2M3EA

The integrin alpha l transmembrane domain in bicelles: structure and interaction with integrin beta 2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
50
structure length
50
Chain Sequence
b'SNADVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-L
molecule tags Membrane protein
source organism Homo sapiens
publication title The Integrin Alpha L Transmembrane Domain in Bicelles: Structure and Interaction with Integrin Beta 2
rcsb
total genus 12
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2013-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00357 Integrin_alpha Integrin alpha cytoplasmic region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.930 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Bicelle-embedded integrin alpha(iib) transmembrane segment 2m3eA00
2M3EA 2K1AA 2KNCA 2K9JA
chains in the Genus database with same CATH superfamily
3H1JJ 1BSNA 1PP9E 1XTGB 3H1LG 4PV1B 5AW1B 5AW8B 4H44C 2NPSC 3H1KD 2WSCH 3E7KA 5AW9B 1FZBA 1KYOE 3GLMA 1KORA 4OGQC 1HWTC 3GW6A 1IJDB 3CWBE 3HE4A 1VQ8P 1LT9A 1S3JA 3L37A 2OYHA 4JQ0D 3M0DC 2JWAA 5KAIE 3AE4C 2RN0A 1URQA 3H1IE 4WY4C 3L75G 1PGOA 2JP3A 3M91A 1FS0E 1FU1A 3P32A 1Q90D 4LGDE 1FJPA 2FY8A 1YITP 4I2LC 2GM4A 2E75C 2JR8A 3MUDC 5APTA 3SWFA 5BVZA 1SQBJ 1YQ4C 2N9YB 2V7QH 4HYTB 3CXHH 3FX0A 3HTKA 3L75J 1SQXK 3RK3E 2HR3A 3VMYA 2E5YA 2A45H 1ZLLA 1GW3A 1T6AA 3EFGA 3GHGC 3HTKB 2K1AA 3SFDC 1Y9BA 1EC5A 2RMZA 4TT3H 1GU4A 2POHA 3TNUA 4JPZB 1NTZD 2K9YA 3H1HD 1Y8AA 1QEXA 2FYNC 4OH8B 3U1AA 5APUA 3VP9A 3BCCJ 1BE3G 5GTHE 4K3AA 1YHQP 1FZCC 1GMJA 1HJ0A 2C9LY 2PRRA 2BCCG 5KLIC 4IL6H 3RK3B 1NAFA 1SQXJ 1BGYD 1KILE 2C0XA 2LXBA 2WSCJ 3WU2E 3CC7P 2O1JA 3WMM0 1AVOA 2ZYGA 3O8ZA 4R4MA 4KJMA 3LW5H 5KLVD 2K3RA 3Q3DA 4W80A 3CCJP 2Y0CA 1M1KQ 1FBMA 3L71D 1ZOYC 1JCCA 2XDJA 2ZT9D 3CXHD 5AVYB 1LP1B 5GTIE 2ZJSE 3W68A 4YXWH 4ZMDA 4YTPC 1K8AQ 1KILB 2L91A 5KJ7A 1KD1Q 1GL2A 4IFMA 1KV4A 2KIKA 3L75E 2M0BA 4BWNA 2N1TB 3A2AA 1L0LE 2XNXA 1QX8A 1NKZB 3H1LJ 1A02J 1GL2B 1PGQA 1LTAC 3A3YB 2M8RA 3Q1MA 5KTBA 2XU6A 5KAFH 1HGZA 2KP8A 2MJZA 2P1JA 1U57A 2WZ7A 3CWBJ 3L74E 1IFNA 1GTWA 2E42A 1N7SA 1LT9C 1T3JA 3Q2YA 3P7KA 3JC22 3CX5E 1E79H 1FZAA 2YNYA 2B87A 1PFIA 1J1EB 2YXQB 1W5CE 3QH9A 3N7NA 3M0AA 1VQNP 1PP9J 2KSJA 1SQVJ 4GKGA 4R4LA 4U3FG 1DX7A 4Y28J 1NWQA 5KKZC 3HE5B 2Y0DA 4PJ0E 2NPSD 5CCGC 4ZKPA 3L70D 1SLQA 4C7NB 1RQUA 3H1JE 5AVVB 1L4AA 3EFFK 1NTZE 2PFXA 3TK1A 2QJKC 1LTJB 1FDIA 2Q5UA 1RE3A 1L0LG 1J2JB 1FC2C 4Y99C 4YXDC 2E74B 2FYNB 4I1LA 2VRSA 1RF1A 1FOSF 3L73J 4U3FD 1EQ7A 5APYA 3P8CE 2J5UA 2BASA 1JY3N 3AE6C 3CCMP 3GHGB 3RL0B 1AQTA 1RF0A 1SFCA 1BCCD 1L0NK 1X0TA 2FBWC 2LXCB 1MKMA 2M5AA 2XV5A 2IZ1A 2QA4P 2OQQA 3KZIH 5APXA 5K5GB 2IBZE 2WPSA 1LWUA 2LR2A 2Q6QA 1IFMA 