM A;  4YTP C;  2FYU K;  3RK2 C;  3JSV C;  3Q3D A;  1OW6 A;  3A3Y B;  4D6T G;  2I1K A;  2IYO A;  2KXP B;  4H44 D;  1FDI A;  2Z5I A;  2O01 N;  1VQN P;  2YKQ A;  1BGY J;  1VQ6 P;  2NRG A;  2C0X A;  1L0N K;  3QH9 A;  1SQX E;  1RE3 A;  5CCG D;  4PJ0 H;  1GL2 D;  5B66 H;  1P84 D;  2P67 A;  2E5T A;  2AEM A;  2ZYA A;  2ZT9 C;  5KLV G;  3VP9 A;  1YJW P;  1SQX J;  2M3B A;  1KFN A;  3TGU D;  1M1K Q;  1EDL A;  1VQP P;  4ZKU A;  1NTK G;  2IBZ D;  1BE3 J;  3GHG B;  2J59 M;  4D6T E;  2OYI C;  3HTK A;  3PRJ A;  3V4W A;  5AVV B;  5AVT B;  1J2J B;  2L5G B;  1RH5 B;  3A5T A;  1QVG O;  3V2Q A;  4DOJ A;  5AVR B;  4D6T J;  2WT7 A;  4C7N B;  1EZV I;  3PH0 A;  5AW0 B;  1GDT A;  2YO3 A;  1RF1 C;  1AA0 A;  3BAS A;  5AVW B;  1W2B O;  1Y47 A;  3RK3 C;  2ZFC A;  2WSE H;  3L71 E;  2ITA A;  2FFD C;  2HLO A;  2KUB A;  3OA7 A;  2KOG A;  2E75 D;  5KLV J;  3CX5 H;  4GIF A;  2J58 A;  1BDC A;  1W5C E;  2KZJ A;  2FXP A;  3AE4 C;  2ZYG A;  3D70 A;  4H0L C;  4WB4 A;  1HF9 A;  3RL0 D;  4UB6 E;  1NTK J;  2C9N Y;  2W27 A;  2WSF J;  1KIL B;  1M1J B;  4K35 A;  5APT A;  1OVV A;  1FJK A;  1S5L E;  3B5N B;  1ZLL A;  1PGO A;  1LTA C;  1IFI A;  4GT1 A;  1FZC A;  4U3F G;  2IDB A;  1E79 H;  1KIL E;  3HTK B;  1RY3 A;  1JB0 J;  3L70 G;  4C46 A;  3M0D C;  1QX8 A;  4WY4 C;  2YXR B;  4W80 A;  1FZB A;  2BEQ D;  1H8A A;  3V2P A;  3AE1 C;  2YO2 A;  3RL0 g;  1USD A;  2FYU G;  3H32 A;  1KN7 A;  1HH0 A;  4OGQ C;  1SQP D;  3M06 A;  1IFP A;  4UB8 H;  2N1T C;  1LJ2 A;  3A7O A;  2QJP B;  3O6Q A;  3S4R A;  2O01 J;  3A0B E;  5AVX B;  3L74 D;  2KLV A;  2JO1 A;  1OMI A;  1G2C A;  1GU5 A;  3PJS K;  1DEE G;  3H1L G;  1L0N G;  1LP1 A;  3H1J D;  1EZV D;  2V7Q J;  1YQ3 C;  2HR3 A;  1S3J A;  3HE4 A;  4U3F E;  2WSC H;  1N73 B;  1PPJ E;  1JTH B;  4BXL A;  3HD7 D;  2B87 A;  3LW5 H;  4U3F J;  2OYH C;  1NHL A;  4Z1M H;  1JMM A;  2R3C A;  2BCC D;  2IFM A;  4EOT A;  5B66 E;  1FDO A;  3H1H G;  3D6Z A;  3F5H A;  1SQB D;  4PD4 H;  3CCS P;  5CCG A;  3L72 G;  1N8R Q;  1GL2 A;  3KHU A;  1YIJ P;  2O1K A;  3MIW A;  4LC1 A;  1U7M A;  3GF3 A;  3L36 A;  3RK2 D;  4EIJ A;  4I7Z B;  5CCH C;  1NU1 D;  2YKO A;  1VQK P;  2FYN C;  2KK7 A;  1QVF O;  2KSJ A;  1EDI A;  3VYI A;  3L4F A;  1E5W A;  1ZW0 A;  1YHQ P;  1BCC D;  1KD1 Q;  1SQP K;  3O6Q B;  2BEZ F;  1CSB A;  3PLN A;  4H13 B;  1RQV A;  3SFE C;  3IN6 A;  1EC5 A;  1OXZ A;  3H1H E;  2KS1 B;  5M1B A;  2ZT9 D;  3TYY A;  3WUT A;  2ZVN B;  1LP1 B;  2K9J A;  5AVY B;  1IFN A;  1A02 J;  1U57 A;  3I5C A;  1SQQ D;  1NTZ E;  1MV8 A;  2FBW C;  4AUW A;  3U1A A;  3H1H J;  2XZR A;  1NVO A;  3CC2 P;  3CX5 E;  1DD4 A;  3Q5R A; 
#chains in the Genus database with same CATH homology
 2M3E A;  2KNC A;  2K1A A;  2K9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...