1LP1A 1RH5B 1M56D 2JKVA 2E75B 2J59M 2R5DA 4WY4A 5L8RJ 3SSUA 1ZMEC 1OVUA 1JM0A 4PD4H 1KILA 3M0DA 4GOFA 5AVUB 4AYCA 4JYBA 3B8EB 2KNCA 3PP5A 3Q5SA 3AE5C 1KN7A 1S9KD 2N1TA 2JO1A 5E79H 3O6QA 1H0TA 1SQQK 1JEKA 2IBZG 1HVVA 1NTMJ 1T8ZA 5KLVK 1EDJA 1NTKJ 1LWUC 4UB6H 3K5BA 2W6JH 2A45I 3A0BH 5CCHA 1NAYA 3BCCE 3H1LE 2CPBA 2O01H 1N7SB 3L72E 4PV1C 1SQXG 5KLVG 3AEBC 2BCCD 3H1HE 5C39A 3L73E 1G2CA 4HKZH 1FAVA 2RH0A 4U3FE 1L0LD 2GA1A 1U7MA 2FYUG 2QJPC 3NMDA 4B86A 2NZ2A 1H88A 1HF9A 2KYVA 4CPGA 3AE7C 1L2PA 1N73C 1NTMK 1NTZG 2D2CD 3BATA 3RL0g 3L70G 3WUUA 2E43A 3H6PA 4PJ0H 3ITKA 1X8YA 1BGYG 1SQPE 2O3JA 1JUNA 1N2DC 2K37A 2OTKE 3L73G 2W27A 3NFQA 1N73B 1OW7A 1RF1B 1VQMP 1RHZB 2AEJA 1NJIQ 2YXRB 1VQ6P 1E5WA 2FXPA 1NTZJ 1CI6A 1NYHA 3MTUE 3TGUJ 2ZYDA 1YJWP 5GTHH 1NU1J 3BCCD 1QLED 4UB8H 2M5AB 1VQLP 3MGNA 1N7SC 2G3AA 3FWNA 4N6JA 2WSFJ 2GUVA 3AE3C 5E79E 1ZR4A 3JSVC 1IFJA 3V2RA 2K9JB 1KTMA 1VQ7P 2HG5D 3CCRP 1L0NG 5AVZB 4DJGA 4IL6X 1M8OB 2ZAEB 1M1JC 3E1RA 3IF4A 3V4WA 2FFDC 2Z4EA 4GOEA 2ZFCA 3M9BA 2V4HA 3B5NB 2IFMA 5KLVJ 5CCGA 1QVFO 1JY2P 4M3LA 3EQ2A 1M90Q 1GW4A 3L71J 4HJGH 1AV1A 2KZJA 3SWYA 1OMIA 1SFCC 1WT6A 1IFPA 1NHLA 4HB1A 1KC8Q 2OGUA 1DEEG 5KLVE 3HD7B 3PTZA 4IFDK 2QEXP 1YTZT 2AXCA 2QIWA 4QMAA 4EOTA 1RE3C 1KQFB 1KB9D 3I5CA 1OXZA 3A0BE 4UB8E 2A06D 1MV8A 1JNMA 4YPCA 1LGHB 4Y99B 2R3CA 1USEA 1NU1G 2P58A 4I7ZB 1TU3F 4XFJA 1L4AD 2JJLA 3AEDC 1NTMG 2PGDA 2QJYC 3B71A 3BRTB 2W8ZA 1PIXA 2FXOA 1S5LH 3D71A 2M3BA 3ABVC 4GODA 1GK6A 3LW5J 5CMZA 2KXPB 5KAFE 2R5BA 3FWLA 2O1KA 3L70J 1LT9B 1N7SD 2G8YA 1OIPA 3BVHA 3WUVA 2IFNA 3AE2C 3SWKA 3IR9A 3B5NC 1KQSO 1OW6A 1DD3A 2W90A 1YJ9P 1FJKA 2KS1A 1K04A 1GL2C 1SQVG 4U3FJ 4MN4C 1R5LA 1M1JB 5APQA 4I6MC 3I55P 2HPCB 2FFDB 4UB6E 4GT1A 3L72D 1WRGA 1OX3A 1GDTA 1KB9H 1GL2D 2N9BA 1RE4C 3PH0A 4H13C 4XE5B 1M1JA 4ASWA 2YKOA 3H1IJ 2FFDA 2QVAA 4DOJA 2I1JA 3CMAP 4K35A 1Q86Q 1FZFA 2R44A 4BXLA 3II6A 2Q1KA 3CI9A 1VDFA 2SPZA 3C8VA 1AFOA 2P7JA 1ZW0A 1FZEA 3HD7A 3M06A 3RL0D 1PPJD 1KZUB 1YTZI 3F89A 1IFDA 4IFFA 4NPEA 1GK4A 3NTNA 4IL6E 3PLNA 2YO3A 5AW3B 1H8AA 1IZNB 1LTSC 1PPJE 1UIIA 3CX5D 5DJTB 1S9KE 1N86A 1ZRTE 2FYUD 2ZVNB 1SQPD 2H7HA 3L74J 2NRGA 2W6BA 2A06G 4D6TJ 2KLUA 3AEFC 5H2FH 3D6ZA 2QJPB 4EDFA 2YIUB 1IK9A 1LNQA 3RK3D 4RJTA 4H44D 1NTKK 2IYPA 4OGQD 1NU1K 3C9IA 2A45G 1SQQD 4ASVA 5B66E 5GTIH 3HE4B 1HH0A 3GF7A 3AE1C 1VQ5P 5CCHD 1AVYA 2LKMA 3H1HG 1MZ9A 2Z5HA 3AECC 3AEEC 3P8CD 1NTKE 1NTZK 4NPFX 1SQBE 5KJ7D 5M1BA 1NOHA 2C9NY 4EIJA 3OW2O 1BE3J 1EDIA 1PP9G 5KAIH 1H0TB 5AVRB 3SFEC 5CBOA 2XNDH 2E75D 2JWDA 2QE7H 1IK7A 1AA0A 2J58A 3TYYA 1KILD 1BGYE 1JY2N 1OZHA 4JYCA 4AUWA 3KPEA 1L0ND 1P84H 5AW2B 1LTGC 3AEAC 3O6QB 4U7JA 1QGKB 4WY4D 3VP8A 1KQLA 2K88A 4H13D 1A02F 1SQBK 1L0NE 2ZT9B 1AQ5A 3CX5H 1BE3E 1PGPA 2H8PD 2FYZA 2DW3A 3KHUA 1H89A 2C0WA 3CMEP 1KFNA 2WPVB 1PP9D 1SQVD 3GG2A 2CK3H 4OGQB 3PRJA 2O01J 1DH3A 1MUUA 2E74D 4DZOA 3W67A 1EXJA 4H44B 1RF0C 3E1IA 2KOGA 3VYIA 2WT7B 1VPCA 4OWFA 3CCSP 1Q2NA 3IN6A 2E74C 1ZXGA 2WWWA 3TNUB 2XKMA 1YBKA 3G4SP 2PAJA 1J1DB 1LTJC 2B9BA 2E76B 2HFED 2YIUC 3KXDA 4AQRD 2WTYA 5AW6B 2W6AA 1CW5A 1LTJA 4W7ZA 3L73D 3CCQP 2KZIA 3AE9C 5KKZB 2ZXXA 3EWKA 1USDA 5BU8B 1BSHA 1JB0J 4L75A 2Q7CA 1JTHA 2JEEA 3OAKA 5EFWB 3VOPA 1J1EC 1VQKP 2WSEH 1FOSE 3HD7D 5APVA 1SP4A 5AW5B 3H1JD 1ZR2A 4L74A 3H25A 2OTLP 1EZVD 1NTME 1P84E 3IAOA 3NXSA 3H1KJ 4A7PA 3CLQA 5AVSB 1GD2E 5TISH 2AXTE 1QVGO 1X9VA 3S1KA 1JY3P 2HPCA 1EZVI 1VL2A 1DEBA 1S5LX 3VN0A 1GU5A 3OA7A 3CC4P 1NTKD 1UIXA 1BDDA 1KB9I 1KILC 2I1KA 4N78E 4RESB 4TLFA 5APWA 3FXDA 3RK2C 3A7OA 1SQVK 1HTLC 1HUCA 1X22A 1OWAA 1S2EA 2H89C 2WITA 2WSSH 3KYQA 4RKUJ 3RK2D 3R2PA 2B87B 2BCCJ 2FYUK 4WVZA 1BCCE 1SQBD 1S4XA 2KLVA 4Z1MH 1L0LJ 3BCCG 3M9QA 1LTIC 1G2CB 3CXHI 1OVRA 5AW7B 1PZQA 3S4RA 4BRYB 5AVXB 4D6TE 1NKNA 4C7NA 3RBXA 2WT7A 1L4AB 1Q7YQ 2IDBA 1IFIA 1ZRTD 2QM7A 3U1CA 3C1LA 3H1HJ 1KQGB 3A5TA 1K05A 2Q3EA 3HE5A 1R8EA 1PV3A 4I7ZC 4O9BA 5TISE 3L70E 3TGUG 1J1DC 1NH4A 2E76C 2KB7P 2WSEJ 3CCLP 3RGUA 1S1CX 3TGUD 1FZCB 2YO2A 3G3ZA 2E5TA 2HLOA 2RKLA 2E76D 4JF7A 1NU1D 1SQXD 2AEMA 1KYOH 1CI6B 1BGYJ 1JTHB 5BU5A 2B88A 2XZRA 2ZYAA 4L76A 3RBZA 3FXEA 1NGMB 1SQXE 1HGVA 3M9HA 3HD7C 4KHXA 2W83C 2OARA 3GHGA 1EDLA 1SQPK 2B89A 1SQPJ 1SFCB 2ZT9C 3KZIE 3L74D 3VTPC 1JOCA 3TF5A 1M57D 3HUSA 1IC2A 4D6TD 3Q5RA 1EXIA 2FKWB 2IBZD 4PD4E 2ZVOB 5CCGD 3B4SA 1HBWA 1HJBA 2FXMA 2PP6A 1URQD 3HUSB 3H1JG 3L71G 3MUDA 4WY4B 5TJHA 2OTJP 3CCVP 3MHVA 1LTTC 1NTKG 2OYOA 3CCEP 1SQQJ 5KJ7C 4C7RA 1N7LA 2QM8A 1RQVA 3A0HE 2KNCB 1OVVA 2Y0EA 1YYCA 2QRXA 1WMKA 3H1IG 3H1LD 2Z5IA 3H32A 1FE6A 3L74G 3MP7B 4PV1D 1OW8A 2KUBA 4XA4A 3CPWO 5H2FE 1S72P 2P2UA 4EI2A 2YMKA 2NPSB 3D70A 2KK7A 2QSIA 3CWBD 1EZVG 2Y9ZA 3P8MC 4H0LB 1NVOA 2P10A 2NPSA 1KYOD 1JY2O 4D6TG 3G6EP 4BRYA 4OVNF 3S9OA 1IO4A 1JCDA 4HH2A 1PGJA 2L5GB 1KYOI 2D2CB 3WU2H 1VF5B 1ZV8A 4ZNCA 1VQ4P 1NO4A 2D2CC 1CSBA 5CJ0A 3Q5PA 2QG4A 1YJNP 3MZWB 1MFZA 2KSEA 3USSA 3LIDA 1LT1A 3ZDMA 1FZCA 1AJYA 3TDKA 4LLHA 2JDIH 1ZN5A 3JCUH 3OJAB 4JBZA 2WVRA 1SQBG 4DCKA 3G9RA 1QL2A 3A0HH 1XTCC 3GF3A 1RE4A 3L75D 3L72G 2M3EA 4KT0J 2UWJE 2R32A 2OYIC 1BCCJ 4GDOA 4WB4A 5CBNA 4LC1A 1LWUB 4H13B 1Z56A 2IYOA 4N3YB 1SQQE 3L72J 4WWIA 3L36A 3B5NA 2K9JA 3PJSK 5B5EH 2N1TD 4N78D 2BCCE 3H1ID 4L73A 3GMAA 1URQC 3HUSC 3CX5I 1R5SA 1FDOA 3HRNA 1G1IA 1K73Q 1SVFA 2P67A 3BASA 2OYHC 1YIJP 3CC2P 2WQYC 3JCUE 3N4XA 4EYYQ 3H32B 5CHXA 5AW4B 2R3SA 2MKVA 1EZVE 1NTMD 1P84D 2ITAA 1BDCA 1DD4A 3FGAD 1SFCD 3AEGC 2KI7B 3LIEA 3MIWA 3RL0C 1KB9E 4WBAA 3V2PA 1JO5A 3L4FA 2QJYB 2WSFH 3BRVB 3KDPB 2FYUJ 1JMBA 1BCCG 1VF5D 1PPJG 1VQ9P 1M7LA 2HODB 1SQPG 3VMXA 3V2QA 3TSIA 1W2EA 2QJKB 1G1JA 1LJ2A 3T97B 1EDKA 2Y9YA 2I8DA 4DT0A 3KQGA 3QWOC 2BEZF 5B66H 5B5EE 2WPRA 4H0LD 1T2KD 1N73A 2IBZI 1L4AC 3VMZA 1S5LE 2CPSA 5AVQB 1GZLA 1KFMA 2YKPA 3F5HA 4C46A 3UIAA 3I56P 3L35A 3PHLA 5DJUB 4PD4D 5CCHC 3G71P 1W2BO 1MFTA 2O01N 1Q81Q 1DIPA 3L71E 1BE3D 1Y47A 5APSA 3MD0A 1Q82Q 3V5BA 1KMIZ 2OYHB 1VQPP 2ZXEB 1VQOP 4IOIH 1URQB 1L0NJ 3V6IA 1JMMA 1YQ3C 1L0LK 2A06E 2AXTH 2H88C 3RK2B 1P84I 3B5ND 2IX7C 2N1TC 4W7YA 3H1KE 3TGUE 3V2NA 1NU1E 2KS1B 3CCUP 2H43A 2IPPA 1N8RQ 5AW0B 3AE8C 3VMAA 2OYIB 3D6YA 1LTBC 1K9MQ 1OFCX 1YI2P 2HYNA 3WUTA 1T3UA 1SQQG 2OYIA 4PD4I 3U59A 2IZ0A 3V4QA 2GUSA 4RO0A 3CL3D 3H1KG 1FZGA 2Q9IA 4NPDA 1D7MA 2AEFA 2BEQD 1U7JA 4GIFA 1CZQA 1RY3A 1RF1C 1ZP0C 2WMMA 1FDMA 2V7QJ 3R4YA 1PL5A 5CJ4A 1X79B 1VF5C 4ZKUA 3IFMA 1JY3O 2Q3IA 2YMYA 2YKQA 2HODA 3CXHE 3RK3C 1SQVE 5KLIB 2FYUE 1QL1A 3CWBG 2WPQA 5AVWB 5AVTB 3T97A 3CD6P 1SS1A 1T2KC 4H0LC
chains in the Genus database with same CATH topology
2M3EA 2K1AA 2KNCA 2K9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M3E A;  2K1A A;  2KNC A;  2K9J A; 
#chains in the Genus database with same CATH topology
 3H1J J;  1BSN A;  1PP9 E;  1XTG B;  3H1L G;  4PV1 B;  5AW1 B;  5AW8 B;  4H44 C;  2NPS C;  3H1K D;  2WSC H;  3E7K A;  5AW9 B;  1FZB A;  1KYO E;  3GLM A;  1KOR A;  4OGQ C;  1HWT C;  3GW6 A;  1IJD B;  3CWB E;  3HE4 A;  1VQ8 P;  1LT9 A;  1S3J A;  3L37 A;  2OYH A;  4JQ0 D;  3M0D C;  2JWA A;  5KAI E;  3AE4 C;  2RN0 A;  1URQ A;  3H1I E;  4WY4 C;  3L75 G;  1PGO A;  2JP3 A;  3M91 A;  1FS0 E;  1FU1 A;  3P32 A;  1Q90 D;  4LGD E;  1FJP A;  2FY8 A;  1YIT P;  4I2L C;  2GM4 A;  2E75 C;  2JR8 A;  3MUD C;  5APT A;  3SWF A;  5BVZ A;  1SQB J;  1YQ4 C;  2N9Y B;  2V7Q H;  4HYT B;  3CXH H;  3FX0 A;  3HTK A;  3L75 J;  1SQX K;  3RK3 E;  2HR3 A;  3VMY A;  2E5Y A;  2A45 H;  1ZLL A;  1GW3 A;  1T6A A;  3EFG A;  3GHG C;  3HTK B;  2K1A A;  3SFD C;  1Y9B A;  1EC5 A;  2RMZ A;  4TT3 H;  1GU4 A;  2POH A;  3TNU A;  4JPZ B;  1NTZ D;  2K9Y A;  3H1H D;  1Y8A A;  1QEX A;  2FYN C;  4OH8 B;  3U1A A;  5APU A;  3VP9 A;  3BCC J;  1BE3 G;  5GTH E;  4K3A A;  1YHQ P;  1FZC C;  1GMJ A;  1HJ0 A;  2C9L Y;  2PRR A;  2BCC G;  5KLI C;  4IL6 H;  3RK3 B;  1NAF A;  1SQX J;  1BGY D;  1KIL E;  2C0X A;  2LXB A;  2WSC J;  3WU2 E;  3CC7 P;  2O1J A;  3WMM 0;  1AVO A;  2ZYG A;  3O8Z A;  4R4M A;  4KJM A;  3LW5 H;  5KLV D;  2K3R A;  3Q3D A;  4W80 A;  3CCJ P;  2Y0C A;  1M1K Q;  1FBM A;  3L71 D;  1ZOY C;  1JCC A;  2XDJ A;  2ZT9 D;  3CXH D;  5AVY B;  1LP1 B;  5GTI E;  2ZJS E;  3W68 A;  4YXW H;  4ZMD A;  4YTP C;  1K8A Q;  1KIL B;  2L91 A;  5KJ7 A;  1KD1 Q;  1GL2 A;  4IFM A;  1KV4 A;  2KIK A;  3L75 E;  2M0B A;  4BWN A;  2N1T B;  3A2A A;  1L0L E;  2XNX A;  1QX8 A;  1NKZ B;  3H1L J;  1A02 J;  1GL2 B;  1PGQ A;  1LTA C;  3A3Y B;  2M8R A;  3Q1M A;  5KTB A;  2XU6 A;  5KAF H;  1HGZ A;  2KP8 A;  2MJZ A;  2P1J A;  1U57 A;  2WZ7 A;  3CWB J;  3L74 E;  1IFN A;  1GTW A;  2E42 A;  1N7S A;  1LT9 C;  1T3J A;  3Q2Y A;  3P7K A;  3JC2 2;  3CX5 E;  1E79 H;  1FZA A;  2YNY A;  2B87 A;  1PFI A;  1J1E B;  2YXQ B;  1W5C E;  3QH9 A;  3N7N A;  3M0A A;  1VQN P;  1PP9 J;  2KSJ A;  1SQV J;  4GKG A;  4R4L A;  4U3F G;  1DX7 A;  4Y28 J;  1NWQ A;  5KKZ C;  3HE5 B;  2Y0D A;  4PJ0 E;  2NPS D;  5CCG C;  4ZKP A;  3L70 D;  1SLQ A;  4C7N B;  1RQU A;  3H1J E;  5AVV B;  1L4A A;  3EFF K;  1NTZ E;  2PFX A;  3TK1 A;  2QJK C;  1LTJ B;  1FDI A;  2Q5U A;  1RE3 A;  1L0L G;  1J2J B;  1FC2 C;  4Y99 C;  4YXD C;  2E74 B;  2FYN B;  4I1L A;  2VRS A;  1RF1 A;  1FOS F;  3L73 J;  4U3F D;  1EQ7 A;  5APY A;  3P8C E;  2J5U A;  2BAS A;  1JY3 N;  3AE6 C;  3CCM P;  3GHG B;  3RL0 B;  1AQT A;  1RF0 A;  1SFC A;  1BCC D;  1L0N K;  1X0T A;  2FBW C;  2LXC B;  1MKM A;  2M5A A;  2XV5 A;  2IZ1 A;  2QA4 P;  2OQQ A;  3KZI H;  5APX A;  5K5G B;  2IBZ E;  2WPS A;  1LWU A;  2LR2 A;  2Q6Q A;  1IFM A;  1LP1 A;  1RH5 B;  1M56 D;  2JKV A;  2E75 B;  2J59 M;  2R5D A;  4WY4 A;  5L8R J;  3SSU A;  1ZME C;  1OVU A;  1JM0 A;  4PD4 H;  1KIL A;  3M0D A;  4GOF A;  5AVU B;  4AYC A;  4JYB A;  3B8E B;  2KNC A;  3PP5 A;  3Q5S A;  3AE5 C;  1KN7 A;  1S9K D;  2N1T A;  2JO1 A;  5E79 H;  3O6Q A;  1H0T A;  1SQQ K;  1JEK A;  2IBZ G;  1HVV A;  1NTM J;  1T8Z A;  5KLV K;  1EDJ A;  1NTK J;  1LWU C;  4UB6 H;  3K5B A;  2W6J H;  2A45 I;  3A0B H;  5CCH A;  1NAY A;  3BCC E;  3H1L E;  2CPB A;  2O01 H;  1N7S B;  3L72 E;  4PV1 C;  1SQX G;  5KLV G;  3AEB C;  2BCC D;  3H1H E;  5C39 A;  3L73 E;  1G2C A;  4HKZ H;  1FAV A;  2RH0 A;  4U3F E;  1L0L D;  2GA1 A;  1U7M A;  2FYU G;  2QJP C;  3NMD A;  4B86 A;  2NZ2 A;  1H88 A;  1HF9 A;  2KYV A;  4CPG A;  3AE7 C;  1L2P A;  1N73 C;  1NTM K;  1NTZ G;  2D2C D;  3BAT A;  3RL0 g;  3L70 G;  3WUU A;  2E43 A;  3H6P A;  4PJ0 H;  3ITK A;  1X8Y A;  1BGY G;  1SQP E;  2O3J A;  1JUN A;  1N2D C;  2K37 A;  2OTK E;  3L73 G;  2W27 A;  3NFQ A;  1N73 B;  1OW7 A;  1RF1 B;  1VQM P;  1RHZ B;  2AEJ A;  1NJI Q;  2YXR B;  1VQ6 P;  1E5W A;  2FXP A;  1NTZ J;  1CI6 A;  1NYH A;  3MTU E;  3TGU J;  2ZYD A;  1YJW P;  5GTH H;  1NU1 J;  3BCC D;  1QLE D;  4UB8 H;  2M5A B;  1VQL P;  3MGN A;  1N7S C;  2G3A A;  3FWN A;  4N6J A;  2WSF J;  2GUV A;  3AE3 C;  5E79 E;  1ZR4 A;  3JSV C;  1IFJ A;  3V2R A;  2K9J B;  1KTM A;  1VQ7 P;  2HG5 D;  3CCR P;  1L0N G;  5AVZ B;  4DJG A;  4IL6 X;  1M8O B;  2ZAE B;  1M1J C;  3E1R A;  3IF4 A;  3V4W A;  2FFD C;  2Z4E A;  4GOE A;  2ZFC A;  3M9B A;  2V4H A;  3B5N B;  2IFM A;  5KLV J;  5CCG A;  1QVF O;  1JY2 P;  4M3L A;  3EQ2 A;  1M90 Q;  1GW4 A;  3L71 J;  4HJG H;  1AV1 A;  2KZJ A;  3SWY A;  1OMI A;  1SFC C;  1WT6 A;  1IFP A;  1NHL A;  4HB1 A;  1KC8 Q;  2OGU A;  1DEE G;  5KLV E;  3HD7 B;  3PTZ A;  4IFD K;  2QEX P;  1YTZ T;  2AXC A;  2QIW A;  4QMA A;  4EOT A;  1RE3 C;  1KQF B;  1KB9 D;  3I5C A;  1OXZ A;  3A0B E;  4UB8 E;  2A06 D;  1MV8 A;  1JNM A;  4YPC A;  1LGH B;  4Y99 B;  2R3C A;  1USE A;  1NU1 G;  2P58 A;  4I7Z B;  1TU3 F;  4XFJ A;  1L4A D;  2JJL A;  3AED C;  1NTM G;  2PGD A;  2QJY C;  3B71 A;  3BRT B;  2W8Z A;  1PIX A;  2FXO A;  1S5L H;  3D71 A;  2M3B A;  3ABV C;  4GOD A;  1GK6 A;  3LW5 J;  5CMZ A;  2KXP B;  5KAF E;  2R5B A;  3FWL A;  2O1K A;  3L70 J;  1LT9 B;  1N7S D;  2G8Y A;  1OIP A;  3BVH A;  3WUV A;  2IFN A;  3AE2 C;  3SWK A;  3IR9 A;  3B5N C;  1KQS O;  1OW6 A;  1DD3 A;  2W90 A;  1YJ9 P;  1FJK A;  2KS1 A;  1K04 A;  1GL2 C;  1SQV G;  4U3F J;  4MN4 C;  1R5L A;  1M1J B;  5APQ A;  4I6M C;  3I55 P;  2HPC B;  2FFD B;  4UB6 E;  4GT1 A;  3L72 D;  1WRG A;  1OX3 A;  1GDT A;  1KB9 H;  1GL2 D;  2N9B A;  1RE4 C;  3PH0 A;  4H13 C;  4XE5 B;  1M1J A;  4ASW A;  2YKO A;  3H1I J;  2FFD A;  2QVA A;  4DOJ A;  2I1J A;  3CMA P;  4K35 A;  1Q86 Q;  1FZF A;  2R44 A;  4BXL A;  3II6 A;  2Q1K A;  3CI9 A;  1VDF A;  2SPZ A;  3C8V A;  1AFO A;  2P7J A;  1ZW0 A;  1FZE A;  3HD7 A;  3M06 A;  3RL0 D;  1PPJ D;  1KZU B;  1YTZ I;  3F89 A;  1IFD A;  4IFF A;  4NPE A;  1GK4 A;  3NTN A;  4IL6 E;  3PLN A;  2YO3 A;  5AW3 B;  1H8A A;  1IZN B;  1LTS C;  1PPJ E;  1UII A;  3CX5 D;  5DJT B;  1S9K E;  1N86 A;  1ZRT E;  2FYU D;  2ZVN B;  1SQP D;  2H7H A;  3L74 J;  2NRG A;  2W6B A;  2A06 G;  4D6T J;  2KLU A;  3AEF C;  5H2F H;  3D6Z A;  2QJP B;  4EDF A;  2YIU B;  1IK9 A;  1LNQ A;  3RK3 D;  4RJT A;  4H44 D;  1NTK K;  2IYP A;  4OGQ D;  1NU1 K;  3C9I A;  2A45 G;  1SQQ D;  4ASV A;  5B66 E;  5GTI H;  3HE4 B;  1HH0 A;  3GF7 A;  3AE1 C;  1VQ5 P;  5CCH D;  1AVY A;  2LKM A;  3H1H G;  1MZ9 A;  2Z5H A;  3AEC C;  3AEE C;  3P8C D;  1NTK E;  1NTZ K;  4NPF X;  1SQB E;  5KJ7 D;  5M1B A;  1NOH A;  2C9N Y;  4EIJ A;  3OW2 O;  1BE3 J;  1EDI A;  1PP9 G;  5KAI H;  1H0T B;  5AVR B;  3SFE C;  5CBO A;  2XND H;  2E75 D;  2JWD A;  2QE7 H;  1IK7 A;  1AA0 A;  2J58 A;  3TYY A;  1KIL D;  1BGY E;  1JY2 N;  1OZH A;  4JYC A;  4AUW A;  3KPE A;  1L0N D;  1P84 H;  5AW2 B;  1LTG C;  3AEA C;  3O6Q B;  4U7J A;  1QGK B;  4WY4 D;  3VP8 A;  1KQL A;  2K88 A;  4H13 D;  1A02 F;  1SQB K;  1L0N E;  2ZT9 B;  1AQ5 A;  3CX5 H;  1BE3 E;  1PGP A;  2H8P D;  2FYZ A;  2DW3 A;  3KHU A;  1H89 A;  2C0W A;  3CME P;  1KFN A;  2WPV B;  1PP9 D;  1SQV D;  3GG2 A;  2CK3 H;  4OGQ B;  3PRJ A;  2O01 J;  1DH3 A;  1MUU A;  2E74 D;  4DZO A;  3W67 A;  1EXJ A;  4H44 B;  1RF0 C;  3E1I A;  2KOG A;  3VYI A;  2WT7 B;  1VPC A;  4OWF A;  3CCS P;  1Q2N A;  3IN6 A;  2E74 C;  1ZXG A;  2WWW A;  3TNU B;  2XKM A;  1YBK A;  3G4S P;  2PAJ A;  1J1D B;  1LTJ C;  2B9B A;  2E76 B;  2HFE D;  2YIU C;  3KXD A;  4AQR D;  2WTY A;  5AW6 B;  2W6A A;  1CW5 A;  1LTJ A;  4W7Z A;  3L73 D;  3CCQ P;  2KZI A;  3AE9 C;  5KKZ B;  2ZXX A;  3EWK A;  1USD A;  5BU8 B;  1BSH A;  1JB0 J;  4L75 A;  2Q7C A;  1JTH A;  2JEE A;  3OAK A;  5EFW B;  3VOP A;  1J1E C;  1VQK P;  2WSE H;  1FOS E;  3HD7 D;  5APV A;  1SP4 A;  5AW5 B;  3H1J D;  1ZR2 A;  4L74 A;  3H25 A;  2OTL P;  1EZV D;  1NTM E;  1P84 E;  3IAO A;  3NXS A;  3H1K J;  4A7P A;  3CLQ A;  5AVS B;  1GD2 E;  5TIS H;  2AXT E;  1QVG O;  1X9V A;  3S1K A;  1JY3 P;  2HPC A;  1EZV I;  1VL2 A;  1DEB A;  1S5L X;  3VN0 A;  1GU5 A;  3OA7 A;  3CC4 P;  1NTK D;  1UIX A;  1BDD A;  1KB9 I;  1KIL C;  2I1K A;  4N78 E;  4RES B;  4TLF A;  5APW A;  3FXD A;  3RK2 C;  3A7O A;  1SQV K;  1HTL C;  1HUC A;  1X22 A;  1OWA A;  1S2E A;  2H89 C;  2WIT A;  2WSS H;  3KYQ A;  4RKU J;  3RK2 D;  3R2P A;  2B87 B;  2BCC J;  2FYU K;  4WVZ A;  1BCC E;  1SQB D;  1S4X A;  2KLV A;  4Z1M H;  1L0L J;  3BCC G;  3M9Q A;  1LTI C;  1G2C B;  3CXH I;  1OVR A;  5AW7 B;  1PZQ A;  3S4R A;  4BRY B;  5AVX B;  4D6T E;  1NKN A;  4C7N A;  3RBX A;  2WT7 A;  1L4A B;  1Q7Y Q;  2IDB A;  1IFI A;  1ZRT D;  2QM7 A;  3U1C A;  3C1L A;  3H1H J;  1KQG B;  3A5T A;  1K05 A;  2Q3E A;  3HE5 A;  1R8E A;  1PV3 A;  4I7Z C;  4O9B A;  5TIS E;  3L70 E;  3TGU G;  1J1D C;  1NH4 A;  2E76 C;  2KB7 P;  2WSE J;  3CCL P;  3RGU A;  1S1C X;  3TGU D;  1FZC B;  2YO2 A;  3G3Z A;  2E5T A;  2HLO A;  2RKL A;  2E76 D;  4JF7 A;  1NU1 D;  1SQX D;  2AEM A;  1KYO H;  1CI6 B;  1BGY J;  1JTH B;  5BU5 A;  2B88 A;  2XZR A;  2ZYA A;  4L76 A;  3RBZ A;  3FXE A;  1NGM B;  1SQX E;  1HGV A;  3M9H A;  3HD7 C;  4KHX A;  2W83 C;  2OAR A;  3GHG A;  1EDL A;  1SQP K;  2B89 A;  1SQP J;  1SFC B;  2ZT9 C;  3KZI E;  3L74 D;  3VTP C;  1JOC A;  3TF5 A;  1M57 D;  3HUS A;  1IC2 A;  4D6T D;  3Q5R A;  1EXI A;  2FKW B;  2IBZ D;  4PD4 E;  2ZVO B;  5CCG D;  3B4S A;  1HBW A;  1HJB A;  2FXM A;  2PP6 A;  1URQ D;  3HUS B;  3H1J G;  3L71 G;  3MUD A;  4WY4 B;  5TJH A;  2OTJ P;  3CCV P;  3MHV A;  1LTT C;  1NTK G;  2OYO A;  3CCE P;  1SQQ J;  5KJ7 C;  4C7R A;  1N7L A;  2QM8 A;  1RQV A;  3A0H E;  2KNC B;  1OVV A;  2Y0E A;  1YYC A;  2QRX A;  1WMK A;  3H1I G;  3H1L D;  2Z5I A;  3H32 A;  1FE6 A;  3L74 G;  3MP7 B;  4PV1 D;  1OW8 A;  2KUB A;  4XA4 A;  3CPW O;  5H2F E;  1S72 P;  2P2U A;  4EI2 A;  2YMK A;  2NPS B;  3D70 A;  2KK7 A;  2QSI A;  3CWB D;  1EZV G;  2Y9Z A;  3P8M C;  4H0L B;  1NVO A;  2P10 A;  2NPS A;  1KYO D;  1JY2 O;  4D6T G;  3G6E P;  4BRY A;  4OVN F;  3S9O A;  1IO4 A;  1JCD A;  4HH2 A;  1PGJ A;  2L5G B;  1KYO I;  2D2C B;  3WU2 H;  1VF5 B;  1ZV8 A;  4ZNC A;  1VQ4 P;  1NO4 A;  2D2C C;  1CSB A;  5CJ0 A;  3Q5P A;  2QG4 A;  1YJN P;  3MZW B;  1MFZ A;  2KSE A;  3USS A;  3LID A;  1LT1 A;  3ZDM A;  1FZC A;  1AJY A;  3TDK A;  4LLH A;  2JDI H;  1ZN5 A;  3JCU H;  3OJA B;  4JBZ A;  2WVR A;  1SQB G;  4DCK A;  3G9R A;  1QL2 A;  3A0H H;  1XTC C;  3GF3 A;  1RE4 A;  3L75 D;  3L72 G;  2M3E A;  4KT0 J;  2UWJ E;  2R32 A;  2OYI C;  1BCC J;  4GDO A;  4WB4 A;  5CBN A;  4LC1 A;  1LWU B;  4H13 B;  1Z56 A;  2IYO A;  4N3Y B;  1SQQ E;  3L72 J;  4WWI A;  3L36 A;  3B5N A;  2K9J A;  3PJS K;  5B5E H;  2N1T D;  4N78 D;  2BCC E;  3H1I D;  4L73 A;  3GMA A;  1URQ C;  3HUS C;  3CX5 I;  1R5S A;  1FDO A;  3HRN A;  1G1I A;  1K73 Q;  1SVF A;  2P67 A;  3BAS A;  2OYH C;  1YIJ P;  3CC2 P;  2WQY C;  3JCU E;  3N4X A;  4EYY Q;  3H32 B;  5CHX A;  5AW4 B;  2R3S A;  2MKV A;  1EZV E;  1NTM D;  1P84 D;  2ITA A;  1BDC A;  1DD4 A;  3FGA D;  1SFC D;  3AEG C;  2KI7 B;  3LIE A;  3MIW A;  3RL0 C;  1KB9 E;  4WBA A;  3V2P A;  1JO5 A;  3L4F A;  2QJY B;  2WSF H;  3BRV B;  3KDP B;  2FYU J;  1JMB A;  1BCC G;  1VF5 D;  1PPJ G;  1VQ9 P;  1M7L A;  2HOD B;  1SQP G;  3VMX A;  3V2Q A;  3TSI A;  1W2E A;  2QJK B;  1G1J A;  1LJ2 A;  3T97 B;  1EDK A;  2Y9Y A;  2I8D A;  4DT0 A;  3KQG A;  3QWO C;  2BEZ F;  5B66 H;  5B5E E;  2WPR A;  4H0L D;  1T2K D;  1N73 A;  2IBZ I;  1L4A C;  3VMZ A;  1S5L E;  2CPS A;  5AVQ B;  1GZL A;  1KFM A;  2YKP A;  3F5H A;  4C46 A;  3UIA A;  3I56 P;  3L35 A;  3PHL A;  5DJU B;  4PD4 D;  5CCH C;  3G71 P;  1W2B O;  1MFT A;  2O01 N;  1Q81 Q;  1DIP A;  3L71 E;  1BE3 D;  1Y47 A;  5APS A;  3MD0 A;  1Q82 Q;  3V5B A;  1KMI Z;  2OYH B;  1VQP P;  2ZXE B;  1VQO P;  4IOI H;  1URQ B;  1L0N J;  3V6I A;  1JMM A;  1YQ3 C;  1L0L K;  2A06 E;  2AXT H;  2H88 C;  3RK2 B;  1P84 I;  3B5N D;  2IX7 C;  2N1T C;  4W7Y A;  3H1K E;  3TGU E;  3V2N A;  1NU1 E;  2KS1 B;  3CCU P;  2H43 A;  2IPP A;  1N8R Q;  5AW0 B;  3AE8 C;  3VMA A;  2OYI B;  3D6Y A;  1LTB C;  1K9M Q;  1OFC X;  1YI2 P;  2HYN A;  3WUT A;  1T3U A;  1SQQ G;  2OYI A;  4PD4 I;  3U59 A;  2IZ0 A;  3V4Q A;  2GUS A;  4RO0 A;  3CL3 D;  3H1K G;  1FZG A;  2Q9I A;  4NPD A;  1D7M A;  2AEF A;  2BEQ D;  1U7J A;  4GIF A;  1CZQ A;  1RY3 A;  1RF1 C;  1ZP0 C;  2WMM A;  1FDM A;  2V7Q J;  3R4Y A;  1PL5 A;  5CJ4 A;  1X79 B;  1VF5 C;  4ZKU A;  3IFM A;  1JY3 O;  2Q3I A;  2YMY A;  2YKQ A;  2HOD A;  3CXH E;  3RK3 C;  1SQV E;  5KLI B;  2FYU E;  1QL1 A;  3CWB G;  2WPQ A;  5AVW B;  5AVT B;  3T97 A;  3CD6 P;  1SS1 A;  1T2K C;  4H0L C; 
#chains in the Genus database with same CATH homology
 2M3E A;  2K1A A;  2KNC A;  2K9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...